data_3O8V # _entry.id 3O8V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3O8V RCSB RCSB060811 WWPDB D_1000060811 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3KUF _pdbx_database_related.details 'The same protein labeled with SeMet and structure re-determined by Se-SAD. Structure refinement also included merohedral twinning.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3O8V _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-08-03 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lam, R.' 1 'Guo, Y.H.' 2 'Adams-Cioaba, M.' 3 'Bian, C.B.' 4 'Mackenzie, F.' 5 'Bountra, C.' 6 'Weigelt, J.' 7 'Arrowsmith, C.H.' 8 'Edwards, A.M.' 9 'Bochkarev, A.' 10 'Min, J.' 11 'Structural Genomics Consortium (SGC)' 12 # _citation.id primary _citation.title 'Structural Studies of the Tandem Tudor Domains of Fragile X Mental Retardation Related Proteins FXR1 and FXR2.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 5 _citation.page_first e13559 _citation.page_last e13559 _citation.year 2010 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21072162 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0013559 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Adams-Cioaba, M.A.' 1 primary 'Guo, Y.' 2 primary 'Bian, C.' 3 primary 'Amaya, M.F.' 4 primary 'Lam, R.' 5 primary 'Wasney, G.A.' 6 primary 'Vedadi, M.' 7 primary 'Xu, C.' 8 primary 'Min, J.' 9 # _cell.length_a 71.857 _cell.length_b 71.857 _cell.length_c 94.055 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 3O8V _cell.pdbx_unique_axis ? _cell.Z_PDB 9 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'H 3' _symmetry.entry_id 3O8V _symmetry.Int_Tables_number 146 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fragile X mental retardation syndrome-related protein 1' 15245.146 1 ? ? 'residues 2-132' ? 2 water nat water 18.015 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hFXR1p # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWL AKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVD ; _entity_poly.pdbx_seq_one_letter_code_can ;AELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWL AKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 LEU n 1 4 THR n 1 5 VAL n 1 6 GLU n 1 7 VAL n 1 8 ARG n 1 9 GLY n 1 10 SER n 1 11 ASN n 1 12 GLY n 1 13 ALA n 1 14 PHE n 1 15 TYR n 1 16 LYS n 1 17 GLY n 1 18 PHE n 1 19 ILE n 1 20 LYS n 1 21 ASP n 1 22 VAL n 1 23 HIS n 1 24 GLU n 1 25 ASP n 1 26 SER n 1 27 LEU n 1 28 THR n 1 29 VAL n 1 30 VAL n 1 31 PHE n 1 32 GLU n 1 33 ASN n 1 34 ASN n 1 35 TRP n 1 36 GLN n 1 37 PRO n 1 38 GLU n 1 39 ARG n 1 40 GLN n 1 41 VAL n 1 42 PRO n 1 43 PHE n 1 44 ASN n 1 45 GLU n 1 46 VAL n 1 47 ARG n 1 48 LEU n 1 49 PRO n 1 50 PRO n 1 51 PRO n 1 52 PRO n 1 53 ASP n 1 54 ILE n 1 55 LYS n 1 56 LYS n 1 57 GLU n 1 58 ILE n 1 59 SER n 1 60 GLU n 1 61 GLY n 1 62 ASP n 1 63 GLU n 1 64 VAL n 1 65 