data_3OA4 # _entry.id 3OA4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3OA4 RCSB RCSB060856 WWPDB D_1000060856 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGRC-000295 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3OA4 _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-08-04 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Malashkevich, V.N.' 1 'Patskovsky, Y.' 2 'Garrett, S.' 3 'Foti, R.' 4 'Toro, R.' 5 'Seidel, R.' 6 'Almo, S.C.' 7 'New York Structural Genomics Research Consortium (NYSGRC)' 8 # _citation.id primary _citation.title 'CRYSTAL STRUCTURE OF hypothetical protein BH1468 from Bacillus halodurans C-125' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Malashkevich, V.N.' 1 primary 'Patskovsky, Y.' 2 primary 'Garrett, S.' 3 primary 'Foti, R.' 4 primary 'Toro, R.' 5 primary 'Seidel, R.' 6 primary 'Almo, S.C.' 7 # _cell.length_a 63.264 _cell.length_b 63.264 _cell.length_c 90.855 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3OA4 _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.entry_id 3OA4 _symmetry.Int_Tables_number 96 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man glyoxalase 18219.891 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BH1468 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VMAEKSNKLDHIGIAVTSIKDVLPFYVGSLKLKLLGMEDLPSQGVKIAFLEIGESKIELLEPLSEESPIAKFIQKRGEGI HHIAIGVKSIEERIQEVKENGVQMINDEPVPGARGAQVAFLHPRSARGVLYEFCEKKEQAENLYFQSHHHHHHWSHPQFE K ; _entity_poly.pdbx_seq_one_letter_code_can ;VMAEKSNKLDHIGIAVTSIKDVLPFYVGSLKLKLLGMEDLPSQGVKIAFLEIGESKIELLEPLSEESPIAKFIQKRGEGI HHIAIGVKSIEERIQEVKENGVQMINDEPVPGARGAQVAFLHPRSARGVLYEFCEKKEQAENLYFQSHHHHHHWSHPQFE K ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGRC-000295 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 MET n 1 3 ALA n 1 4 GLU n 1 5 LYS n 1 6 SER n 1 7 ASN n 1 8 LYS n 1 9 LEU n 1 10 ASP n 1 11 HIS n 1 12 ILE n 1 13 GLY n 1 14 ILE n 1 15 ALA n 1 16 VAL n 1 17 THR n 1 18 SER n 1 19 ILE n 1 20 LYS n 1 21 ASP n 1 22 VAL n 1 23 LEU n 1 24 PRO n 1 25 PHE n 1 26 TYR n 1 27 VAL n 1 28 GLY n 1 29 SER n 1 30 LEU n 1 31 LYS n 1 32 LEU n 1 33 LYS n 1 34 LEU n 1 35 LEU n 1 36 GLY n 1 37 MET n 1 38 GLU n 1 39 ASP n 1 40 LEU n 1 41 PRO n 1 42 SER n 1 43 GLN n 1 44 GLY n 1 45 VAL n 1 46 LYS n 1 47 ILE n 1 48 ALA n 1 49 PHE n 1 50 LEU n 1 51 GLU n 1 52 ILE n 1 53 GLY n 1 54 GLU n 1 55 SER n 1 56 LYS n 1 57 ILE n 1 58 GLU n 1 59 LEU n 1 60 LEU n 1 61 GLU n 1 62 PRO n 1 63 LEU n 1 64 SER n 1 65 GLU n 1 66 GLU n 1 67 SER n 1 68 PRO n 1 69 ILE n 1 70 ALA n 1 71 LYS n 1 72 PHE n 1 73 ILE n 1 74 GLN n 1 75 LYS n 1 76 ARG n 1 77 GLY n 1 78 GLU n 1 79 GLY n 1 80 ILE n 1 81 HIS n 1 82 HIS n 1 83 ILE n 1 84 ALA n 1 85 ILE n 1 86 GLY n 1 87 VAL n 1 88 LYS n 1 89 SER n 1 90 ILE n 1 91 GLU n 1 92 GLU n 1 93 ARG n 1 94 ILE n 1 95 GLN n 1 96 GLU n 1 97 VAL n 1 98 LYS n 1 99 GLU n 1 100 ASN n 1 101 GLY n 1 102 VAL n 1 103 GLN n 1 104 MET n 1 105 ILE n 1 106 ASN n 1 107 ASP n 1 108 GLU n 1 109 PRO n 1 110 VAL n 1 111 PRO n 1 112 GLY n 1 113 ALA n 1 114 ARG n 1 115 GLY n 1 116 ALA n 1 117 GLN n 1 118 VAL n 1 119 ALA n 1 120 PHE n 1 121 LEU n 1 122 HIS n 1 123 PRO n 1 124 ARG n 1 125 SER n 1 126 ALA n 1 127 ARG n 1 128 GLY n 1 129 VAL n 1 130 LEU n 1 131 TYR n 1 132 GLU n 1 133 PHE n 1 134 CYS n 1 135 GLU n 1 136 LYS n 1 137 LYS n 1 138 GLU n 1 139 GLN n 1 140 ALA n 1 141 GLU n 1 142 ASN n 1 143 LEU n 1 144 TYR n 1 145 PHE n 1 146 GLN