data_3M11 # _entry.id 3M11 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3M11 RCSB RCSB057972 WWPDB D_1000057972 # _pdbx_database_status.entry_id 3M11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-03-03 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, J.S.' 1 'Leou, J.S.' 2 'Coumar, M.S.' 3 'Hsieh, H.P.' 4 'Wu, S.Y.' 5 # _citation.id primary _citation.title 'Fast-forwarding hit to lead: aurora and epidermal growth factor receptor kinase inhibitor lead identification' _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 53 _citation.page_first 4980 _citation.page_last 4988 _citation.year 2010 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20550212 _citation.pdbx_database_id_DOI 10.1021/jm1000198 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Coumar, M.S.' 1 primary 'Chu, C.Y.' 2 primary 'Lin, C.W.' 3 primary 'Shiao, H.Y.' 4 primary 'Ho, Y.L.' 5 primary 'Reddy, R.' 6 primary 'Lin, W.H.' 7 primary 'Chen, C.H.' 8 primary 'Peng, Y.H.' 9 primary 'Leou, J.S.' 10 primary 'Lien, T.W.' 11 primary 'Huang, C.T.' 12 primary 'Fang, M.Y.' 13 primary 'Wu, S.H.' 14 primary 'Wu, J.S.' 15 primary 'Chittimalla, S.K.' 16 primary 'Song, J.S.' 17 primary 'Hsu, J.T.' 18 primary 'Wu, S.Y.' 19 primary 'Liao, C.C.' 20 primary 'Chao, Y.S.' 21 primary 'Hsieh, H.P.' 22 # _cell.length_a 82.266 _cell.length_b 82.266 _cell.length_c 170.283 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 3M11 _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.entry_id 3M11 _symmetry.Int_Tables_number 178 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase 6' 32359.123 1 2.7.11.1 T288D 'catalytic domain' ? 2 non-polymer syn '1-(4-{2-[(5,6-diphenylfuro[2,3-d]pyrimidin-4-yl)amino]ethyl}phenyl)-3-phenylurea' 525.600 1 ? ? ? ? 3 water nat water 18.015 100 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora kinase A, Serine/threonine-protein kinase aurora-A, Serine/threonine-protein kinase 15, Aurora/IPL1-related kinase 1, Aurora-related kinase 1, ARK-1, hARK1, Breast tumor-amplified kinase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRTDLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASK ; _entity_poly.pdbx_seq_one_letter_code_can ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRTDLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 LYS n 1 4 ARG n 1 5 GLN n 1 6 TRP n 1 7 ALA n 1 8 LEU n 1 9 GLU n 1 10 ASP n 1 11 PHE n 1 12 GLU n 1 13 ILE n 1 14 GLY n 1 15 ARG n 1 16 PRO n 1 17 LEU n 1 18 GLY n 1 19 LYS n 1 20 GLY n 1 21 LYS n 1 22 PHE n 1 23 GLY n 1 24 ASN n 1 25 VAL n 1 26 TYR n 1 27 LEU n 1 28 ALA n 1 29 ARG n 1 30 GLU n 1 31 LYS n 1 32 GLN n 1 33 SER n 1 34 LYS n 1 35 PHE n 1 36 ILE n 1 37 LEU n 1 38 ALA n 1 39 LEU n 1 40 LYS n 1 41 VAL n 1 42 LEU n 1 43 PHE n 1 44 LYS n 1 45 ALA n 1 46 GLN n 1 47 LEU n 1 48 GLU n 1 49 LYS n 1 50 ALA n 1 51 GLY n 1 52 VAL n 1 53 GLU n 1 54 HIS n 1 55 GLN n 1 56 LEU n 1 57 ARG n 1 58 ARG n 1 59 GLU n 1 60 VAL n 1 61 GLU n 1 62 ILE n 1 63 GLN n 1 64 SER n 1 65 HIS n 1 66 LEU n 1 67 ARG n 1 68 HIS n 1 69 PRO n 1 70 ASN n 1 71 ILE n 1 72 LEU n 1 73 ARG n 1 74 LEU n 1 75 TYR n 1 76 GLY n 1 77 TYR n 1 78 PHE n 1 79 HIS n 1 80 ASP n 1 81 ALA n 1 82 THR n 1 83 ARG n 1 84 VAL n 1 85 TYR n 1 86 LEU n 1 87 ILE n 1 88 LEU n 1 89 GLU n 1 90 TYR n 1 91 ALA n 1 92 PRO n 1 93 LEU n 1 94 GLY n 1 95 THR n 1 96 VAL n 1 97 TYR n 1 98 ARG n 1 99 GLU n 1 100 LEU n 1 101 GLN n 1 102 LYS n 1 103 LEU n 1 104 SER n 1 105 LYS n 1 106 PHE n 1 107 ASP n 1 108 GLU n 1 109 GLN n 1 110 ARG n 1 111 THR n 1 112 ALA n 1 113 THR n 1 114 TYR n 1 115 ILE n 1 116 THR n 1 117 GLU n 1 118 LEU n 1 119 ALA n 1 120 ASN n 1 121 ALA n 1 122 LEU n 1 123 SER n 1 124 TYR n 1 125 CYS n 1 126 HIS n 1 127 SER n 1 128 LYS n 1 129 ARG n 1 130 VAL n 1 131 ILE n 1 132 HIS n 1 133 ARG n 1 134 ASP n 1 135 ILE n 1 136 LYS n 1 137 PRO n 1 138 GLU n 1 139 ASN n 1 140 LEU n 1 141 LEU n 1 142 LEU n 1 143 GLY n 1 144 SER n 1 145 ALA