GLU n 1 66 VAL n 1 67 TYR n 1 68 SER n 1 69 ARG n 1 70 ALA n 1 71 ASN n 1 72 ASP n 1 73 GLN n 1 74 GLU n 1 75 PRO n 1 76 CYS n 1 77 GLY n 1 78 TRP n 1 79 TRP n 1 80 LEU n 1 81 ALA n 1 82 LYS n 1 83 VAL n 1 84 ARG n 1 85 MET n 1 86 MET n 1 87 LYS n 1 88 GLY n 1 89 GLU n 1 90 PHE n 1 91 TYR n 1 92 VAL n 1 93 ILE n 1 94 GLU n 1 95 TYR n 1 96 ALA n 1 97 ALA n 1 98 CYS n 1 99 ASP n 1 100 ALA n 1 101 THR n 1 102 TYR n 1 103 ASN n 1 104 GLU n 1 105 ILE n 1 106 VAL n 1 107 THR n 1 108 PHE n 1 109 GLU n 1 110 ARG n 1 111 LEU n 1 112 ARG n 1 113 PRO n 1 114 VAL n 1 115 ASN n 1 116 GLN n 1 117 ASN n 1 118 LYS n 1 119 THR n 1 120 VAL n 1 121 LYS n 1 122 LYS n 1 123 ASN n 1 124 THR n 1 125 PHE n 1 126 PHE n 1 127 LYS n 1 128 CYS n 1 129 THR n 1 130 VAL n 1 131 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FXR1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-(DE3)-V2R-pRARE2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28-MHL _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FXR1_HUMAN _struct_ref.pdbx_db_accession P51114 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWL AKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVD ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3O8V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P51114 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3O8V _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.07 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 59.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '1.4M Ammonium Sulfate, 0.1M HEPES pH 6.8, 0.25 M NaCl, 10 mM DTT, VAPOR DIFFUSION, SITTING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2010-05-11 _diffrn_detector.details 'Double crystal monochromator' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'double crystal monochromator' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97904 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97904 _diffrn_source.pdbx_synchrotron_site CLSI _diffrn_source.pdbx_synchrotron_beamline 08ID-1 # _reflns.entry_id 3O8V _reflns.d_resolution_high 2.500 _reflns.d_resolution_low 50.000 _reflns.number_obs 6291 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_netI_over_sigmaI 19.100 _reflns.pdbx_chi_squared 3.016 _reflns.pdbx_redundancy 3.900 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 2.500 2.590 ? ? ? 0.549 ? ? 1.031 3.900 ? 641 100.000 ? 1 2.590 2.690 ? ? ? 0.426 ? ? 1.011 4.000 ? 626 100.000 ? 2 2.690 2.820 ? ? ? 0.322 ? ? 1.117 3.900 ? 613 100.000 ? 3 2.820 2.960 ? ? ? 0.236 ? ? 1.323 3.900 ? 634 100.000 ? 4 2.960 3.150 ? ? ? 0.148 ? ? 1.508 4.000 ? 630 100.000 ? 5 3.150 3.390 ? ? ? 0.087 ? ? 1.930 3.900 ? 627 100.000 ? 6 3.390 3.730 ? ? ? 0.066 ? ? 1.902 4.000 ? 638 100.000 ? 7 3.730 4.270 ? ? ? 0.064 ? ? 1.636 4.000 ? 629 100.000 ? 8 4.270 5.380 ? ? ? 0.056 ? ? 4.988 4.000 ? 625 100.000 ? 9 5.380 50.000 ? ? ? 