n 1 147 SER n 1 148 HIS n 1 149 HIS n 1 150 HIS n 1 151 HIS n 1 152 HIS n 1 153 HIS n 1 154 TRP n 1 155 SER n 1 156 HIS n 1 157 PRO n 1 158 GLN n 1 159 PHE n 1 160 GLU n 1 161 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BAB05187.1, BH1468' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain C-125 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus halodurans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272558 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)CODON+RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'BC-PSGX3(BC)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9KCV1_BACHD _struct_ref.pdbx_db_accession Q9KCV1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAEKSNKLDHIGIAVTSIKDVLPFYVGSLKLKLLGMEDLPSQGVKIAFLEIGESKIELLEPLSEESPIAKFIQKRGEGIH HIAIGVKSIEERIQEVKENGVQMINDEPVPGARGAQVAFLHPRSARGVLYEFCEKKEQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3OA4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9KCV1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3OA4 VAL A 1 ? UNP Q9KCV1 ? ? 'expression tag' 1 1 1 3OA4 ALA A 140 ? UNP Q9KCV1 ? ? 'expression tag' 140 2 1 3OA4 GLU A 141 ? UNP Q9KCV1 ? ? 'expression tag' 141 3 1 3OA4 ASN A 142 ? UNP Q9KCV1 ? ? 'expression tag' 142 4 1 3OA4 LEU A 143 ? UNP Q9KCV1 ? ? 'expression tag' 143 5 1 3OA4 TYR A 144 ? UNP Q9KCV1 ? ? 'expression tag' 144 6 1 3OA4 PHE A 145 ? UNP Q9KCV1 ? ? 'expression tag' 145 7 1 3OA4 GLN A 146 ? UNP Q9KCV1 ? ? 'expression tag' 146 8 1 3OA4 SER A 147 ? UNP Q9KCV1 ? ? 'expression tag' 147 9 1 3OA4 HIS A 148 ? UNP Q9KCV1 ? ? 'expression tag' 148 10 1 3OA4 HIS A 149 ? UNP Q9KCV1 ? ? 'expression tag' 149 11 1 3OA4 HIS A 150 ? UNP Q9KCV1 ? ? 'expression tag' 150 12 1 3OA4 HIS A 151 ? UNP Q9KCV1 ? ? 'expression tag' 151 13 1 3OA4 HIS A 152 ? UNP Q9KCV1 ? ? 'expression tag' 152 14 1 3OA4 HIS A 153 ? UNP Q9KCV1 ? ? 'expression tag' 153 15 1 3OA4 TRP A 154 ? UNP Q9KCV1 ? ? 'expression tag' 154 16 1 3OA4 SER A 155 ? UNP Q9KCV1 ? ? 'expression tag' 155 17 1 3OA4 HIS A 156 ? UNP Q9KCV1 ? ? 'expression tag' 156 18 1 3OA4 PRO A 157 ? UNP Q9KCV1 ? ? 'expression tag' 157 19 1 3OA4 GLN A 158 ? UNP Q9KCV1 ? ? 'expression tag' 158 20 1 3OA4 PHE A 159 ? UNP Q9KCV1 ? ? 'expression tag' 159 21 1 3OA4 GLU A 160 ? UNP Q9KCV1 ? ? 'expression tag' 160 22 1 3OA4 LYS A 161 ? UNP Q9KCV1 ? ? 'expression tag' 161 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.crystals_number 1 _exptl.entry_id 3OA4 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 50.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details '2.0 M ammonium sulfate, 0.1 M TRIS, 0.2 M lithium sulfate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2010-06-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.07 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_wavelength_list 1.07 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A # _reflns.entry_id 3OA4 _reflns.d_resolution_high 1.940 _reflns.d_resolution_low 50.000 _reflns.number_obs 14255 _reflns.pdbx_Rmerge_I_obs 0.090 _reflns.pdbx_netI_over_sigmaI 6.700 _reflns.pdbx_chi_squared 0.803 _reflns.pdbx_redundancy 15.200 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.940 1.970 ? ? ? 0.896 ? ? 0.454 13.300 ? 696 100.000 ? 1 1.970 2.010 ? ? ? 0.795 ? ? 0.417 14.300 ? 676 100.000 ? 2 2.010 2.050 ? ? ? 0.664 ? ? 0.400 14.700 ? 728 100.000 ? 3 2.050 2.090 ? ? ? 0.553 ? ? 0.465 15.300 ? 681 100.000 ? 4 2.090 2.140 ? ? ? 