n 1 146 GLY n 1 147 GLU n 1 148 LEU n 1 149 LYS n 1 150 ILE n 1 151 ALA n 1 152 ASP n 1 153 PHE n 1 154 GLY n 1 155 TRP n 1 156 SER n 1 157 VAL n 1 158 HIS n 1 159 ALA n 1 160 PRO n 1 161 SER n 1 162 SER n 1 163 ARG n 1 164 ARG n 1 165 THR n 1 166 ASP n 1 167 LEU n 1 168 CYS n 1 169 GLY n 1 170 THR n 1 171 LEU n 1 172 ASP n 1 173 TYR n 1 174 LEU n 1 175 PRO n 1 176 PRO n 1 177 GLU n 1 178 MET n 1 179 ILE n 1 180 GLU n 1 181 GLY n 1 182 ARG n 1 183 MET n 1 184 HIS n 1 185 ASP n 1 186 GLU n 1 187 LYS n 1 188 VAL n 1 189 ASP n 1 190 LEU n 1 191 TRP n 1 192 SER n 1 193 LEU n 1 194 GLY n 1 195 VAL n 1 196 LEU n 1 197 CYS n 1 198 TYR n 1 199 GLU n 1 200 PHE n 1 201 LEU n 1 202 VAL n 1 203 GLY n 1 204 LYS n 1 205 PRO n 1 206 PRO n 1 207 PHE n 1 208 GLU n 1 209 ALA n 1 210 ASN n 1 211 THR n 1 212 TYR n 1 213 GLN n 1 214 GLU n 1 215 THR n 1 216 TYR n 1 217 LYS n 1 218 ARG n 1 219 ILE n 1 220 SER n 1 221 ARG n 1 222 VAL n 1 223 GLU n 1 224 PHE n 1 225 THR n 1 226 PHE n 1 227 PRO n 1 228 ASP n 1 229 PHE n 1 230 VAL n 1 231 THR n 1 232 GLU n 1 233 GLY n 1 234 ALA n 1 235 ARG n 1 236 ASP n 1 237 LEU n 1 238 ILE n 1 239 SER n 1 240 ARG n 1 241 LEU n 1 242 LEU n 1 243 LYS n 1 244 HIS n 1 245 ASN n 1 246 PRO n 1 247 SER n 1 248 GLN n 1 249 ARG n 1 250 PRO n 1 251 MET n 1 252 LEU n 1 253 ARG n 1 254 GLU n 1 255 VAL n 1 256 LEU n 1 257 GLU n 1 258 HIS n 1 259 PRO n 1 260 TRP n 1 261 ILE n 1 262 THR n 1 263 ALA n 1 264 ASN n 1 265 SER n 1 266 SER n 1 267 LYS n 1 268 PRO n 1 269 SER n 1 270 ASN n 1 271 CYS n 1 272 GLN n 1 273 ASN n 1 274 LYS n 1 275 GLU n 1 276 SER n 1 277 ALA n 1 278 SER n 1 279 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STK6_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASK ; _struct_ref.pdbx_align_begin 123 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3M11 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 279 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 123 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 401 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 123 _struct_ref_seq.pdbx_auth_seq_align_end 401 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3M11 _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 166 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O14965 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 288 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 288 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AKI non-polymer . '1-(4-{2-[(5,6-diphenylfuro[2,3-d]pyrimidin-4-yl)amino]ethyl}phenyl)-3-phenylurea' ? 'C33 H27 N5 O2' 525.600 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3M11 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity 1.069 _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 2.57 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 52.14 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '22% PEG400, 0.1mM ammonia sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2008-01-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? _diffrn_source.pdbx_synchrotron_site NSRRC _diffrn_source.pdbx_synchrotron_beamline BL13B1 # _reflns.entry_id 3M11 _reflns.d_resolution_high 2.750 _reflns.d_resolution_low 30.000 _reflns.number_obs 8896 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_netI_over_sigmaI 24.900 _reflns.pdbx_chi_squared 1.054 _reflns.pdbx_redundancy 8.800 _reflns.percent_possible_obs 95.100 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.number_all 8964 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 2.75 2.85 ? ? ? 0.344 ? ? 1.081 9.00 ? 863 94.90 ? 1 2.85 2.96 ? ? ? 0.233 ? ? 1.087 8.90 ? 865 95.20 ? 2 2.96 3.10 ? ? ? 0.182 ? ? 1.085 9.00 ? 868 95.70 ? 3 3.10 3.26 ? ? ? 0.122 ? ? 1.082 8.90 ? 866 94.90 ? 4 3.26 3.46 ? ? ? 0.077 ? ? 1.031 8.90 ? 869 94.00 ? 5 3.46 3.73 ? ? ? 0.056 ? ? 1.010 8.60 ? 888 94.30 ? 6 3.73 4.11 ? ? ? 0.044 ? ? 1.043 8.40 ? 910 96.70 ? 7 4.11 4.70 ? ? ? 0.041 ? ? 