data_3M0N # _entry.id 3M0N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3M0N pdb_00003m0n 10.2210/pdb3m0n/pdb RCSB RCSB057958 ? ? WWPDB D_1000057958 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2a0s 'Crystal structure of 6-pyruvoyl tetrahydropterin synthase (PTPS) from Plasmodium vivax at 2.2 A resolution' unspecified PDB 3lx3 'Plasmodium vivax 6-pyruvoyltetrahydropterin synthase (PTPS) in complex with xanthopterin' unspecified PDB 1y13 'Structural Analysis of Plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (PTPS)' unspecified PDB 3LZE 'Plasmodium vivax 6-pyruvoyltetrahydropterin synthase (PTPS), E37C catalytic residue mutant' unspecified TargetDB Pviv004546AAA . unspecified # _pdbx_database_status.entry_id 3M0N _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-03-03 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Larson, E.T.' 1 'Merritt, E.A.' 2 'Medical Structural Genomics of Pathogenic Protozoa (MSGPP)' 3 # _citation.id primary _citation.title 'Structural analysis of the dual-functional 6-pyruvoyltetrahydropterin synthase from Malaria parasites.' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Larson, E.T.' 1 ? primary 'Bosch, J.' 2 ? primary 'Kim, J.E.' 3 ? primary 'Kelley, A.' 4 ? primary 'Castaneda, L.' 5 ? primary 'Napuli, A.' 6 ? primary 'Mueller, N.' 7 ? primary 'Verlinde, C.L.M.J.' 8 ? primary 'Van Voorhis, W.C.' 9 ? primary 'Buckner, F.S.' 10 ? primary 'Fan, E.' 11 ? primary 'Hol, W.G.J.' 12 ? primary 'Merritt, E.A.' 13 ? # _cell.length_a 131.750 _cell.length_b 131.750 _cell.length_c 74.240 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 3M0N _cell.pdbx_unique_axis ? _cell.Z_PDB 18 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'H 3 2' _symmetry.entry_id 3M0N _symmetry.Int_Tables_number 155 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative 6-pyruvoyl tetrahydrobiopterin synthase' 20934.863 1 4.2.3.12 E37A ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn PTERINE 163.137 1 ? ? ? ? 4 water nat water 18.015 59 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMNPHPVEPRDQIAELLVESPLFSFNCAHFIAFKGFRATLHGHNYNVSLRLRGNIQGDGYVIDFSILKEKVRK VCKQLDHHFILPMYSDVLNIQEVNDNFKITCEDNSEYSFPKRDCVQIPIKHSSTEEIGLYILNQLIEEIDLPFLKTRSVN YMEVTVSESPSQKATVHRNI ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMNPHPVEPRDQIAELLVESPLFSFNCAHFIAFKGFRATLHGHNYNVSLRLRGNIQGDGYVIDFSILKEKVRK VCKQLDHHFILPMYSDVLNIQEVNDNFKITCEDNSEYSFPKRDCVQIPIKHSSTEEIGLYILNQLIEEIDLPFLKTRSVN YMEVTVSESPSQKATVHRNI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier Pviv004546AAA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 ASN n 1 11 PRO n 1 12 HIS n 1 13 PRO n 1 14 VAL n 1 15 GLU n 1 16 PRO n 1 17 ARG n 1 18 ASP n 1 19 GLN n 1 20 ILE n 1 21 ALA n 1 22 GLU n 1 23 LEU n 1 24 LEU n 1 25 VAL n 1 26 GLU n 1 27 SER n 1 28 PRO n 1 29 LEU n 1 30 PHE n 1 31 SER n 1 32 PHE n 1 33 ASN n 1 34 CYS n 1 35 ALA n 1 36 HIS n 1 37 PHE n 1 38 ILE n 1 39 ALA n 1 40 PHE n 1 41 LYS n 1 42 GLY n 1 43 PHE n 1 44 ARG n 1 45 ALA n 1 46 THR n 1 47 LEU n 1 48 HIS n 1 49 GLY n 1 50 HIS n 1 51 ASN n 1 52 TYR n 1 53 ASN n 1 54 VAL n 1 55 SER n 1 56 LEU n 1 57 ARG n 1 58 LEU n 1 59 ARG n 1 60 GLY n 1 61 ASN n 1 62 ILE n 1 63 GLN n 1 64 GLY n 1 65 ASP n 1 66 GLY n 1 67 TYR n 1 68 VAL n 1 69 ILE n 1 70 ASP n 1 71 PHE n 1 72 SER n 1 73 ILE n 1 74 LEU n 1 75 LYS n 1 76 GLU n 1 77 LYS n 1 78 VAL n 1 79 ARG n 1 80 LYS n 1 81 VAL n 1 82 CYS n 1 83 LYS n 1 84 GLN n 1 85 LEU n 1 86 ASP n 1 87 HIS n 1 88 HIS n 1 89 PHE n 1 90 ILE n 1 91 LEU n 1 92 PRO n 1 93 MET n 1 94 TYR n 1 95 SER n 1 96 ASP n 1 97 VAL n 1 98 LEU n 1 99 ASN n 1 100 ILE n 1 101 GLN n 1 102 GLU n 1 103 VAL n 1 104 ASN n 1 105 ASP n 1 106 ASN n 1 107 PHE n 1 108 LYS n 1 109 ILE n 1 110 THR n 1 111 CYS n 1 112 GLU n 1 113 ASP n 1 114 ASN n 1 115 SER n 1 116 GLU n 1 