data_3MS6 # _entry.id 3MS6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3MS6 RCSB RCSB058932 WWPDB D_1000058932 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3MSH _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3MS6 _pdbx_database_status.recvd_initial_deposition_date 2010-04-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Garcia-Saez, I.' 1 'Skoufias, D.' 2 # _citation.id primary _citation.title ;Structural Characterization of HBXIP: The Protein That Interacts with the Anti-Apoptotic Protein Survivin and the Oncogenic Viral Protein HBx. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 405 _citation.page_first 331 _citation.page_last 340 _citation.year 2011 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21059355 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2010.10.046 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Garcia-Saez, I.' 1 primary 'Lacroix, F.B.' 2 primary 'Blot, D.' 3 primary 'Gabel, F.' 4 primary 'Skoufias, D.A.' 5 # _cell.entry_id 3MS6 _cell.length_a 48.997 _cell.length_b 48.997 _cell.length_c 71.644 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3MS6 _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hepatitis B virus X-interacting protein' 10881.634 1 ? ? ? ? 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 3 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 2 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HBV X-interacting protein, HBX-interacting protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)EATLEQHLEDT(MSE)KNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNG NI(MSE)IQKHDGITVAVHK(MSE)ASLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHD GITVAVHKMASLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLU n 1 3 ALA n 1 4 THR n 1 5 LEU n 1 6 GLU n 1 7 GLN n 1 8 HIS n 1 9 LEU n 1 10 GLU n 1 11 ASP n 1 12 THR n 1 13 MSE n 1 14 LYS n 1 15 ASN n 1 16 PRO n 1 17 SER n 1 18 ILE n 1 19 VAL n 1 20 GLY n 1 21 VAL n 1 22 LEU n 1 23 CYS n 1 24 THR n 1 25 ASP n 1 26 SER n 1 27 GLN n 1 28 GLY n 1 29 LEU n 1 30 ASN n 1 31 LEU n 1 32 GLY n 1 33 CYS n 1 34 ARG n 1 35 GLY n 1 36 THR n 1 37 LEU n 1 38 SER n 1 39 ASP n 1 40 GLU n 1 41 HIS n 1 42 ALA n 1 43 GLY n 1 44 VAL n 1 45 ILE n 1 46 SER n 1 47 VAL n 1 48 LEU n 1 49 ALA n 1 50 GLN n 1 51 GLN n 1 52 ALA n 1 53 ALA n 1 54 LYS n 1 55 LEU n 1 56 THR n 1 57 SER n 1 58 ASP n 1 59 PRO n 1 60 THR n 1 61 ASP n 1 62 ILE n 1 63 PRO n 1 64 VAL n 1 65 VAL n 1 66 CYS n 1 67 LEU n 1 68 GLU n 1 69 SER n 1 70 ASP n 1 71 ASN n 1 72 GLY n 1 73 ASN n 1 74 ILE n 1 75 MSE n 1 76 ILE n 1 77 GLN n 1 78 LYS n 1 79 HIS n 1 80 ASP n 1 81 GLY n 1 82 ILE n 1 83 THR n 1 84 VAL n 1 85 ALA n 1 86 VAL n 1 87 HIS n 1 88 LYS n 1 89 MSE n 1 90 ALA n 1 91 SER n 1 92 LEU n 1 93 GLU n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HBXIP, XIP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-23d(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HBXIP_HUMAN _struct_ref.pdbx_db_accession O43504 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHD GITVAVHKMAS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3MS6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O43504 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 91 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3MS6 LEU A 92 ? UNP O43504 ? ? 'EXPRESSION TAG' 92 1 1 3MS6 GLU A 93 ? UNP O43504 ? ? 'EXPRESSION TAG' 93 2 1 3MS6 HIS A 94 ? UNP O43504 ? ? 'EXPRESSION TAG' 94 3 1 3MS6 HIS A 95 ? UNP O43504 ? ? 'EXPRESSION TAG' 95 4 1 3MS6 HIS A 96 ? UNP O43504 ? ? 'EXPRESSION TAG' 96 5 1 3MS6 HIS A 97 ? UNP O43504 ? ? 'EXPRESSION TAG' 97 6 1 3MS6 HIS A 98 ? UNP O43504 ? ? 'EXPRESSION TAG' 98 7 1 3MS6 HIS A 99 ? UNP O43504 ? ? 'EXPRESSION TAG' 99 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3MS6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.98 _exptl_crystal.density_percent_sol 37.