1.068 8.60 ? 911 97.40 ? 8 4.70 5.91 ? ? ? 0.038 ? ? 1.036 8.70 ? 945 96.10 ? 9 5.91 30.00 ? ? ? 0.028 ? ? 1.023 8.70 ? 979 91.80 ? 10 # _refine.entry_id 3M11 _refine.ls_d_res_high 2.750 _refine.ls_d_res_low 30.000 _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 94.730 _refine.ls_number_reflns_obs 8896 _refine.ls_number_reflns_all 8964 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.221 _refine.ls_R_factor_R_work 0.217 _refine.ls_wR_factor_R_work 0.238 _refine.ls_R_factor_R_free 0.299 _refine.ls_wR_factor_R_free 0.321 _refine.ls_percent_reflns_R_free 4.700 _refine.ls_number_reflns_R_free 419 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 69.047 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -0.700 _refine.aniso_B[2][2] -0.700 _refine.aniso_B[3][3] 1.050 _refine.aniso_B[1][2] -0.350 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.941 _refine.correlation_coeff_Fo_to_Fc_free 0.907 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free 0.435 _refine.pdbx_overall_ESU_R_Free 0.435 _refine.overall_SU_ML 0.348 _refine.overall_SU_B 17.537 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 3FDN _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.737 _refine.B_iso_max 108.58 _refine.B_iso_min 40.05 _refine.occupancy_max 1.00 _refine.occupancy_min 0.50 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2062 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.number_atoms_solvent 100 _refine_hist.number_atoms_total 2202 _refine_hist.d_res_high 2.750 _refine_hist.d_res_low 30.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 2161 0.012 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2931 1.431 1.983 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 254 6.425 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 102 35.265 23.333 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 354 18.811 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15 23.596 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 312 0.089 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1666 0.004 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 1050 0.234 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 1444 0.315 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 134 0.179 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 37 0.345 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 13 0.250 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1307 0.759 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2050 1.375 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 977 1.349 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 881 2.228 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.754 _refine_ls_shell.d_res_low 2.825 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 95.050 _refine_ls_shell.number_reflns_R_work 603 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.276 _refine_ls_shell.R_factor_R_free 0.427 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 634 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3M11 _struct.title 'Crystal Structure of Aurora A Kinase complexed with inhibitor' _struct.pdbx_descriptor 'Serine/threonine-protein kinase 6 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3M11 _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text ;Aurora kinase inhibitor, X-ray co-crystal analysis, Structure-based drug design, ATP-binding, Cell cycle, Cytoskeleton, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, TRANSFERASE-TRANSFERASE INHIBITOR complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 7 ? GLU A 9 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 2 LYS A 44 ? ALA A 50 ? LYS A 166 ALA A 172 1 ? 7 HELX_P HELX_P3 3 VAL A 52 ? SER A 64 ? VAL A 174 SER A 186 1 ? 