117 TYR n 1 118 SER n 1 119 PHE n 1 120 PRO n 1 121 LYS n 1 122 ARG n 1 123 ASP n 1 124 CYS n 1 125 VAL n 1 126 GLN n 1 127 ILE n 1 128 PRO n 1 129 ILE n 1 130 LYS n 1 131 HIS n 1 132 SER n 1 133 SER n 1 134 THR n 1 135 GLU n 1 136 GLU n 1 137 ILE n 1 138 GLY n 1 139 LEU n 1 140 TYR n 1 141 ILE n 1 142 LEU n 1 143 ASN n 1 144 GLN n 1 145 LEU n 1 146 ILE n 1 147 GLU n 1 148 GLU n 1 149 ILE n 1 150 ASP n 1 151 LEU n 1 152 PRO n 1 153 PHE n 1 154 LEU n 1 155 LYS n 1 156 THR n 1 157 ARG n 1 158 SER n 1 159 VAL n 1 160 ASN n 1 161 TYR n 1 162 MET n 1 163 GLU n 1 164 VAL n 1 165 THR n 1 166 VAL n 1 167 SER n 1 168 GLU n 1 169 SER n 1 170 PRO n 1 171 SER n 1 172 GLN n 1 173 LYS n 1 174 ALA n 1 175 THR n 1 176 VAL n 1 177 HIS n 1 178 ARG n 1 179 ASN n 1 180 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PVX_114505 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details 'E37A mutation confirmed from plasmid DNA sequence' _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium vivax' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5855 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BG1861 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A5K2B2_PLAVI _struct_ref.pdbx_db_accession A5K2B2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNPHPVEPRDQIAELLVESPLFSFNCAHFIAFKGFRETLHGHNYNVSLRLRGNIQGDGYVIDFSILKEKVRKVCKQLDHH FILPMYSDVLNIQEVNDNFKITCEDNSEYSFPKRDCVQIPIKHSSTEEIGLYILNQLIEEIDLPFLKTRSVNYMEVTVSE SPSQKATVHRNI ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3M0N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A5K2B2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 172 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 172 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3M0N MET A 1 ? UNP A5K2B2 ? ? 'expression tag' -7 1 1 3M0N ALA A 2 ? UNP A5K2B2 ? ? 'expression tag' -6 2 1 3M0N HIS A 3 ? UNP A5K2B2 ? ? 'expression tag' -5 3 1 3M0N HIS A 4 ? UNP A5K2B2 ? ? 'expression tag' -4 4 1 3M0N HIS A 5 ? UNP A5K2B2 ? ? 'expression tag' -3 5 1 3M0N HIS A 6 ? UNP A5K2B2 ? ? 'expression tag' -2 6 1 3M0N HIS A 7 ? UNP A5K2B2 ? ? 'expression tag' -1 7 1 3M0N HIS A 8 ? UNP A5K2B2 ? ? 'expression tag' 0 8 1 3M0N ALA A 45 ? UNP A5K2B2 GLU 37 'engineered mutation' 37 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PE0 non-polymer . PTERINE ? 'C6 H5 N5 O' 163.137 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.crystals_number 1 _exptl.entry_id 3M0N _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.96 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 58.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.2 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details ;2 ul 25 mg/ml protein (in SGPP buffer) mixed with 2 ul 0.1 M sodium acetate (pH 5.2), 28% PEG 3350, 5 mM DTT; cryoprotected by 5 sec dip in 96 mM sodium acetate (pH 5.2), 24% PEG 3350, 134 mM NaCl, 20% glycerol, vapor diffusion, hanging drop, temperature 298K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.pdbx_collection_date 2010-02-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator crystal _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL9-2 # _reflns.entry_id 3M0N _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 50.000 _reflns.number_obs 19474 _reflns.pdbx_Rmerge_I_obs 0.079 _reflns.pdbx_netI_over_sigmaI 12.900 _reflns.pdbx_chi_squared 1.064 _reflns.pdbx_redundancy 9.300 _reflns.percent_possible_obs 99.800 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 5 _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate 43 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.97 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.683 _reflns_shell.meanI_over_sigI_obs 2.