0.494 ? ? 0.437 15.400 ? 693 100.000 ? 5 2.140 2.180 ? ? ? 0.415 ? ? 0.472 15.700 ? 690 100.000 ? 6 2.180 2.240 ? ? ? 0.350 ? ? 0.474 15.800 ? 704 100.000 ? 7 2.240 2.300 ? ? ? 0.319 ? ? 0.525 15.900 ? 694 100.000 ? 8 2.300 2.370 ? ? ? 0.292 ? ? 0.509 15.800 ? 707 100.000 ? 9 2.370 2.440 ? ? ? 0.246 ? ? 0.553 15.900 ? 694 100.000 ? 10 2.440 2.530 ? ? ? 0.216 ? ? 0.553 15.700 ? 725 100.000 ? 11 2.530 2.630 ? ? ? 0.170 ? ? 0.650 15.800 ? 698 100.000 ? 12 2.630 2.750 ? ? ? 0.153 ? ? 0.750 15.700 ? 705 100.000 ? 13 2.750 2.900 ? ? ? 0.128 ? ? 0.856 15.700 ? 706 100.000 ? 14 2.900 3.080 ? ? ? 0.108 ? ? 0.988 15.600 ? 712 100.000 ? 15 3.080 3.320 ? ? ? 0.092 ? ? 1.231 15.500 ? 724 100.000 ? 16 3.320 3.650 ? ? ? 0.089 ? ? 1.599 15.100 ? 724 100.000 ? 17 3.650 4.180 ? ? ? 0.077 ? ? 1.694 14.800 ? 737 100.000 ? 18 4.180 5.260 ? ? ? 0.063 ? ? 1.506 14.200 ? 749 99.600 ? 19 5.260 50.000 ? ? ? 0.060 ? ? 1.455 13.400 ? 812 98.700 ? 20 # _refine.entry_id 3OA4 _refine.ls_d_res_high 1.9400 _refine.ls_d_res_low 19.5400 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.3200 _refine.ls_number_reflns_obs 14122 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : RESIDUAL ONLY' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1976 _refine.ls_R_factor_R_work 0.1958 _refine.ls_wR_factor_R_work 0.1969 _refine.ls_R_factor_R_free 0.2342 _refine.ls_wR_factor_R_free 0.2293 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_number_reflns_R_free 703 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 46.9393 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -0.0100 _refine.aniso_B[2][2] -0.0100 _refine.aniso_B[3][3] 0.0200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9630 _refine.correlation_coeff_Fo_to_Fc_free 0.9410 _refine.overall_SU_R_Cruickshank_DPI 0.1396 _refine.overall_SU_R_free 0.1355 _refine.pdbx_overall_ESU_R_Free 0.1350 _refine.overall_SU_ML 0.0920 _refine.overall_SU_B 6.9670 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8488 _refine.B_iso_max 106.180 _refine.B_iso_min 28.410 _refine.occupancy_max 1.000 _refine.occupancy_min 0.500 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1073 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 1141 _refine_hist.d_res_high 1.9400 _refine_hist.d_res_low 19.5400 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1106 0.012 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1486 1.408 2.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 139 5.737 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 48 44.633 25.625 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 215 17.540 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 5 15.534 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 165 0.101 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 808 0.006 0.021 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 687 1.170 3.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1108 4.593 50.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 419 10.899 50.