0.067 ? ? 13.674 4.000 ? 628 99.200 ? 10 # _refine.entry_id 3O8V _refine.ls_d_res_high 2.5000 _refine.ls_d_res_low 35.9300 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.8900 _refine.ls_number_reflns_obs 6288 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY, The data is hemohedral twinning with twinning operators: ((H, K, L),(K, H, -L) and corresponding twinned fractions: 0.941, 0.059. ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2201 _refine.ls_R_factor_R_work 0.2183 _refine.ls_wR_factor_R_work 0.2320 _refine.ls_R_factor_R_free 0.2612 _refine.ls_wR_factor_R_free 0.2650 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_number_reflns_R_free 288 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 71.1447 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 25.8100 _refine.aniso_B[2][2] 25.8100 _refine.aniso_B[3][3] -51.6200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9470 _refine.correlation_coeff_Fo_to_Fc_free 0.9380 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R_Free 0.0520 _refine.overall_SU_ML 0.2050 _refine.overall_SU_B 10.8600 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 141.670 _refine.B_iso_min 38.500 _refine.occupancy_max 1.000 _refine.occupancy_min 1.000 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R 0.063 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 805 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 806 _refine_hist.d_res_high 2.5000 _refine_hist.d_res_low 35.9300 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 826 0.017 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1125 1.760 1.933 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 98 7.546 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 42 37.830 23.810 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 116 22.629 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 6 16.117 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 121 0.111 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 648 0.008 0.021 ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_low _refine_ls_shell.d_res_high _refine_ls_shell.number_reflns_all _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free _refine_ls_shell.number_reflns_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.R_factor_all _refine_ls_shell.pdbx_refine_id 20 2.561 2.496 460 99.565 437 0.217 21 0.468 . . . . . 'X-RAY DIFFRACTION' 20 2.630 2.561 456 99.781 429 0.292 26 0.413 . . . . . 'X-RAY DIFFRACTION' 20 2.706 2.630 441 100.000 411 0.305 30 0.396 . . . . . 'X-RAY DIFFRACTION' 20 2.789 2.706 413 100.000 384 0.297 29 0.371 . . . . . 'X-RAY DIFFRACTION' 20 2.880 2.789 439 100.000 431 0.313 8 0.308 . . . . . 'X-RAY DIFFRACTION' 20 2.980 2.880 367 100.000 349 0.286 18 0.199 . . . . . 'X-RAY DIFFRACTION' 20 3.092 2.980 392 100.000 371 0.280 21 0.339 . . . . . 