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.980 _reflns_shell.pdbx_redundancy 9.40 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1947 _reflns_shell.percent_possible_all 100.00 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3M0N _refine.ls_d_res_high 1.900 _refine.ls_d_res_low 35.300 _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.680 _refine.ls_number_reflns_obs 19465 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS; U VALUES: WITH TLS ADDED. Identity of ligand in active site unknown but clear density for pterine ring of substrate or product present so modeled as such ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.198 _refine.ls_R_factor_R_work 0.196 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.225 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.200 _refine.ls_number_reflns_R_free 1011 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 49.913 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -2.450 _refine.aniso_B[2][2] -2.450 _refine.aniso_B[3][3] 3.670 _refine.aniso_B[1][2] -1.220 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.947 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.128 _refine.pdbx_overall_ESU_R_Free 0.122 _refine.overall_SU_ML 0.089 _refine.overall_SU_B 6.565 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.400 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model '3lx3, ligand removed and with E37 mutated to A' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 108.34 _refine.B_iso_min 23.57 _refine.occupancy_max 1.00 _refine.occupancy_min 0.40 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1364 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 1439 _refine_hist.d_res_high 1.900 _refine_hist.d_res_low 35.300 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1411 0.010 0.022 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 962 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1917 1.243 1.961 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 2351 0.806 3.001 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 173 6.283 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 74 38.270 24.459 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 256 13.130 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 9 22.495 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 212 0.076 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1571 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 287 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 833 1.976 4.000 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 331 0.642 4.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1368 2.892 6.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 578 3.354 6.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 543 5.070 10.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.90 _refine_ls_shell.d_res_low 1.950 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 97.560 _refine_ls_shell.number_reflns_R_work 1325 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.256 _refine_ls_shell.R_factor_R_free 0.256 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 74 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1399 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3M0N _struct.title 'Plasmodium vivax 6-pyruvoyltetrahydropterin synthase (PTPS), E37A catalytic residue mutant' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3M0N _struct_keywords.text ;PTS, PTP SYNTHASE, PTPS, METAL-BINDING, TETRAHYDROBIOPTERIN BIOSYNTHESIS, FOLATE BIOSYNTHESIS, Structural Genomics, Medical Structural Genomics of Pathogenic Protozoa, MSGPP, BIOSYNTHETIC PROTEIN ; _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 70 ? ASP A 86 ? ASP A 62 ASP A 78 1 ? 17 HELX_P HELX_P2 2 SER A 133 ? ASP A 150 ? SER A 125 ASP A 142 1 ? 