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 377 1.392 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.9400 _refine_ls_shell.d_res_low 1.9900 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 97.6400 _refine_ls_shell.number_reflns_R_work 944 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2250 _refine_ls_shell.R_factor_R_free 0.2670 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 993 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3OA4 _struct.title 'CRYSTAL STRUCTURE OF hypothetical protein BH1468 from Bacillus halodurans C-125' _struct.pdbx_descriptor glyoxalase _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3OA4 _struct_keywords.text ;STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, glyoxalase family, PSI-Biology, LYASE, New York Structural Genomics Research Consortium, NYSGRC ; _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 18 ? SER A 29 ? SER A 18 SER A 29 1 ? 12 HELX_P HELX_P2 2 PRO A 41 ? GLN A 43 ? PRO A 41 GLN A 43 5 ? 3 HELX_P HELX_P3 3 SER A 67 ? GLY A 77 ? SER A 67 GLY A 77 1 ? 11 HELX_P HELX_P4 4 SER A 89 ? ASN A 100 ? SER A 89 ASN A 100 1 ? 12 HELX_P HELX_P5 5 ALA A 113 ? GLY A 115 ? ALA A 113 GLY A 115 5 ? 3 HELX_P HELX_P6 6 HIS A 122 ? ALA A 126 ? HIS A 122 ALA A 126 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 11 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 11 A ZN 300 1_555 ? ? ? ? ? ? ? 1.999 ? metalc2 metalc ? ? A HIS 82 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 82 A ZN 300 1_555 ? ? ? ? ? ? ? 2.158 ? metalc3 metalc ? ? A GLU 132 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 132 A ZN 300 1_555 ? ? ? ? ? ? ? 2.197 ? metalc4 metalc ? ? A GLU 58 OE1 A ? ? 1_555 B ZN . ZN ? ? A GLU 58 A ZN 300 1_555 ? ? ? ? ? ? ? 2.422 ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 D GOL . O1 ? ? A ZN 300 A GOL 302 1_555 ? ? ? ? ? ? ? 2.472 ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 300 A HOH 192 1_555 ? ? ? ? ? ? ? 2.592 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 33 ? LEU A 40 ? LYS A 33 LEU A 40 A 2 VAL A 45 ? ILE A 52 ? VAL A 45 ILE A 52 A 3 SER A 55 ? PRO A 62 ? SER A 55 PRO A 62 A 4 LYS A 8 ? ALA A 15 ? LYS A 8 ALA A 15 A 5 GLY A 79 ? GLY A 86 ? GLY A 79 GLY A 86 A 6 TYR A 131 ? GLU A 135 ? TYR A 131 GLU A 135 A 7 GLN A 117 ? PHE A 120 ? GLN A 117 PHE A 120 A 8 VAL A 110 ? PRO A 111 ? VAL A 110 PRO A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 38 ? N GLU A 38 O ILE A 47 ? O ILE A 47 A 2 3 N LYS A 46 ? N LYS A 46 O GLU A 61 ? O GLU A 61 A 3 4 O GLU A 58 ? O GLU A 58 N ILE A 14 ? N ILE A 14 A 4 5 N GLY A 13 ? N GLY A 13 O HIS A 81 ? O HIS A 81 A 5 6 N ILE A 85 ? N ILE A 85 O GLU A 132 ? O GLU A 132 A 6 7 O PHE A 133 ? O PHE A 133 N ALA A 119 ? N ALA A 119 A 7 8 O VAL A 118 ? O VAL A 118 N VAL A 110 ? N VAL A 110 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN A 300' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 301' AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 11 ? HIS A 11 . ? 1_555 ? 2 AC1 6 GLU A 58 ? GLU A 58 . ? 1_555 ? 3 AC1 6 HIS A 82 ? HIS A 82 . ? 1_555 ? 4 AC1 6 GLU A 132 ? GLU A 132 . ? 1_555 ? 5 AC1 6 HOH E . ? HOH A 192 . ? 1_555 ? 6 AC1 6 GOL D . ? GOL A 302 . ? 1_555 ? 7 AC2 5 LYS A 56 ? LYS A 56 . ? 1_555 ? 8 AC2 5 ARG A 114 ? ARG A 114 . ? 1_555 ? 9 AC2 5 ARG A 124 ? ARG A 124 . ? 5_554 ? 10 AC2 5 LYS A 136 ? LYS A 136 . ? 1_555 ? 11 AC2 5 HOH E . ? HOH A 201 . ? 5_554 ? 12 AC3 4 GLU A 58 ? GLU A 58 . ? 1_555 ? 13 AC3 4 GLU A 132 ? GLU A 132 . ? 1_555 ? 14 AC3 4 HOH E . ? HOH A 192 . ? 1_555 ? 15 AC3 4 ZN B . ? ZN A 300 . ? 