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pdbx_details '20-24% PEG3350, 20% isopropanol, 0.1M tri-sodium citrate dihydrate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 292K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2009-04-30 _diffrn_detector.details 'Toroidal focusing mirror' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Single Silicon (111) monochromator' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.979 # _reflns.entry_id 3MS6 _reflns.observed_criterion_sigma_I 1 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 48.997 _reflns.d_resolution_high 2.085 _reflns.number_obs 5586 _reflns.number_all 5623 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.096 _reflns.pdbx_Rsym_value 0.093 _reflns.pdbx_netI_over_sigmaI 6.7 _reflns.B_iso_Wilson_estimate 25 _reflns.pdbx_redundancy 12.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.085 _reflns_shell.d_res_low 2.20 _reflns_shell.percent_possible_all 97.5 _reflns_shell.Rmerge_I_obs 0.40 _reflns_shell.pdbx_Rsym_value 0.38 _reflns_shell.meanI_over_sigI_obs 5.9 _reflns_shell.pdbx_redundancy 9.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 774 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3MS6 _refine.ls_number_reflns_obs 5579 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 28.918 _refine.ls_d_res_high 2.085 _refine.ls_percent_reflns_obs 99.50 _refine.ls_R_factor_obs 0.1927 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1910 _refine.ls_R_factor_R_free 0.2283 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.59 _refine.ls_number_reflns_R_free 256 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 0.3140 _refine.aniso_B[2][2] 0.3140 _refine.aniso_B[3][3] -0.6280 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.413 _refine.solvent_model_param_bsol 68.090 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.29 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 666 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 729 _refine_hist.d_res_high 2.085 _refine_hist.d_res_low 28.918 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 722 'X-RAY DIFFRACTION' ? f_angle_d 1.088 ? ? 991 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.905 ? ? 259 'X-RAY DIFFRACTION' ? f_chiral_restr 0.068 ? ? 115 'X-RAY DIFFRACTION' ? f_plane_restr 0.004 ? ? 120 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.085 2.6270 2589 0.1788 99.00 0.2391 . . 121 . . . . 'X-RAY DIFFRACTION' . 2.6270 28.9205 2734 0.1949 100.00 0.2223 . . 135 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 3MS6 _struct.title 'Crystal structure of Hepatitis B X-Interacting Protein (HBXIP)' _struct.pdbx_descriptor 'Hepatitis B virus X-interacting protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3MS6 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'alpha-beta protein, profilin-like fold, Roadblock/LC7 domain superfamily, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 4 ? MSE A 13 ? THR A 4 MSE A 13 1 ? 10 HELX_P HELX_P2 2 SER A 38 ? GLU A 40 ? SER A 38 GLU A 40 5 ? 3 HELX_P HELX_P3 3 HIS A 41 ? LEU A 55 ? HIS A 41 LEU A 55 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A GLU 2 N ? ? A MSE 1 A GLU 2 1_555 ? ? ? ? ? ? ? 1.333 ? covale2 covale ? ? A THR 12 C ? ? ? 1_555 A MSE 13 N ? ? A THR 12 A MSE 13 1_555 ? ? ? ? ? ? ? 1.332 ? covale3 covale ? ? A MSE 13 C ? ? ? 1_555 A LYS 14 N ? ? A MSE 13 A LYS 14 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale ? ? A ILE 74 C ? ? ? 1_555 A MSE 75 N ? ? A ILE 74 A MSE 75 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale ? ? A MSE 75 C ? ? ? 1_555 A ILE 76 N ? ? A MSE 75 A ILE 76 1_555 ? ? ? ? ? ? ? 1.328 ? covale6 covale ? ? A LYS 88 C ? ? ? 1_555 A MSE 89 N ? ? A LYS 88 A MSE 89 1_555 ? ? ? ? ? ? ? 1.324 ? covale7 covale ? ? A MSE 89 C ? ? ? 1_555 A ALA 90 N ? ? A MSE 89 A ALA 90 1_555 ? ? ? ? ? ? ? 