13 HELX_P HELX_P4 4 THR A 95 ? SER A 104 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 5 ASP A 107 ? LYS A 128 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P6 6 LYS A 136 ? GLU A 138 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 7 ASP A 152 ? SER A 156 ? ASP A 274 SER A 278 5 ? 5 HELX_P HELX_P8 8 PRO A 175 ? GLU A 180 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P9 9 GLU A 186 ? GLY A 203 ? GLU A 308 GLY A 325 1 ? 18 HELX_P HELX_P10 10 THR A 211 ? VAL A 222 ? THR A 333 VAL A 344 1 ? 12 HELX_P HELX_P11 11 THR A 231 ? LEU A 242 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P12 12 ASN A 245 ? ARG A 249 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P13 13 MET A 251 ? HIS A 258 ? MET A 373 HIS A 380 1 ? 8 HELX_P HELX_P14 14 HIS A 258 ? SER A 265 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 11 ? GLY A 20 ? PHE A 133 GLY A 142 A 2 GLY A 23 ? GLU A 30 ? GLY A 145 GLU A 152 A 3 PHE A 35 ? PHE A 43 ? PHE A 157 PHE A 165 A 4 ARG A 83 ? LEU A 88 ? ARG A 205 LEU A 210 A 5 LEU A 74 ? HIS A 79 ? LEU A 196 HIS A 201 B 1 LEU A 140 ? LEU A 142 ? LEU A 262 LEU A 264 B 2 LEU A 148 ? ILE A 150 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 14 ? N GLY A 136 O LEU A 27 ? O LEU A 149 A 2 3 N TYR A 26 ? N TYR A 148 O LEU A 39 ? O LEU A 161 A 3 4 N ALA A 38 ? N ALA A 160 O LEU A 88 ? O LEU A 210 A 4 5 O ILE A 87 ? O ILE A 209 N TYR A 75 ? N TYR A 197 B 1 2 N LEU A 141 ? N LEU A 263 O LYS A 149 ? O LYS A 271 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'BINDING SITE FOR RESIDUE AKI A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 LEU A 17 ? LEU A 139 . ? 1_555 ? 2 AC1 14 GLY A 18 ? GLY A 140 . ? 1_555 ? 3 AC1 14 PHE A 22 ? PHE A 144 . ? 1_555 ? 4 AC1 14 ALA A 38 ? ALA A 160 . ? 1_555 ? 5 AC1 14 LYS A 40 ? LYS A 162 . ? 1_555 ? 6 AC1 14 LEU A 42 ? LEU A 164 . ? 1_555 ? 7 AC1 14 LEU A 56 ? LEU A 178 . ? 1_555 ? 8 AC1 14 GLU A 59 ? GLU A 181 . ? 1_555 ? 9 AC1 14 GLU A 89 ? GLU A 211 . ? 1_555 ? 10 AC1 14 TYR A 90 ? TYR A 212 . ? 1_555 ? 11 AC1 14 ALA A 91 ? ALA A 213 . ? 1_555 ? 12 AC1 14 GLY A 94 ? GLY A 216 . ? 1_555 ? 13 AC1 14 THR A 95 ? THR A 217 . ? 1_555 ? 14 AC1 14 ASP A 152 ? ASP A 274 . ? 1_555 ? # _atom_sites.entry_id 3M11 _atom_sites.fract_transf_matrix[1][1] 0.012156 _atom_sites.fract_transf_matrix[1][2] 0.007018 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014036 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005873 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 123 ? ? ? A . n A 1 2 LYS 2 124 ? ? ? A . n A 1 3 LYS 3 125 ? ? ? A . n A 1 4 ARG 4 126 126 ARG ARG A . n A 1 5 GLN 5 127 127 GLN GLN A . n A 1 6 TRP 6 128 128 TRP TRP A . n A 1 7 ALA 7 129 129 ALA ALA A . n A 1 8 LEU 8 130 130 LEU LEU A . n A 1 9 GLU 9 131 131 GLU GLU A . n A 1 10 ASP 10 132 132 ASP ASP A . n A 1 11 PHE 11 133 133 PHE PHE A . n A 1 12 GLU 12 134 134 GLU GLU A . n A 1 13 ILE 13 135 135 ILE ILE A . n A 1 14 GLY 14 136 136 GLY GLY A . n A 1 15 ARG 15 137 137 ARG ARG A . n A 1 16 PRO 16 138 138 PRO PRO A . n A 1 17 LEU 17 139 139 LEU LEU A . n A 1 18 GLY 18 140 140 GLY GLY A . n A 1 19 LYS 19 141 141 LYS LYS A . n A 1 20 GLY 20 142 142 GLY GLY A . n A 1 21 LYS 21 143 143 LYS LYS A . n A 1 22 PHE 22 144 144 PHE PHE A . n A 1 23 GLY 23 145 145 GLY GLY A . n A 1 24 ASN 24 146 146 ASN ASN A . n A 1 25 VAL 25 147 147 VAL VAL A . n A 1 26 TYR 26 148 148 TYR TYR A . n A 1 27 LEU 27 149 149 LEU LEU A . n A 1 28 ALA 28 150 150 ALA ALA A . n A 1 29 ARG 29 151 151 ARG ARG A . n A 1 30 GLU 30 152 152 GLU GLU A . n A 1 31 LYS 31 153 153 LYS LYS A . n A 1 32 GLN 32 154 154 GLN GLN A . n A 1 33 SER 33 155 155 SER SER A . n A 1 34 LYS 34 156 156 LYS LYS A . n A 1 35 PHE 35 157 157 PHE PHE A . n A 1 36 ILE 36 158 158 ILE ILE A . n A 1 37 LEU 37 159 159 LEU LEU A . n A 1 38 ALA 38 160 160 ALA ALA A . n A 1 39 LEU 39 161 161 LEU LEU A . n A 1 40 LYS 40 162 162 LYS LYS A . n A 1 41 VAL 41 163 163 VAL VAL A . n A 1 42 LEU 42 164 164 LEU LEU A . n A 1 43 PHE 43 165 165 PHE PHE A . n A 1 44 LYS 44 166 166 LYS LYS A . n A 1 45 ALA 45 167 167 ALA