18 HELX_P HELX_P3 3 ASP A 150 ? ARG A 157 ? ASP A 142 ARG A 149 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 36 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.127 ? ? metalc2 metalc ? ? A HIS 48 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 40 A ZN 201 1_555 ? ? ? ? ? ? ? 1.985 ? ? metalc3 metalc ? ? A HIS 50 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 1.979 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 201 A HOH 260 1_555 ? ? ? ? ? ? ? 2.600 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? C ? 2 ? D ? 2 ? E ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? parallel E 1 2 ? anti-parallel E 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 20 ? VAL A 25 ? ILE A 12 VAL A 17 A 2 HIS A 48 ? ASN A 61 ? HIS A 40 ASN A 53 A 3 SER A 31 ? HIS A 36 ? SER A 23 HIS A 28 B 1 ILE A 20 ? VAL A 25 ? ILE A 12 VAL A 17 B 2 HIS A 48 ? ASN A 61 ? HIS A 40 ASN A 53 B 3 TYR A 161 ? SER A 169 ? TYR A 153 SER A 161 B 4 GLN A 172 ? ASN A 179 ? GLN A 164 ASN A 171 C 1 ALA A 39 ? PHE A 40 ? ALA A 31 PHE A 32 C 2 PHE A 43 ? ARG A 44 ? PHE A 35 ARG A 36 D 1 PHE A 89 ? PRO A 92 ? PHE A 81 PRO A 84 D 2 CYS A 124 ? ILE A 127 ? CYS A 116 ILE A 119 E 1 LEU A 98 ? VAL A 103 ? LEU A 90 VAL A 95 E 2 ASN A 106 ? CYS A 111 ? ASN A 98 CYS A 103 E 3 GLU A 116 ? PRO A 120 ? GLU A 108 PRO A 112 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 25 ? N VAL A 17 O LEU A 56 ? O LEU A 48 A 2 3 O HIS A 50 ? O HIS A 42 N CYS A 34 ? N CYS A 26 B 1 2 N VAL A 25 ? N VAL A 17 O LEU A 56 ? O LEU A 48 B 2 3 N ASN A 53 ? N ASN A 45 O SER A 167 ? O SER A 159 B 3 4 N VAL A 166 ? N VAL A 158 O ALA A 174 ? O ALA A 166 C 1 2 N PHE A 40 ? N PHE A 32 O PHE A 43 ? O PHE A 35 D 1 2 N LEU A 91 ? N LEU A 83 O VAL A 125 ? O VAL A 117 E 1 2 N GLN A 101 ? N GLN A 93 O LYS A 108 ? O LYS A 100 E 2 3 N PHE A 107 ? N PHE A 99 O PHE A 119 ? O PHE A 111 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A PE0 202 ? 9 'BINDING SITE FOR RESIDUE PE0 A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 36 ? HIS A 28 . ? 1_555 ? 2 AC1 5 HIS A 48 ? HIS A 40 . ? 1_555 ? 3 AC1 5 HIS A 50 ? HIS A 42 . ? 1_555 ? 4 AC1 5 GLU A 168 ? GLU A 160 . ? 1_555 ? 5 AC1 5 HOH D . ? HOH A 260 . ? 1_555 ? 6 AC2 9 TYR A 67 ? TYR A 59 . ? 2_555 ? 7 AC2 9 ILE A 69 ? ILE A 61 . ? 2_555 ? 8 AC2 9 ASP A 70 ? ASP A 62 . ? 2_555 ? 9 AC2 9 PHE A 71 ? PHE A 63 . ? 2_555 ? 10 AC2 9 SER A 133 ? SER A 125 . ? 1_555 ? 11 AC2 9 THR A 134 ? THR A 126 . ? 1_555 ? 12 AC2 9 GLU A 135 ? GLU A 127 . ? 1_555 ? 13 AC2 9 GLU A 168 ? GLU A 160 . ? 1_555 ? 14 AC2 9 HOH D . ? HOH A 260 . ? 1_555 ? # _atom_sites.entry_id 3M0N _atom_sites.fract_transf_matrix[1][1] 0.007590 _atom_sites.fract_transf_matrix[1][2] 0.004382 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008764 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013470 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 ALA 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 HIS 8 0 ? ? ? A . n A 1 9 MET 9 1 ? ? ? A . n A 1 10 ASN 10 2 ? ? ? A . n A 1 11 PRO 11 3 ? ? ? A . n A 1 12 HIS 12 4 ? ? ? A . n A 1 13 PRO 13 5 ? ? ? A . n A 1 14 VAL 14 6 ? ? ? A . n A 1 15 GLU 15 7 ? ? ? A . n A 1 16 PRO 16 8 ? ? ? A . n A 1 17 ARG 17 9 ? ? ? A . n A 1 18 ASP 18 10 10 ASP ASP A . n A 1 19 GLN 19 11 11 GLN GLN A . n A 1 20 ILE 20 12 12 ILE ILE A . n A 1 21 ALA 21 13 13 ALA ALA A . n A 1 22 GLU 22 14 14 GLU GLU A . n A 1 23 LEU 23 15 15 LEU LEU A . n A 1 24 LEU 24 16 16 LEU LEU A . n A 1 25 VAL 25 17 17 VAL VAL A . n A 1 26 GLU 26 18 18 GLU GLU A . n A 1 27 SER 27 19 19 SER SER A . n A 1 28 PRO 28 20 20 PRO PRO A . n A 1 29 LEU 29 21 21 LEU LEU A . n A 1 30 PHE 30 22 22 PHE PHE A . n A 1 31 SER 31 23 23 SER SER A . n A 1 32 PHE 32 24 24 PHE PHE A . n A 1 33 ASN 33 25 25 ASN ASN A . n A 1 34 CYS 34 26 26 CYS CYS A . n A 1 35 ALA 35 27 27 ALA ALA A . n A 1 36 HIS 36 28 28 HIS HIS A . n A 1 37 PHE 37 29 29 PHE PHE A . n A 1 38 ILE 38 30 30 ILE ILE A . n A 1 39 ALA 39 31 31 ALA ALA A . n A 1 40 PHE 40 32 32 PHE PHE A . n A 1 41 LYS 41 33 33 LYS LYS A . n A 1 42 GLY 42 34 34 GLY GLY A . n A 1 43 PHE 43 35 35 PHE PHE A . n A 1 44 ARG 44 36 36 ARG ARG A . n A 1 45 ALA 45 37 37 ALA ALA A . n A 1 46 THR 46 38 38 THR THR A . n A 1 47 LEU 47 39 39 LEU LEU A . n A 1 48 HIS 48 40 40 HIS HIS A . n A 1 49 GLY 49 41 41 GLY GLY A . n A 1 50 HIS 50 42 42 HIS HIS A . n A 1 51 ASN 51 43 43 ASN ASN A . n A 1 52 TYR 52 44 44 TYR TYR A . n A 1 53 ASN 53 45 45 ASN ASN A . n A 1 54 VAL 54 46 46 VAL VAL A . n A 1 55 SER 55 47 47 SER SER A . n A 1 56 LEU 56 48 48 LEU LEU A . n A 1 57 ARG 57 49 49 ARG ARG A . n A 1 58 LEU 58 50 50 LEU LEU A . n A 1 59 ARG 59 51 51 ARG ARG A . n A 1 60 GLY 60 52 52 GLY GLY A . n A 1 61 ASN 61 53 53 ASN ASN A . n A 1 62 ILE 62 54 54 ILE ILE A . n A 1 63 GLN 63 55 55 GLN GLN A . n A 1 64 GLY 64 56 56 GLY GLY A . n A 1 65 ASP 65 57 57 ASP ASP A . n A 1 66 GLY 66 58 58 GLY GLY A . n A 1 67 TYR 67 59 59 TYR TYR A . n A 1 68 VAL 68 60 60 VAL VAL A . n A 1 69 ILE 69 61 61 ILE ILE A . n A 1 70 ASP 70 62 62 ASP ASP A . n A 1 71 PHE 71 63 63 PHE PHE A . n A 1 72 SER 72 64 64 SER SER A . n A 1 73 ILE 73 65 65 ILE ILE A . n A 1 74 LEU 74 66 66 LEU LEU A . n A 1 75 LYS 75 67 67 LYS LYS A . n A 1 76 GLU 76 68 68 GLU GLU A . n A 1 77 LYS 77 69 69 LYS LYS A . n A 1 78 VAL 78 70 70 VAL VAL A . n A 1 79 ARG 79 71 71 ARG ARG A . n A 1 80 LYS 80 72 72 LYS LYS A . n A 1 81 VAL 81 73 73 VAL VAL A . n A 1 82 CYS 82 74 74 CYS CYS A . n A 1 83 LYS 83 75 75 LYS LYS A . n A 1 84 GLN 84 76 76 GLN GLN A . n A 1 85 LEU 85 77 77 LEU LEU A . n A 1 86 ASP 86 78 78 ASP ASP A . n A 1 87 HIS 87 79 79 HIS HIS A . n A 1 88 HIS 88 80 80 HIS HIS A . n A 1 89 PHE 89 81 81 PHE PHE A . n A 1 90 ILE 90 82 82 ILE ILE A . n A 1 91 LEU 91 83 83 LEU LEU A . n A 1 92 PRO 92 84 84 PRO PRO A . n A 1 93 MET 93 85 85 MET MET A . n A 1 94 TYR 94 86 86 TYR TYR A . n A 1 95 SER 95 87 87 SER SER A . n A 1 96 ASP 96 88 88 ASP ASP A . n A 1 97 VAL 97 89 89 VAL VAL A . n A 1 98 LEU 98 90 90 LEU LEU A . n A 1 99 ASN 99 91 91 ASN ASN A . n A 1 100 ILE 100 92 92 ILE ILE A . n A 1 101 GLN 101 93 93 GLN GLN A . n A 1 102 GLU 102 94 94 GLU GLU A . n A 1 103 VAL 103 95 95 VAL VAL A . n A 1 104 ASN 104 96 96 ASN ASN A . n A 1 105 ASP 105 97 97 ASP ASP A . n A 1 106 ASN 106 98 98 ASN ASN A . n A 1 107 PHE 107 99 99 PHE PHE A . n A 1 108 LYS 108 100 100 LYS LYS A . n A 1 109 ILE 109 101 101 ILE ILE A . n A 1 110 THR 110 102 102 THR THR A . n A 1 111 CYS 111 103 103 CYS CYS A . n A 1 112 GLU 112 104 104 GLU GLU A . n A 1 113 ASP 113 105 105 ASP ASP A . n A 1 114 ASN 114 106 106 ASN ASN A . n A 1 115 SER 115 107 107 SER SER A . n A 1 116 GLU 116 108 108 GLU GLU A . n A 1 117 TYR 117 109 109 TYR TYR A . n A 1 118 SER 118 110 110 SER SER A . n A 1 119 PHE 119 111 111 PHE PHE A . n A 1 120 PRO 120 112 112 PRO PRO A . n A 1 121 LYS 121 113 113 LYS LYS A . n A 1 122 ARG 122 114 114 ARG ARG A . n A 1 123 ASP 123 115 115 ASP ASP A . n A 1 124 CYS 124 116 116 CYS CYS A . n A 1 125 VAL 125 117 117 VAL VAL A . n A 1 126 GLN 126 118 118 GLN GLN A . n A 1 127 ILE 127 119 119 ILE ILE A . n A 1 128 PRO 128 120 120 PRO PRO A . n A 1 129 ILE 129 121 121 ILE ILE A . n A 1 130 LYS 130 122 122 LYS LYS A . n A 1 131 HIS 131 123 123 HIS HIS A . n A 1 132 SER 132 124 124 SER SER A . n A 1 133 SER 133 125 125 SER SER A . n A 1 134 THR 134 126 126 THR THR A . n A 1 135 GLU 135 127 127 GLU GLU A . n A 1 136 GLU 136 128 128 GLU GLU A . n A 1 137 ILE 137 129 129 ILE ILE A . n A 1 138 GLY 138 130 130 GLY GLY A . n A 1 139 LEU 139 131 131 LEU LEU A . n A 1 140 TYR 140 132 132 TYR TYR A . n A 1 141 ILE 141 133 133 ILE ILE A . n A 1 142 LEU 142 134 134 LEU LEU A . n A 1 143 ASN 143 135 135 ASN ASN A . n A 1 144 GLN 144 