1.326 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 58 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 58 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 59 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 59 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.50 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 30 ? GLY A 35 ? ASN A 30 GLY A 35 A 2 ILE A 18 ? THR A 24 ? ILE A 18 THR A 24 A 3 ILE A 82 ? LYS A 88 ? ILE A 82 LYS A 88 A 4 GLY A 72 ? HIS A 79 ? GLY A 72 HIS A 79 A 5 VAL A 65 ? SER A 69 ? VAL A 65 SER A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 31 ? O LEU A 31 N CYS A 23 ? N CYS A 23 A 2 3 N GLY A 20 ? N GLY A 20 O HIS A 87 ? O HIS A 87 A 3 4 O LYS A 88 ? O LYS A 88 N ASN A 73 ? N ASN A 73 A 4 5 O ILE A 76 ? O ILE A 76 N VAL A 65 ? N VAL A 65 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PEG A 100' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IPA A 101' AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IPA A 102' AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 THR A 12 ? THR A 12 . ? 1_555 ? 2 AC1 4 ASP A 25 ? ASP A 25 . ? 7_555 ? 3 AC1 4 HIS A 79 ? HIS A 79 . ? 1_555 ? 4 AC1 4 ASP A 80 ? ASP A 80 . ? 1_555 ? 5 AC2 4 GLU A 68 ? GLU A 68 . ? 1_555 ? 6 AC2 4 SER A 69 ? SER A 69 . ? 1_555 ? 7 AC2 4 ASP A 70 ? ASP A 70 . ? 1_555 ? 8 AC2 4 HOH F . ? HOH A 139 . ? 1_555 ? 9 AC3 2 LEU A 55 ? LEU A 55 . ? 8_555 ? 10 AC3 2 ASN A 71 ? ASN A 71 . ? 1_555 ? 11 AC4 4 THR A 36 ? THR A 36 . ? 1_555 ? 12 AC4 4 ASN A 71 ? ASN A 71 . ? 1_555 ? 13 AC4 4 MSE A 89 ? MSE A 89 . ? 1_555 ? 14 AC4 4 HOH F . ? HOH A 140 . ? 1_555 ? # _database_PDB_matrix.entry_id 3MS6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3MS6 _atom_sites.fract_transf_matrix[1][1] 0.020409 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020409 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013958 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 MSE 13 13 13 MSE MSE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 MSE 75 75 75 MSE MSE A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 MSE 89 89 89 MSE MSE A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 LEU 92 92 ? ? ? A . n A 1 93 GLU 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 13 A MSE 13 ? MET SELENOMETHIONINE 3 A MSE 75 A MSE 75 ? MET SELENOMETHIONINE 4 A MSE 89 A MSE 89 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3500 ? 1 MORE 4 ? 1 'SSA (A^2)' 10010 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 35.8220000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-11-10 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DNA 'data collection' . ? 1 SHARP phasing . ? 2 PHENIX refinement '(phenix.refine)' ? 3 XDS 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 57 ? ? -148.61 49.19 2 1 ASP A 58 ? ? 53.10 -160.88 3 1 ASP A 61 ? ? -64.47 79.93 4 1 ALA A 90 ? ? -91.54 -78.56 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 92 ? A LEU 92 2 1 Y 1 A GLU 93 ? A GLU 93 3 1 Y 1 A HIS 94 ? A HIS 94 4 1 Y 1 A HIS 95 ? A HIS 95 5 1 Y 1 A HIS 96 ? A HIS 96 6 1 Y 1 A HIS 97 ? A HIS 97 7 1 Y 1 A HIS 98 ? A HIS 98 8 1 Y 1 A HIS 99 ? A HIS 99 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 'ISOPROPYL ALCOHOL' IPA 4 GLYCEROL GOL 5 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 100 100 PEG PEG A . C 3 IPA 1 101 101 IPA IPA A . D 3 IPA 1 102 102 IPA IPA A . E 4 GOL 1 103 103 GOL GOL A . F 5 HOH 1 104 1 HOH HOH A . F 5 HOH 2 105 2 HOH HOH A . F 5 HOH 3 106 3 HOH HOH A . F 5 HOH 4 107 4 HOH HOH A . F 5 HOH 5 108 5 HOH HOH A . F 5 HOH 6 109 6 HOH HOH A . F 5 HOH 7 110 7 HOH HOH A . F 5 HOH 8 111 8 HOH HOH A . F 5 HOH 9 112 9 HOH HOH A . F 5 HOH 10 113 10 HOH HOH A . F 5 HOH 11 114 11 HOH HOH A . F 5 HOH 12 115 12 HOH HOH A . F 5 HOH 13 116 13 HOH HOH A . F 5 HOH 14 117 14 HOH HOH A . F 5 HOH 15 118 15 HOH HOH A . F 5 HOH 16 119 16 HOH HOH A . F 5 HOH 17 120 17 HOH HOH A . F 5 HOH 18 121 18 HOH HOH A . F 5 HOH 19 122 19 HOH HOH A . F 5 HOH 20 123 20 HOH HOH A . F 5 HOH 21 124 21 HOH HOH A . F 5 HOH 22 125 22 HOH HOH A . F 5 HOH 23 126 23 HOH HOH A . F 5 HOH 24 127 24 HOH HOH A . F 5 HOH 25 128 25 HOH HOH A . F 5 HOH 26 129 26 HOH HOH A . F 5 HOH 27 130 27 HOH HOH A . F 5 HOH 28 131 28 HOH HOH A . F 5 HOH 29 132 29 HOH HOH A . F 5 HOH 30 133 30 HOH HOH A . F 5 HOH 31 134 31 HOH HOH A . F 5 HOH 32 135 32 HOH HOH A . F 5 HOH 33 136 33 HOH HOH A . F 5 HOH 34 137 34 HOH HOH A . F 5 HOH 35 138 35 HOH HOH A . F 5 HOH 36 139 36 HOH HOH A . F 5 HOH 37 140 37 HOH HOH A . F 5 HOH 38 141 38 HOH HOH A . F 5 HOH 39 142 39 HOH HOH A . F 5 HOH 40 143 40 HOH HOH A . F 5 HOH 41 144 41 HOH HOH A . F 5 HOH 42 145 42 HOH HOH A . #