ALA A . n A 1 46 GLN 46 168 168 GLN GLN A . n A 1 47 LEU 47 169 169 LEU LEU A . n A 1 48 GLU 48 170 170 GLU GLU A . n A 1 49 LYS 49 171 171 LYS LYS A . n A 1 50 ALA 50 172 172 ALA ALA A . n A 1 51 GLY 51 173 173 GLY GLY A . n A 1 52 VAL 52 174 174 VAL VAL A . n A 1 53 GLU 53 175 175 GLU GLU A . n A 1 54 HIS 54 176 176 HIS HIS A . n A 1 55 GLN 55 177 177 GLN GLN A . n A 1 56 LEU 56 178 178 LEU LEU A . n A 1 57 ARG 57 179 179 ARG ARG A . n A 1 58 ARG 58 180 180 ARG ARG A . n A 1 59 GLU 59 181 181 GLU GLU A . n A 1 60 VAL 60 182 182 VAL VAL A . n A 1 61 GLU 61 183 183 GLU GLU A . n A 1 62 ILE 62 184 184 ILE ILE A . n A 1 63 GLN 63 185 185 GLN GLN A . n A 1 64 SER 64 186 186 SER SER A . n A 1 65 HIS 65 187 187 HIS HIS A . n A 1 66 LEU 66 188 188 LEU LEU A . n A 1 67 ARG 67 189 189 ARG ARG A . n A 1 68 HIS 68 190 190 HIS HIS A . n A 1 69 PRO 69 191 191 PRO PRO A . n A 1 70 ASN 70 192 192 ASN ASN A . n A 1 71 ILE 71 193 193 ILE ILE A . n A 1 72 LEU 72 194 194 LEU LEU A . n A 1 73 ARG 73 195 195 ARG ARG A . n A 1 74 LEU 74 196 196 LEU LEU A . n A 1 75 TYR 75 197 197 TYR TYR A . n A 1 76 GLY 76 198 198 GLY GLY A . n A 1 77 TYR 77 199 199 TYR TYR A . n A 1 78 PHE 78 200 200 PHE PHE A . n A 1 79 HIS 79 201 201 HIS HIS A . n A 1 80 ASP 80 202 202 ASP ASP A . n A 1 81 ALA 81 203 203 ALA ALA A . n A 1 82 THR 82 204 204 THR THR A . n A 1 83 ARG 83 205 205 ARG ARG A . n A 1 84 VAL 84 206 206 VAL VAL A . n A 1 85 TYR 85 207 207 TYR TYR A . n A 1 86 LEU 86 208 208 LEU LEU A . n A 1 87 ILE 87 209 209 ILE ILE A . n A 1 88 LEU 88 210 210 LEU LEU A . n A 1 89 GLU 89 211 211 GLU GLU A . n A 1 90 TYR 90 212 212 TYR TYR A . n A 1 91 ALA 91 213 213 ALA ALA A . n A 1 92 PRO 92 214 214 PRO PRO A . n A 1 93 LEU 93 215 215 LEU LEU A . n A 1 94 GLY 94 216 216 GLY GLY A . n A 1 95 THR 95 217 217 THR THR A . n A 1 96 VAL 96 218 218 VAL VAL A . n A 1 97 TYR 97 219 219 TYR TYR A . n A 1 98 ARG 98 220 220 ARG ARG A . n A 1 99 GLU 99 221 221 GLU GLU A . n A 1 100 LEU 100 222 222 LEU LEU A . n A 1 101 GLN 101 223 223 GLN GLN A . n A 1 102 LYS 102 224 224 LYS LYS A . n A 1 103 LEU 103 225 225 LEU LEU A . n A 1 104 SER 104 226 226 SER SER A . n A 1 105 LYS 105 227 227 LYS LYS A . n A 1 106 PHE 106 228 228 PHE PHE A . n A 1 107 ASP 107 229 229 ASP ASP A . n A 1 108 GLU 108 230 230 GLU GLU A . n A 1 109 GLN 109 231 231 GLN GLN A . n A 1 110 ARG 110 232 232 ARG ARG A . n A 1 111 THR 111 233 233 THR THR A . n A 1 112 ALA 112 234 234 ALA ALA A . n A 1 113 THR 113 235 235 THR THR A . n A 1 114 TYR 114 236 236 TYR TYR A . n A 1 115 ILE 115 237 237 ILE ILE A . n A 1 116 THR 116 238 238 THR THR A . n A 1 117 GLU 117 239 239 GLU GLU A . n A 1 118 LEU 118 240 240 LEU LEU A . n A 1 119 ALA 119 241 241 ALA ALA A . n A 1 120 ASN 120 242 242 ASN ASN A . n A 1 121 ALA 121 243 243 ALA ALA A . n A 1 122 LEU 122 244 244 LEU LEU A . n A 1 123 SER 123 245 245 SER SER A . n A 1 124 TYR 124 246 246 TYR TYR A . n A 1 125 CYS 125 247 247 CYS CYS A . n A 1 126 HIS 126 248 248 HIS HIS A . n A 1 127 SER 127 249 249 SER SER A . n A 1 128 LYS 128 250 250 LYS LYS A . n A 1 129 ARG 129 251 251 ARG ARG A . n A 1 130 VAL 130 252 252 VAL VAL A . n A 1 131 ILE 131 253 253 ILE ILE A . n A 1 132 HIS 132 254 254 HIS HIS A . n A 1 133 ARG 133 255 255 ARG ARG A . n A 1 134 ASP 134 256 256 ASP ASP A . n A 1 135 ILE 135 257 257 ILE ILE A . n A 1 136 LYS 136 258 258 LYS LYS A . n A 1 137 PRO 137 259 259 PRO PRO A . n A 1 138 GLU 138 260 260 GLU GLU A . n A 1 139 ASN 139 261 261 ASN ASN A . n A 1 140 LEU 140 262 262 LEU LEU A . n A 1 141 LEU 141 263 263 LEU LEU A . n A 1 142 LEU 142 264 264 LEU LEU A . n A 1 143 GLY 143 265 265 GLY GLY A . n A 1 144 SER 144 266 266 SER SER A . n A 1 145 ALA 145 267 267 ALA ALA A . n A 1 146 GLY 146 268 268 GLY GLY A . n A 1 147 GLU 147 269 269 GLU GLU A . n A 1 148 LEU 148 270 270 LEU LEU A . n A 1 149 LYS 149 271 271 LYS LYS A . n A 1 150 ILE 150 272 272 ILE ILE A . n A 1 