'X-RAY DIFFRACTION' 20 3.217 3.092 380 100.000 366 0.267 14 0.297 . . . . . 'X-RAY DIFFRACTION' 20 3.359 3.217 360 100.000 338 0.233 22 0.332 . . . . . 'X-RAY DIFFRACTION' 20 3.521 3.359 336 100.000 322 0.250 14 0.405 . . . . . 'X-RAY DIFFRACTION' 20 3.710 3.521 340 100.000 335 0.230 5 0.240 . . . . . 'X-RAY DIFFRACTION' 20 3.932 3.710 304 100.000 295 0.212 9 0.292 . . . . . 'X-RAY DIFFRACTION' 20 4.200 3.932 274 100.000 260 0.175 14 0.202 . . . . . 'X-RAY DIFFRACTION' 20 4.532 4.200 277 100.000 265 0.168 12 0.284 . . . . . 'X-RAY DIFFRACTION' 20 4.956 4.532 247 100.000 242 0.165 5 0.210 . . . . . 'X-RAY DIFFRACTION' 20 5.528 4.956 227 100.000 217 0.191 10 0.148 . . . . . 'X-RAY DIFFRACTION' 20 6.358 5.528 204 100.000 198 0.179 6 0.118 . . . . . 'X-RAY DIFFRACTION' 20 7.727 6.358 164 100.000 152 0.204 12 0.346 . . . . . 'X-RAY DIFFRACTION' 20 10.683 7.727 137 99.270 128 0.205 8 0.170 . . . . . 'X-RAY DIFFRACTION' 20 35.931 10.683 77 96.104 70 0.268 4 0.119 . . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 3O8V _struct.title 'Crystal Structure of the Tudor Domains from FXR1' _struct.pdbx_descriptor 'Fragile X mental retardation syndrome-related protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3O8V _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Structural Genomics Consortium, SGC, Tandem Tudor, protein binding, RNA-binding' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 42 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 44 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 42 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 44 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 39 ? VAL A 41 ? ARG A 39 VAL A 41 A 2 LEU A 27 ? PHE A 31 ? LEU A 27 PHE A 31 A 3 PHE A 14 ? VAL A 22 ? PHE A 14 VAL A 22 A 4 THR A 4 ? ARG A 8 ? THR A 4 ARG A 8 A 5 VAL A 46 ? ARG A 47 ? VAL A 46 ARG A 47 B 1 GLU A 104 ? THR A 107 ? GLU A 104 THR A 107 B 2 PHE A 90 ? GLU A 94 ? PHE A 90 GLU A 94 B 3 GLY A 77 ? LYS A 87 ? GLY A 77 LYS A 87 B 4 GLU A 63 ? SER A 68 ? GLU A 63 SER A 68 B 5 LEU A 111 ? PRO A 113 ? LEU A 111 PRO A 113 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 39 ? O ARG A 39 N VAL A 29 ? N VAL A 29 A 2 3 O THR A 28 ? O THR A 28 N LYS A 20 ? N LYS A 20 A 3 4 O TYR A 15 ? O TYR A 15 N VAL A 7 ? N VAL A 7 A 4 5 N GLU A 6 ? N GLU A 6 O ARG A 47 ? O ARG A 47 B 1 2 O GLU A 104 ? O GLU A 104 N ILE A 93 ? N ILE A 93 B 2 3 O VAL A 92 ? O VAL A 92 N MET A 85 ? N MET A 85 B 3 4 O TRP A 79 ? O TRP A 79 N VAL A 66 ? N VAL A 66 B 4 5 N GLU A 65 ? N GLU A 65 O ARG A 112 ? O ARG A 112 # _atom_sites.entry_id 3O8V _atom_sites.fract_transf_matrix[1][1] 0.013917 _atom_sites.fract_transf_matrix[1][2] 0.008035 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016069 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010632 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASP 53 53 ? ? ? A . n A 1 54 