136 136 GLN GLN A . n A 1 145 LEU 145 137 137 LEU LEU A . n A 1 146 ILE 146 138 138 ILE ILE A . n A 1 147 GLU 147 139 139 GLU GLU A . n A 1 148 GLU 148 140 140 GLU GLU A . n A 1 149 ILE 149 141 141 ILE ILE A . n A 1 150 ASP 150 142 142 ASP ASP A . n A 1 151 LEU 151 143 143 LEU LEU A . n A 1 152 PRO 152 144 144 PRO PRO A . n A 1 153 PHE 153 145 145 PHE PHE A . n A 1 154 LEU 154 146 146 LEU LEU A . n A 1 155 LYS 155 147 147 LYS LYS A . n A 1 156 THR 156 148 148 THR THR A . n A 1 157 ARG 157 149 149 ARG ARG A . n A 1 158 SER 158 150 150 SER SER A . n A 1 159 VAL 159 151 151 VAL VAL A . n A 1 160 ASN 160 152 152 ASN ASN A . n A 1 161 TYR 161 153 153 TYR TYR A . n A 1 162 MET 162 154 154 MET MET A . n A 1 163 GLU 163 155 155 GLU GLU A . n A 1 164 VAL 164 156 156 VAL VAL A . n A 1 165 THR 165 157 157 THR THR A . n A 1 166 VAL 166 158 158 VAL VAL A . n A 1 167 SER 167 159 159 SER SER A . n A 1 168 GLU 168 160 160 GLU GLU A . n A 1 169 SER 169 161 161 SER SER A . n A 1 170 PRO 170 162 162 PRO PRO A . n A 1 171 SER 171 163 163 SER SER A . n A 1 172 GLN 172 164 164 GLN GLN A . n A 1 173 LYS 173 165 165 LYS LYS A . n A 1 174 ALA 174 166 166 ALA ALA A . n A 1 175 THR 175 167 167 THR THR A . n A 1 176 VAL 176 168 168 VAL VAL A . n A 1 177 HIS 177 169 169 HIS HIS A . n A 1 178 ARG 178 170 170 ARG ARG A . n A 1 179 ASN 179 171 171 ASN ASN A . n A 1 180 ILE 180 172 172 ILE ILE A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Medical Structural Genomics of Pathogenic Protozoa' _pdbx_SG_project.initial_of_center MSGPP # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 3 PE0 1 202 202 PE0 PE0 A . D 4 HOH 1 211 211 HOH HOH A . D 4 HOH 2 212 212 HOH HOH A . D 4 HOH 3 213 213 HOH HOH A . D 4 HOH 4 214 214 HOH HOH A . D 4 HOH 5 215 215 HOH HOH A . D 4 HOH 6 216 216 HOH HOH A . D 4 HOH 7 217 217 HOH HOH A . D 4 HOH 8 218 218 HOH HOH A . D 4 HOH 9 219 219 HOH HOH A . D 4 HOH 10 220 220 HOH HOH A . D 4 HOH 11 221 221 HOH HOH A . D 4 HOH 12 222 222 HOH HOH A . D 4 HOH 13 223 223 HOH HOH A . D 4 HOH 14 224 224 HOH HOH A . D 4 HOH 15 225 225 HOH HOH A . D 4 HOH 16 226 226 HOH HOH A . D 4 HOH 17 227 227 HOH HOH A . D 4 HOH 18 228 228 HOH HOH A . D 4 HOH 19 229 229 HOH HOH A . D 4 HOH 20 230 230 HOH HOH A . D 4 HOH 21 231 231 HOH HOH A . D 4 HOH 22 232 232 HOH HOH A . D 4 HOH 23 233 233 HOH HOH A . D 4 HOH 24 234 234 HOH HOH A . D 4 HOH 25 235 235 HOH HOH A . D 4 HOH 26 236 236 HOH HOH A . D 4 HOH 27 237 237 HOH HOH A . D 4 HOH 28 238 238 HOH HOH A . D 4 HOH 29 239 239 HOH HOH A . D 4 HOH 30 240 240 HOH HOH A . D 4 HOH 31 241 241 HOH HOH A . D 4 HOH 32 242 242 HOH HOH A . D 4 HOH 33 243 243 HOH HOH A . D 4 HOH 34 244 244 HOH HOH A . D 4 HOH 35 245 245 HOH HOH A . D 4 HOH 36 246 246 HOH HOH A . D 4 HOH 37 247 247 HOH HOH A . D 4 HOH 38 248 248 HOH HOH A . D 4 HOH 39 249 249 HOH HOH A . D 4 HOH 40 250 250 HOH HOH A . D 4 HOH 41 251 251 HOH HOH A . D 4 HOH 42 252 252 HOH HOH A . D 4 HOH 43 253 253 HOH HOH A . D 4 HOH 44 254 254 HOH HOH A . D 4 HOH 45 255 255 HOH HOH A . D 4 HOH 46 256 256 HOH HOH A . D 4 HOH 47 257 257 HOH HOH A . D 4 HOH 48 258 258 HOH HOH A . D 4 HOH 49 259 259 HOH HOH A . D 4 HOH 50 260 260 HOH HOH A . D 4 HOH 51 261 261 HOH HOH A . D 4 HOH 52 262 262 HOH HOH A . D 4 HOH 53 263 263 HOH HOH A . D 4 HOH 54 264 264 HOH HOH A . D 4 HOH 55 265 265 HOH HOH A . D 4 HOH 56 266 266 HOH HOH A . D 4 HOH 57 267 267 HOH HOH A . D 4 HOH 58 268 268 HOH HOH A . D 4 HOH 59 269 269 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 15220 ? 1 MORE -54 ? 1 'SSA (A^2)' 37920 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 74.2400000000 5 'crystal symmetry operation' 5_556 x-y,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 74.2400000000 6 'crystal symmetry operation' 6_556 -x,-x+y,-z+1 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 74.2400000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 36 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 48 ? A HIS 40 ? 