151 ALA 151 273 273 ALA ALA A . n A 1 152 ASP 152 274 274 ASP ASP A . n A 1 153 PHE 153 275 275 PHE PHE A . n A 1 154 GLY 154 276 276 GLY GLY A . n A 1 155 TRP 155 277 277 TRP TRP A . n A 1 156 SER 156 278 278 SER SER A . n A 1 157 VAL 157 279 279 VAL VAL A . n A 1 158 HIS 158 280 280 HIS HIS A . n A 1 159 ALA 159 281 ? ? ? A . n A 1 160 PRO 160 282 ? ? ? A . n A 1 161 SER 161 283 ? ? ? A . n A 1 162 SER 162 284 ? ? ? A . n A 1 163 ARG 163 285 ? ? ? A . n A 1 164 ARG 164 286 ? ? ? A . n A 1 165 THR 165 287 ? ? ? A . n A 1 166 ASP 166 288 ? ? ? A . n A 1 167 LEU 167 289 ? ? ? A . n A 1 168 CYS 168 290 ? ? ? A . n A 1 169 GLY 169 291 291 GLY GLY A . n A 1 170 THR 170 292 292 THR THR A . n A 1 171 LEU 171 293 293 LEU LEU A . n A 1 172 ASP 172 294 294 ASP ASP A . n A 1 173 TYR 173 295 295 TYR TYR A . n A 1 174 LEU 174 296 296 LEU LEU A . n A 1 175 PRO 175 297 297 PRO PRO A . n A 1 176 PRO 176 298 298 PRO PRO A . n A 1 177 GLU 177 299 299 GLU GLU A . n A 1 178 MET 178 300 300 MET MET A . n A 1 179 ILE 179 301 301 ILE ILE A . n A 1 180 GLU 180 302 302 GLU GLU A . n A 1 181 GLY 181 303 303 GLY GLY A . n A 1 182 ARG 182 304 304 ARG ARG A . n A 1 183 MET 183 305 305 MET MET A . n A 1 184 HIS 184 306 306 HIS HIS A . n A 1 185 ASP 185 307 307 ASP ASP A . n A 1 186 GLU 186 308 308 GLU GLU A . n A 1 187 LYS 187 309 309 LYS LYS A . n A 1 188 VAL 188 310 310 VAL VAL A . n A 1 189 ASP 189 311 311 ASP ASP A . n A 1 190 LEU 190 312 312 LEU LEU A . n A 1 191 TRP 191 313 313 TRP TRP A . n A 1 192 SER 192 314 314 SER SER A . n A 1 193 LEU 193 315 315 LEU LEU A . n A 1 194 GLY 194 316 316 GLY GLY A . n A 1 195 VAL 195 317 317 VAL VAL A . n A 1 196 LEU 196 318 318 LEU LEU A . n A 1 197 CYS 197 319 319 CYS CYS A . n A 1 198 TYR 198 320 320 TYR TYR A . n A 1 199 GLU 199 321 321 GLU GLU A . n A 1 200 PHE 200 322 322 PHE PHE A . n A 1 201 LEU 201 323 323 LEU LEU A . n A 1 202 VAL 202 324 324 VAL VAL A . n A 1 203 GLY 203 325 325 GLY GLY A . n A 1 204 LYS 204 326 326 LYS LYS A . n A 1 205 PRO 205 327 327 PRO PRO A . n A 1 206 PRO 206 328 328 PRO PRO A . n A 1 207 PHE 207 329 329 PHE PHE A . n A 1 208 GLU 208 330 330 GLU GLU A . n A 1 209 ALA 209 331 331 ALA ALA A . n A 1 210 ASN 210 332 332 ASN ASN A . n A 1 211 THR 211 333 333 THR THR A . n A 1 212 TYR 212 334 334 TYR TYR A . n A 1 213 GLN 213 335 335 GLN GLN A . n A 1 214 GLU 214 336 336 GLU GLU A . n A 1 215 THR 215 337 337 THR THR A . n A 1 216 TYR 216 338 338 TYR TYR A . n A 1 217 LYS 217 339 339 LYS LYS A . n A 1 218 ARG 218 340 340 ARG ARG A . n A 1 219 ILE 219 341 341 ILE ILE A . n A 1 220 SER 220 342 342 SER SER A . n A 1 221 ARG 221 343 343 ARG ARG A . n A 1 222 VAL 222 344 344 VAL VAL A . n A 1 223 GLU 223 345 345 GLU GLU A . n A 1 224 PHE 224 346 346 PHE PHE A . n A 1 225 THR 225 347 347 THR THR A . n A 1 226 PHE 226 348 348 PHE PHE A . n A 1 227 PRO 227 349 349 PRO PRO A . n A 1 228 ASP 228 350 350 ASP ASP A . n A 1 229 PHE 229 351 351 PHE PHE A . n A 1 230 VAL 230 352 352 VAL VAL A . n A 1 231 THR 231 353 353 THR THR A . n A 1 232 GLU 232 354 354 GLU GLU A . n A 1 233 GLY 233 355 355 GLY GLY A . n A 1 234 ALA 234 356 356 ALA ALA A . n A 1 235 ARG 235 357 357 ARG ARG A . n A 1 236 ASP 236 358 358 ASP ASP A . n A 1 237 LEU 237 359 359 LEU LEU A . n A 1 238 ILE 238 360 360 ILE ILE A . n A 1 239 SER 239 361 361 SER SER A . n A 1 240 ARG 240 362 362 ARG ARG A . n A 1 241 LEU 241 363 363 LEU LEU A . n A 1 242 LEU 242 364 364 LEU LEU A . n A 1 243 LYS 243 365 365 LYS LYS A . n A 1 244 HIS 244 366 366 HIS HIS A . n A 1 245 ASN 245 367 367 ASN ASN A . n A 1 246 PRO 246 368 368 PRO PRO A . n A 1 247 SER 247 369 369 SER SER A . n A 1 248 GLN 248 370 370 GLN GLN A . n A 1 249 ARG 249 371 371 ARG ARG A . n A 1 250 PRO 250 372 372 PRO PRO A . n A 1 251 MET 251 373 373 MET MET A . n A 1 252 LEU 252 374 374 LEU LEU A . n A 1 253 ARG 253 375 375 ARG ARG A . n A 1 254 GLU 254 376 376 GLU GLU A . n A 1 255 