ILE 54 54 ? ? ? A . n A 1 55 LYS 55 55 ? ? ? A . n A 1 56 LYS 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 ILE 58 58 ? ? ? A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 ? ? ? A . n A 1 71 ASN 71 71 ? ? ? A . n A 1 72 ASP 72 72 ? ? ? A . n A 1 73 GLN 73 73 ? ? ? A . n A 1 74 GLU 74 74 ? ? ? A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ALA 96 96 ? ? ? A . n A 1 97 ALA 97 97 ? ? ? A . n A 1 98 CYS 98 98 ? ? ? A . n A 1 99 ASP 99 99 ? ? ? A . n A 1 100 ALA 100 100 ? ? ? A . n A 1 101 THR 101 101 ? ? ? A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LYS 122 122 ? ? ? A . n A 1 123 ASN 123 123 ? ? ? A . n A 1 124 THR 124 124 ? ? ? A . n A 1 125 PHE 125 125 ? ? ? A . n A 1 126 PHE 126 126 ? ? ? A . n A 1 127 LYS 127 127 ? ? ? A . n A 1 128 CYS 128 128 ? ? ? A . n A 1 129 THR 129 129 ? ? ? A . n A 1 130 VAL 130 130 ? ? ? A . n A 1 131 ASP 131 131 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HOH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 132 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id HOH _pdbx_nonpoly_scheme.auth_mon_id HOH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_phasing_MAD_set.id _pdbx_phasing_MAD_set.d_res_low _pdbx_phasing_MAD_set.d_res_high _pdbx_phasing_MAD_set.reflns_acentric _pdbx_phasing_MAD_set.reflns_centric _pdbx_phasing_MAD_set.R_cullis_acentric _pdbx_phasing_MAD_set.R_cullis_centric ISO_1 35.93 2.50 6265 0 0.000 0.000 ANO_1 35.93 2.50 6261 0 0.595 0.000 # loop_ _pdbx_phasing_MAD_set_shell.id _pdbx_phasing_MAD_set_shell.d_res_low _pdbx_phasing_MAD_set_shell.d_res_high _pdbx_phasing_MAD_set_shell.reflns_acentric _pdbx_phasing_MAD_set_shell.reflns_centric _pdbx_phasing_MAD_set_shell.R_cullis_acentric _pdbx_phasing_MAD_set_shell.R_cullis_centric ISO_1 35.93 9.66 105 0 0.000 0.000 ISO_1 9.66 6.95 186 0 0.000 0.000 ISO_1 6.95 5.71 223 0 0.000 0.000 ISO_1 5.71 4.96 287 0 0.000 0.000 ISO_1 4.96 4.45 309 0 0.000 0.000 ISO_1 4.45 4.07 344 0 0.000 0.000 ISO_1 4.07 3.77 371 0 0.000 0.000 ISO_1 3.77 3.53 410 0 0.000 0.000 ISO_1 3.53 3.33 426 0 0.000 0.000 ISO_1 3.33 3.16 453 0 0.000 0.000 ISO_1 3.16 3.01 457 0 0.000 0.000 ISO_1 3.01 2.88 493 0 0.000 0.000 ISO_1 2.88 2.77 526 0 0.000 0.000 ISO_1 2.77 2.67 551 0 0.000 0.000 ISO_1 2.67 2.58 541 0 0.000 0.000 ISO_1 2.58 2.50 583 0 0.000 0.000 ANO_1 35.93 9.66 103 0 0.287 0.000 ANO_1 9.66 6.95 186 0 0.229 0.000 ANO_1 6.95 5.71 223 0 0.274 0.000 ANO_1 5.71 4.96 287 0 0.366 0.000 ANO_1 4.96 4.45 309 0 0.402 0.000 ANO_1 4.45 4.07 344 0 0.581 0.000 ANO_1 4.07 3.77 370 0 0.671 0.000 ANO_1 3.77 3.53 410 0 0.649 0.000 ANO_1 3.53 3.33 426 0 0.734 0.000 ANO_1 3.33 3.16 453 0 0.787 0.000 ANO_1 3.16 3.01 457 0 0.875 0.000 ANO_1 3.01 2.88 493 0 0.929 0.000 ANO_1 2.88 2.77 526 0 0.949 0.000 ANO_1 2.77 2.67 551 0 0.978 0.000 ANO_1 2.67 2.58 541 0 0.994 0.000 ANO_1 2.58 2.50 582 0 1.002 0.000 # loop_ _pdbx_phasing_MAD_set_site.id _pdbx_phasing_MAD_set_site.atom_type_symbol _pdbx_phasing_MAD_set_site.Cartn_x _pdbx_phasing_MAD_set_site.Cartn_y _pdbx_phasing_MAD_set_site.Cartn_z _pdbx_phasing_MAD_set_site.occupancy _pdbx_phasing_MAD_set_site.b_iso 1 SE -24.199 58.232 29.627 0.91 81.05 2 SE -24.816 58.459 39.460 0.88 72.42 # loop_ _pdbx_phasing_MAD_shell.d_res_low _pdbx_phasing_MAD_shell.d_res_high _pdbx_phasing_MAD_shell.reflns_acentric _pdbx_phasing_MAD_shell.fom_acentric _pdbx_phasing_MAD_shell.reflns_centric _pdbx_phasing_MAD_shell.fom_centric 35.93 9.66 105 0.611 0 0.000 9.66 6.95 186 0.649 0 0.000 6.95 5.71 223 0.617 0 0.000 5.71 4.96 287 0.556 0 0.000 4.96 4.45 309 0.553 0 0.000 4.45 4.07 344 0.473 0 0.000 4.07 3.77 371 0.400 0 0.000 3.77 3.53 410 0.450 0 0.000 3.53 3.33 426 0.411 0 0.000 3.33 3.16 453 0.378 0 0.000 3.16 3.01 457 0.307 0 0.000 3.01 2.88 493 0.274 0 0.000 2.88 2.77 526 0.238 0 0.000 2.77 2.67 551 0.189 0 0.000 2.67 2.58 541 0.157 0 0.000 2.58 2.50 583 0.137 0 0.000 # _pdbx_phasing_dm.entry_id 3O8V _pdbx_phasing_dm.method 'Solvent flattening and Histogram matching' _pdbx_phasing_dm.reflns 6263 # loop_ _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.delta_phi_final _pdbx_phasing_dm_shell.delta_phi_initial _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 5.760 100.000 55.600 ? ? ? 0.847 ? ? 503 4.600 5.760 51.000 ? ? ? 0.934 ? ? 511 4.010 4.600 57.800 ? ? ? 0.937 ? ? 502 3.650 4.010 57.500 ? ? ? 0.909 ? ? 502 3.390 3.650 58.600 ? ? ? 0.898 ? ? 502 3.190 3.390 67.400 ? ? ? 0.889 ? ? 511 3.030 3.190 72.800 ? ? ? 0.886 ? ? 511 2.890 3.030 75.900 ? ? ? 0.871 ? ? 507 2.780 2.890 81.000 ? ? ? 0.794 ? ? 505 2.680 2.780 76.700 ? ? ? 0.826 ? ? 503 2.600 2.680 82.200 ? ? ? 0.809 ? ? 509 2.500 2.600 85.800 ? ? ? 0.738 ? ? 697 # _phasing.method SAD # _phasing_MAD.entry_id 3O8V _phasing_MAD.pdbx_d_res_low 35.930 _phasing_MAD.pdbx_d_res_high 2.500 _phasing_MAD.pdbx_reflns_acentric 6265 _phasing_MAD.pdbx_fom_acentric 0.346 _phasing_MAD.pdbx_reflns_centric 0 _phasing_MAD.pdbx_fom_centric 0.000 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 SHARP . ? package 'Eric de La Fortelle' sharp-develop@globalphasing.com phasing http://www.globalphasing.com/sharp/ ? ? 4 DM 6.1 ? program 'Kevin Cowtan' kowtan@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/dm.html Fortran_77 ? 5 REFMAC refmac_5.6.0081 24/04/2001 program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 6 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 7 MxDC . ? ? ? ? 'data collection' ? ? ? 