1_555 94.4 ? 2 NE2 ? A HIS 36 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 50 ? A HIS 42 ? 1_555 105.6 ? 3 NE2 ? A HIS 48 ? A HIS 40 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 50 ? A HIS 42 ? 1_555 110.5 ? 4 NE2 ? A HIS 36 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? D HOH . ? A HOH 260 ? 1_555 140.6 ? 5 NE2 ? A HIS 48 ? A HIS 40 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? D HOH . ? A HOH 260 ? 1_555 100.0 ? 6 NE2 ? A HIS 50 ? A HIS 42 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? D HOH . ? A HOH 260 ? 1_555 103.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-04-07 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-08 4 'Structure model' 1 3 2021-10-13 5 'Structure model' 1 4 2023-09-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' database_2 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.value' 8 4 'Structure model' '_struct_conn.pdbx_dist_value' 9 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_ref_seq_dif.details' 12 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 13 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 14 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 9.5388 6.0986 21.9497 0.1979 0.2290 0.2920 0.0648 0.0210 0.0209 13.3505 10.3278 27.0511 -8.7108 -12.7951 8.6638 -0.4367 0.5694 -0.1327 -0.3419 0.4754 -0.6725 -0.0036 0.6285 0.2843 'X-RAY DIFFRACTION' 2 ? refined -14.7093 19.3928 28.8699 0.2703 0.1863 0.1344 -0.0286 -0.0098 0.0255 3.6350 2.1646 4.4205 -0.0118 1.3545 1.1003 0.0215 0.0198 -0.0412 -0.2872 -0.2904 0.0936 -0.2389 0.1359 -0.4025 'X-RAY DIFFRACTION' 3 ? refined 5.7053 11.8458 24.0919 0.1960 0.1759 0.1924 0.0244 0.0561 0.0386 3.9568 0.7723 1.3308 -2.0145 -1.9408 0.9409 -0.0536 -0.0329 0.0865 0.1392 0.0648 -0.0441 -0.0080 0.0743 0.0299 'X-RAY DIFFRACTION' 4 ? refined 0.0078 22.9684 29.5249 0.1932 0.2548 0.1911 0.0143 0.0126 -0.0308 5.3803 3.4884 0.2400 -0.5237 -0.2841 1.1888 0.1432 0.1146 -0.2577 -0.1067 -0.0282 -0.6410 -0.0239 -0.0108 0.1902 'X-RAY DIFFRACTION' 5 ? refined -16.6808 34.7080 26.3585 0.2594 0.1963 0.0567 0.0061 -0.0124 0.0183 2.1488 0.8365 1.4146 0.3670 -0.0760 0.0590 0.0719 -0.1081 0.0363 0.0680 -0.1104 -0.1057 -0.2620 -0.1302 -0.2159 'X-RAY DIFFRACTION' 6 ? refined -23.0292 30.2682 30.8115 0.2537 0.2514 0.0772 0.0113 -0.0071 -0.0029 10.2266 5.0920 6.3126 3.7339 3.7603 1.9713 -0.1067 -0.0554 0.1621 0.2630 0.0642 0.3313 -0.1644 0.0101 -0.3692 'X-RAY DIFFRACTION' 7 ? refined -7.3609 24.1535 24.1311 0.2011 0.1625 0.1592 0.0012 0.0213 0.0293 1.0083 3.5515 1.8542 -1.3474 -0.3145 1.3272 0.1575 -0.0602 -0.0973 -0.0675 -0.1450 -0.1383 -0.2424 0.0130 0.1110 'X-RAY DIFFRACTION' 8 ? refined 3.5898 13.8379 17.9153 0.2332 0.1516 0.1932 0.0239 0.0335 0.0515 4.8426 2.6830 1.0488 0.4415 -1.1354 -0.6117 0.1433 -0.0802 -0.0632 0.1879 0.3810 -0.1484 -0.2637 -0.0061 0.0332 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 10 A 21 ? . . . . ? 'X-RAY DIFFRACTION' 2 2 A 22 A 36 ? . . . . ? 'X-RAY DIFFRACTION' 3 3 A 37 A 66 ? . . . . ? 'X-RAY DIFFRACTION' 4 4 A 67 A 85 ? . . . . ? 'X-RAY DIFFRACTION' 5 5 A 86 A 99 ? . . . . ? 'X-RAY DIFFRACTION' 6 6 A 100 A 111 ? . . . . ? 'X-RAY DIFFRACTION' 7 7 A 112 A 136 ? . . . . ? 'X-RAY DIFFRACTION' 8 8 A 137 A 172 ? . . . . ? # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 REFMAC refmac_5.5.0106 24/04/2001 program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 PDB_EXTRACT 3.100 'Jan. 22, 2010' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 Blu-Ice . ? ? ? ? 'data collection' ? ? ? 