VAL 255 377 377 VAL VAL A . n A 1 256 LEU 256 378 378 LEU LEU A . n A 1 257 GLU 257 379 379 GLU GLU A . n A 1 258 HIS 258 380 380 HIS HIS A . n A 1 259 PRO 259 381 381 PRO PRO A . n A 1 260 TRP 260 382 382 TRP TRP A . n A 1 261 ILE 261 383 383 ILE ILE A . n A 1 262 THR 262 384 384 THR THR A . n A 1 263 ALA 263 385 385 ALA ALA A . n A 1 264 ASN 264 386 386 ASN ASN A . n A 1 265 SER 265 387 387 SER SER A . n A 1 266 SER 266 388 388 SER SER A . n A 1 267 LYS 267 389 389 LYS LYS A . n A 1 268 PRO 268 390 390 PRO PRO A . n A 1 269 SER 269 391 391 SER SER A . n A 1 270 ASN 270 392 ? ? ? A . n A 1 271 CYS 271 393 ? ? ? A . n A 1 272 GLN 272 394 ? ? ? A . n A 1 273 ASN 273 395 ? ? ? A . n A 1 274 LYS 274 396 ? ? ? A . n A 1 275 GLU 275 397 ? ? ? A . n A 1 276 SER 276 398 ? ? ? A . n A 1 277 ALA 277 399 ? ? ? A . n A 1 278 SER 278 400 ? ? ? A . n A 1 279 LYS 279 401 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AKI 1 1 1 AKI DRG A . C 3 HOH 1 2 2 HOH HOH A . C 3 HOH 2 3 3 HOH HOH A . C 3 HOH 3 4 4 HOH HOH A . C 3 HOH 4 5 5 HOH HOH A . C 3 HOH 5 6 6 HOH HOH A . C 3 HOH 6 7 7 HOH HOH A . C 3 HOH 7 8 8 HOH HOH A . C 3 HOH 8 9 9 HOH HOH A . C 3 HOH 9 10 10 HOH HOH A . C 3 HOH 10 11 11 HOH HOH A . C 3 HOH 11 12 12 HOH HOH A . C 3 HOH 12 13 13 HOH HOH A . C 3 HOH 13 15 15 HOH HOH A . C 3 HOH 14 17 17 HOH HOH A . C 3 HOH 15 18 18 HOH HOH A . C 3 HOH 16 19 19 HOH HOH A . C 3 HOH 17 20 20 HOH HOH A . C 3 HOH 18 21 21 HOH HOH A . C 3 HOH 19 22 22 HOH HOH A . C 3 HOH 20 23 23 HOH HOH A . C 3 HOH 21 24 24 HOH HOH A . C 3 HOH 22 25 25 HOH HOH A . C 3 HOH 23 26 26 HOH HOH A . C 3 HOH 24 27 27 HOH HOH A . C 3 HOH 25 28 28 HOH HOH A . C 3 HOH 26 29 29 HOH HOH A . C 3 HOH 27 30 30 HOH HOH A . C 3 HOH 28 31 31 HOH HOH A . C 3 HOH 29 32 32 HOH HOH A . C 3 HOH 30 33 33 HOH HOH A . C 3 HOH 31 34 34 HOH HOH A . C 3 HOH 32 36 36 HOH HOH A . C 3 HOH 33 37 37 HOH HOH A . C 3 HOH 34 38 38 HOH HOH A . C 3 HOH 35 39 39 HOH HOH A . C 3 HOH 36 40 40 HOH HOH A . C 3 HOH 37 41 41 HOH HOH A . C 3 HOH 38 42 42 HOH HOH A . C 3 HOH 39 44 44 HOH HOH A . C 3 HOH 40 45 45 HOH HOH A . C 3 HOH 41 46 46 HOH HOH A . C 3 HOH 42 47 47 HOH HOH A . C 3 HOH 43 48 48 HOH HOH A . C 3 HOH 44 50 50 HOH HOH A . C 3 HOH 45 51 51 HOH HOH A . C 3 HOH 46 52 52 HOH HOH A . C 3 HOH 47 53 53 HOH HOH A . C 3 HOH 48 54 54 HOH HOH A . C 3 HOH 49 55 55 HOH HOH A . C 3 HOH 50 56 56 HOH HOH A . C 3 HOH 51 57 57 HOH HOH A . C 3 HOH 52 58 58 HOH HOH A . C 3 HOH 53 59 59 HOH HOH A . C 3 HOH 54 60 60 HOH HOH A . C 3 HOH 55 61 61 HOH HOH A . C 3 HOH 56 63 63 HOH HOH A . C 3 HOH 57 64 64 HOH HOH A . C 3 HOH 58 65 65 HOH HOH A . C 3 HOH 59 66 66 HOH HOH A . C 3 HOH 60 67 67 HOH HOH A . C 3 HOH 61 68 68 HOH HOH A . C 3 HOH 62 69 69 HOH HOH A . C 3 HOH 63 70 70 HOH HOH A . C 3 HOH 64 71 71 HOH HOH A . C 3 HOH 65 72 72 HOH HOH A . C 3 HOH 66 73 73 HOH HOH A . C 3 HOH 67 74 74 HOH HOH A . C 3 HOH 68 75 75 HOH HOH A . C 3 HOH 69 76 76 HOH HOH A . C 3 HOH 70 77 77 HOH HOH A . C 3 HOH 71 78 78 HOH HOH A . C 3 HOH 72 79 79 HOH HOH A . C 3 HOH 73 80 80 HOH HOH A . C 3 HOH 74 81 81 HOH HOH A . C 3 HOH 75 82 82 HOH HOH A . C 3 HOH 76 83 83 HOH HOH A . C 3 HOH 77 84 84 HOH HOH A . C 3 HOH 78 85 85 HOH HOH A . C 3 HOH 79 86 86 HOH HOH A . C 3 HOH 80 88 88 HOH HOH A . C 3 HOH 81 89 89 HOH HOH A . C 3 HOH 82 93 93 HOH HOH A . C 3 HOH 83 94 94 HOH HOH A . C 3 HOH 84 95 95 HOH HOH A . C 3 HOH 85 96 96 HOH HOH A . C 3 HOH 86 98 98 HOH HOH A . C 3 HOH 87 99 99 HOH HOH A . C 3 HOH 88 100 100 HOH HOH A . C 3 HOH 89 102 102 HOH HOH A . C 3 HOH 90 105 105 HOH HOH A . C 3 HOH 91 106 106 HOH HOH A . C 3 HOH 92 107 107 HOH HOH A . C 3 HOH 93 108 108 HOH HOH A . C 3 HOH 94 109 109 HOH HOH A . C 3 HOH 95 111 111 HOH HOH A . C 3 HOH 96 115 115 HOH HOH A . C 3 HOH 97 117 117 HOH HOH A . C 3 HOH 98 118 118 HOH HOH A . C 3 HOH 99 119 119 HOH HOH A . C 3 HOH 100 402 1 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 102 ? C HOH . 