8 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 9 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 33 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -172.50 _pdbx_validate_torsion.psi 136.48 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 24 ? CG ? A GLU 24 CG 2 1 Y 1 A GLU 24 ? CD ? A GLU 24 CD 3 1 Y 1 A GLU 24 ? OE1 ? A GLU 24 OE1 4 1 Y 1 A GLU 24 ? OE2 ? A GLU 24 OE2 5 1 Y 1 A GLN 40 ? CG ? A GLN 40 CG 6 1 Y 1 A GLN 40 ? CD ? A GLN 40 CD 7 1 Y 1 A GLN 40 ? OE1 ? A GLN 40 OE1 8 1 Y 1 A GLN 40 ? NE2 ? A GLN 40 NE2 9 1 Y 1 A SER 59 ? OG ? A SER 59 OG 10 1 Y 1 A ARG 69 ? CG ? A ARG 69 CG 11 1 Y 1 A ARG 69 ? CD ? A ARG 69 CD 12 1 Y 1 A ARG 69 ? NE ? A ARG 69 NE 13 1 Y 1 A ARG 69 ? CZ ? A ARG 69 CZ 14 1 Y 1 A ARG 69 ? NH1 ? A ARG 69 NH1 15 1 Y 1 A ARG 69 ? NH2 ? A ARG 69 NH2 16 1 Y 1 A LYS 82 ? CG ? A LYS 82 CG 17 1 Y 1 A LYS 82 ? CD ? A LYS 82 CD 18 1 Y 1 A LYS 82 ? CE ? A LYS 82 CE 19 1 Y 1 A LYS 82 ? NZ ? A LYS 82 NZ 20 1 Y 1 A LYS 87 ? CG ? A LYS 87 CG 21 1 Y 1 A LYS 87 ? CD ? A LYS 87 CD 22 1 Y 1 A LYS 87 ? CE ? A LYS 87 CE 23 1 Y 1 A LYS 87 ? NZ ? A LYS 87 NZ 24 1 Y 1 A GLU 89 ? CG ? A GLU 89 CG 25 1 Y 1 A GLU 89 ? CD ? A GLU 89 CD 26 1 Y 1 A GLU 89 ? OE1 ? A GLU 89 OE1 27 1 Y 1 A GLU 89 ? OE2 ? A GLU 89 OE2 28 1 Y 1 A TYR 102 ? CG ? A TYR 102 CG 29 1 Y 1 A TYR 102 ? CD1 ? A TYR 102 CD1 30 1 Y 1 A TYR 102 ? CD2 ? A TYR 102 CD2 31 1 Y 1 A TYR 102 ? CE1 ? A TYR 102 CE1 32 1 Y 1 A TYR 102 ? CE2 ? A TYR 102 CE2 33 1 Y 1 A TYR 102 ? CZ ? A TYR 102 CZ 34 1 Y 1 A TYR 102 ? OH ? A TYR 102 OH 35 1 Y 1 A ILE 105 ? CG1 ? A ILE 105 CG1 36 1 Y 1 A ILE 105 ? CG2 ? A ILE 105 CG2 37 1 Y 1 A ILE 105 ? CD1 ? A ILE 105 CD1 38 1 Y 1 A LYS 118 ? CG ? A LYS 118 CG 39 1 Y 1 A LYS 118 ? CD ? A LYS 118 CD 40 1 Y 1 A LYS 118 ? CE ? A LYS 118 CE 41 1 Y 1 A LYS 118 ? NZ ? A LYS 118 NZ 42 1 Y 1 A LYS 121 ? CG ? A LYS 121 CG 43 1 Y 1 A LYS 121 ? CD ? A LYS 121 CD 44 1 Y 1 A LYS 121 ? CE ? A LYS 121 CE 45 1 Y 1 A LYS 121 ? NZ ? A LYS 121 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A ASP 53 ? A ASP 53 4 1 Y 1 A ILE 54 ? A ILE 54 5 1 Y 1 A LYS 55 ? A LYS 55 6 1 Y 1 A LYS 56 ? A LYS 56 7 1 Y 1 A GLU 57 ? A GLU 57 8 1 Y 1 A ILE 58 ? A ILE 58 9 1 Y 1 A ALA 70 ? A ALA 70 10 1 Y 1 A ASN 71 ? A ASN 71 11 1 Y 1 A ASP 72 ? A ASP 72 12 1 Y 1 A GLN 73 ? A GLN 73 13 1 Y 1 A GLU 74 ? A GLU 74 14 1 Y 1 A ALA 96 ? A ALA 96 15 1 Y 1 A ALA 97 ? A ALA 97 16 1 Y 1 A CYS 98 ? A CYS 98 17 1 Y 1 A ASP 99 ? A ASP 99 18 1 Y 1 A ALA 100 ? A ALA 100 19 1 Y 1 A THR 101 ? A THR 101 20 1 Y 1 A LYS 122 ? A LYS 122 21 1 Y 1 A ASN 123 ? A ASN 123 22 1 Y 1 A THR 124 ? A THR 124 23 1 Y 1 A PHE 125 ? A PHE 125 24 1 Y 1 A PHE 126 ? A PHE 126 25 1 Y 1 A LYS 127 ? A LYS 127 26 1 Y 1 A CYS 128 ? A CYS 128 27 1 Y 1 A THR 129 ? A THR 129 28 1 Y 1 A VAL 130 ? A VAL 130 29 1 Y 1 A ASP 131 ? A ASP 131 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_reflns_twin.domain_id _pdbx_reflns_twin.crystal_id _pdbx_reflns_twin.diffrn_id _pdbx_reflns_twin.fraction _pdbx_reflns_twin.operator _pdbx_reflns_twin.type _pdbx_reflns_twin.mean_F_square_over_mean_F2 _pdbx_reflns_twin.mean_I2_over_mean_I_square 1 1 1 0.941 'H, K, L' ? ? ? 2 1 1 0.059 'K, H, -L' ? ? ? #