6 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 7 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 8 REFMAC 5.5.0106 ? ? ? ? phasing ? ? ? # _pdbx_entry_details.entry_id 3M0N _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'E37A MUTATION CONFIRMED FROM PLASMID DNA SEQUENCE' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 135 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 A _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 170 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 19 ? ? -172.72 145.58 2 1 ASN A 96 ? ? 49.92 -116.59 3 1 SER A 124 ? ? -79.54 47.44 4 1 ASP A 142 ? ? 93.81 121.07 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A ALA -6 ? A ALA 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A HIS 0 ? A HIS 8 9 1 Y 1 A MET 1 ? A MET 9 10 1 Y 1 A ASN 2 ? A ASN 10 11 1 Y 1 A PRO 3 ? A PRO 11 12 1 Y 1 A HIS 4 ? A HIS 12 13 1 Y 1 A PRO 5 ? A PRO 13 14 1 Y 1 A VAL 6 ? A VAL 14 15 1 Y 1 A GLU 7 ? A GLU 15 16 1 Y 1 A PRO 8 ? A PRO 16 17 1 Y 1 A ARG 9 ? A ARG 17 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PE0 C1 C Y N 250 PE0 C4 C Y N 251 PE0 O4 O N N 252 PE0 N2 N Y N 253 PE0 C3 C Y N 254 PE0 N6 N N N 255 PE0 N1 N Y N 256 PE0 C2 C Y N 257 PE0 N3 N Y N 258 PE0 C6 C Y N 259 PE0 C5 C Y N 260 PE0 N4 N Y N 261 PE0 HN2 H N N 262 PE0 HN61 H N N 263 PE0 HN62 H N N 264 PE0 H6 H N N 265 PE0 H5 H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TYR N N N N 338 TYR CA C N S 339 TYR C C N N 340 TYR O O N N 341 TYR CB C N N 342 TYR CG C Y N 343 TYR CD1 C Y N 344 TYR CD2 C Y N 345 TYR CE1 C Y N 346 TYR CE2 C Y N 347 TYR CZ C Y N 348 TYR OH O N N 349 TYR OXT O N N 350 TYR H H N N 351 TYR H2 H N N 352 TYR HA H N N 353 TYR HB2 H N N 354 TYR HB3 H N N 355 TYR HD1 H N N 356 TYR HD2 H N N 357 TYR HE1 H N N 358 TYR HE2 H N N 359 TYR HH H N N 360 TYR HXT H N N 361 VAL N N N N 362 VAL CA C N S 363 VAL C C N N 364 VAL O O N N 365 VAL CB C N N 366 VAL CG1 C N N 367 VAL CG2 C N N 368 VAL OXT O N N 369 VAL H H N N 370 VAL H2 H N N 371 VAL HA H N N 372 VAL HB H N N 373 VAL HG11 H N N 374 VAL HG12 H N N 375 VAL HG13 H N N 376 VAL HG21 H N N 377 VAL HG22 H N N 378 VAL HG23 H N N 379 VAL HXT H N N 380 ZN ZN ZN N N 381 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PE0 C1 C4 sing Y N 237 PE0 C1 C2 doub Y N 238 PE0 C1 N4 sing Y N 239 PE0 C4 O4 doub N N 240 PE0 C4 N2 sing Y N 241 PE0 N2 C3 sing Y N 242 PE0 N2 HN2 sing N N 243 PE0 C3 N6 sing N N 244 PE0 C3 N1 doub Y N 245 PE0 N6 HN61 sing N N 246 PE0 N6 HN62 sing N N 247 PE0 N1 C2 sing Y N 248 PE0 C2 N3 sing Y N 249 PE0 N3 C6 doub Y N 250 PE0 C6 C5 sing Y N 251 PE0 C6 H6 sing N N 252 PE0 C5 N4 doub Y N 253 PE0 C5 H5 sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TYR N CA sing N N 324 TYR N H sing N N 325 TYR N H2 sing N N 326 TYR CA C sing N N 327 TYR CA CB sing N N 328 TYR CA HA sing N N 329 TYR C O doub N N 330 TYR C OXT sing N N 331 TYR CB CG sing N N 332 TYR CB HB2 sing N N 333 TYR CB HB3 sing N N 334 TYR CG CD1 doub Y N 335 TYR CG CD2 sing Y N 336 TYR CD1 CE1 sing Y N 337 TYR CD1 HD1 sing N N 338 TYR CD2 CE2 doub Y N 339 TYR CD2 HD2 sing N N 340 TYR CE1 CZ doub Y N 341 TYR CE1 HE1 sing N N 342 TYR CE2 CZ sing Y N 343 TYR CE2 HE2 sing N N 344 TYR CZ OH sing N N 345 TYR OH HH sing N N 346 TYR OXT HXT sing N N 347 VAL N CA sing N N 348 VAL N H sing N N 349 VAL N H2 sing N N 350 VAL CA C sing N N 351 VAL CA CB sing N N 352 VAL CA HA sing N N 353 VAL C O doub N N 354 VAL C OXT sing N N 355 VAL CB CG1 sing N N 356 VAL CB CG2 sing N N 357 VAL CB HB sing N N 358 VAL CG1 HG11 sing N N 359 VAL CG1 HG12 sing N N 360 VAL CG1 HG13 sing N N 361 VAL CG2 HG21 sing N N 362 VAL CG2 HG22 sing N N 363 VAL CG2 HG23 sing N N 364 VAL OXT HXT sing N N 365 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 PTERINE PE0 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3LX3 _pdbx_initial_refinement_model.details '3lx3, ligand removed and with E37 mutated to A' #