2 1 A HOH 107 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-03-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.contact_author' 3 3 'Structure model' '_software.contact_author_email' 4 3 'Structure model' '_software.date' 5 3 'Structure model' '_software.language' 6 3 'Structure model' '_software.location' 7 3 'Structure model' '_software.name' 8 3 'Structure model' '_software.type' 9 3 'Structure model' '_software.version' # _pdbx_phasing_MR.entry_id 3M11 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.250 _pdbx_phasing_MR.d_res_low_rotation 28.380 _pdbx_phasing_MR.d_res_high_translation 3.250 _pdbx_phasing_MR.d_res_low_translation 28.380 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 MOLREP . ? program 'Alexei Vaguine' alexei@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/molrep.html Fortran_77 ? 4 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 HKL-2000 . ? ? ? ? 'data collection' ? ? ? 7 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 186 ? ? -67.03 1.56 2 1 ASP A 202 ? ? -111.82 -157.56 3 1 SER A 226 ? ? 76.09 -56.21 4 1 ASP A 274 ? ? 64.27 67.30 5 1 GLU A 302 ? ? -66.64 5.28 6 1 GLU A 330 ? ? -35.44 124.97 7 1 PRO A 372 ? ? -45.77 164.24 8 1 PRO A 390 ? ? -68.61 -178.01 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 126 ? CG ? A ARG 4 CG 2 1 Y 1 A ARG 126 ? CD ? A ARG 4 CD 3 1 Y 1 A ARG 126 ? NE ? A ARG 4 NE 4 1 Y 1 A ARG 126 ? CZ ? A ARG 4 CZ 5 1 Y 1 A ARG 126 ? NH1 ? A ARG 4 NH1 6 1 Y 1 A ARG 126 ? NH2 ? A ARG 4 NH2 7 1 Y 1 A LYS 141 ? CG ? A LYS 19 CG 8 1 Y 1 A LYS 141 ? CD ? A LYS 19 CD 9 1 Y 1 A LYS 141 ? CE ? A LYS 19 CE 10 1 Y 1 A LYS 141 ? NZ ? A LYS 19 NZ 11 1 Y 1 A LYS 143 ? CG ? A LYS 21 CG 12 1 Y 1 A LYS 143 ? CD ? A LYS 21 CD 13 1 Y 1 A LYS 143 ? CE ? A LYS 21 CE 14 1 Y 1 A LYS 143 ? NZ ? A LYS 21 NZ 15 1 Y 1 A LYS 166 ? CG ? A LYS 44 CG 16 1 Y 1 A LYS 166 ? CD ? A LYS 44 CD 17 1 Y 1 A LYS 166 ? CE ? A LYS 44 CE 18 1 Y 1 A LYS 166 ? NZ ? A LYS 44 NZ 19 1 Y 1 A LYS 171 ? CG ? A LYS 49 CG 20 1 Y 1 A LYS 171 ? CD ? A LYS 49 CD 21 1 Y 1 A LYS 171 ? CE ? A LYS 49 CE 22 1 Y 1 A LYS 171 ? NZ ? A LYS 49 NZ 23 1 Y 1 A ARG 189 ? CG ? A ARG 67 CG 24 1 Y 1 A ARG 189 ? CD ? A ARG 67 CD 25 1 Y 1 A ARG 189 ? NE ? A ARG 67 NE 26 1 Y 1 A ARG 189 ? CZ ? A ARG 67 CZ 27 1 Y 1 A ARG 189 ? NH1 ? A ARG 67 NH1 28 1 Y 1 A ARG 189 ? NH2 ? A ARG 67 NH2 29 1 Y 1 A LYS 250 ? CG ? A LYS 128 CG 30 1 Y 1 A LYS 250 ? CD ? A LYS 128 CD 31 1 Y 1 A LYS 250 ? CE ? A LYS 128 CE 32 1 Y 1 A LYS 250 ? NZ ? A LYS 128 NZ 33 1 Y 1 A ARG 251 ? CG ? A ARG 129 CG 34 1 Y 1 A ARG 251 ? CD ? A ARG 129 CD 35 1 Y 1 A ARG 251 ? NE ? A ARG 129 NE 36 1 Y 1 A ARG 251 ? CZ ? A ARG 129 CZ 37 1 Y 1 A ARG 251 ? NH1 ? A ARG 129 NH1 38 1 Y 1 A ARG 251 ? NH2 ? A ARG 129 NH2 39 1 Y 1 A ARG 362 ? CG ? A ARG 240 CG 40 1 Y 1 A ARG 362 ? CD ? A ARG 240 CD 41 1 Y 1 A ARG 362 ? NE ? A ARG 240 NE 42 1 Y 1 A ARG 362 ? CZ ? A ARG 240 CZ 43 1 Y 1 A ARG 362 ? NH1 ? A ARG 240 NH1 44 1 Y 1 A ARG 362 ? NH2 ? A ARG 240 NH2 45 1 Y 1 A SER 391 ? O ? A SER 269 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 123 ? A SER 1 2 1 Y 1 A LYS 124 ? A LYS 2 3 1 Y 1 A LYS 125 ? A LYS 3 4 1 Y 1 A ALA 281 ? A ALA 159 5 1 Y 1 A PRO 282 ? A PRO 160 6 1 Y 1 A SER 283 ? A SER 161 7 1 Y 1 A SER 284 ? A SER 162 8 1 Y 1 A ARG 285 ? A ARG 163 9 1 Y 1 A ARG 286 ? A ARG 164 10 1 Y 1 A THR 287 ? A THR 165 11 1 Y 1 A ASP 288 ? A ASP 166 12 1 Y 1 A LEU 289 ? A LEU 167 13 1 Y 1 A CYS 290 ? A CYS 168 14 1 Y 1 A ASN 392 ? A ASN 270 15 1 Y 1 A CYS 393 ? A CYS 271 16 1 Y 1 A GLN 394 ? A GLN 272 17 1 Y 1 A ASN 395 ? A ASN 273 18 1 Y 1 A LYS 396 ? A LYS 274 19 1 Y 1 A GLU 397 ? A GLU 275 20 1 Y 1 A SER 398 ? A SER 276 21 1 Y 1 A ALA 399 ? A ALA 277 22 1 Y 1 A SER 400 ? A SER 278 23 1 Y 1 A LYS 401 ? A LYS 279 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(4-{2-[(5,6-diphenylfuro[2,3-d]pyrimidin-4-yl)amino]ethyl}phenyl)-3-phenylurea' AKI 3 water HOH #