1_555 ? # _atom_sites.entry_id 3OA4 _atom_sites.fract_transf_matrix[1][1] 0.015807 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015807 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011007 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 ? ? ? A . n A 1 2 MET 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 CYS 134 134 134 CYS CYS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 LEU 143 143 ? ? ? A . n A 1 144 TYR 144 144 ? ? ? A . n A 1 145 PHE 145 145 ? ? ? A . n A 1 146 GLN 146 146 ? ? ? A . n A 1 147 SER 147 147 ? ? ? A . n A 1 148 HIS 148 148 ? ? ? A . n A 1 149 HIS 149 149 ? ? ? A . n A 1 150 HIS 150 150 ? ? ? A . n A 1 151 HIS 151 151 ? ? ? A . n A 1 152 HIS 152 152 ? ? ? A . n A 1 153 HIS 153 153 ? ? ? A . n A 1 154 TRP 154 154 ? ? ? A . n A 1 155 SER 155 155 ? ? ? A . n A 1 156 HIS 156 156 ? ? ? A . n A 1 157 PRO 157 157 ? ? ? A . n A 1 158 GLN 158 158 ? ? ? A . n A 1 159 PHE 159 159 ? ? ? A . n A 1 160 GLU 160 160 ? ? ? A . n A 1 161 LYS 161 161 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'New York Structural Genomics Research Consortium' _pdbx_SG_project.initial_of_center NYSGRC # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4430 ? 1 MORE -126 ? 1 'SSA (A^2)' 14040 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -45.4275000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 194 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 11 ? A HIS 11 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 82 ? A HIS 82 ? 1_555 101.6 ? 2 NE2 ? A HIS 11 ? A HIS 11 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 OE2 ? A GLU 132 ? A GLU 132 ? 1_555 99.7 ? 3 NE2 ? A HIS 82 ? A HIS 82 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 OE2 ? A GLU 132 ? A GLU 132 ? 1_555 85.5 ? 4 NE2 ? A HIS 11 ? A HIS 11 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 OE1 A A GLU 58 ? A GLU 58 ? 1_555 82.9 ? 5 NE2 ? A HIS 82 ? A HIS 82 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 OE1 A A GLU 58 ? A GLU 58 ? 1_555 93.9 ? 6 OE2 ? A GLU 132 ? A GLU 132 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 OE1 A A GLU 58 ? A GLU 58 ? 1_555 177.4 ? 7 NE2 ? A HIS 11 ? A HIS 11 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O1 ? D GOL . ? A GOL 302 ? 1_555 148.7 ? 8 NE2 ? A HIS 82 ? A HIS 82 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O1 ? D GOL . ? A GOL 302 ? 1_555 105.9 ? 9 OE2 ? A GLU 132 ? A GLU 132 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O1 ? D GOL . ? A GOL 302 ? 1_555 97.2 ? 10 OE1 A A GLU 58 ? A GLU 58 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O1 ? D GOL . ? A GOL 302 ? 1_555 80.5 ? 11 NE2 ? A HIS 11 ? A HIS 11 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O ? E HOH . ? A HOH 192 ? 1_555 95.7 ? 12 NE2 ? A HIS 82 ? A HIS 82 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O ? E HOH . ? A HOH 192 ? 1_555 162.5 ? 13 OE2 ? A GLU 132 ? A GLU 132 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O ? E HOH . ? A HOH 192 ? 1_555 88.9 ? 14 OE1 A A GLU 58 ? A GLU 58 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O ? E HOH . ? A HOH 192 ? 1_555 90.9 ? 15 O1 ? D GOL . ? A GOL 302 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O ? E HOH . ? A HOH 192 ? 1_555 58.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-18 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 17.1646 _pdbx_refine_tls.origin_y -8.7124 _pdbx_refine_tls.origin_z -14.7577 _pdbx_refine_tls.T[1][1] 0.0446 _pdbx_refine_tls.T[2][2] 0.0225 _pdbx_refine_tls.T[3][3] 0.0333 _pdbx_refine_tls.T[1][2] 0.0132 _pdbx_refine_tls.T[1][3] -0.0085 _pdbx_refine_tls.T[2][3] -0.0192 _pdbx_refine_tls.L[1][1] 1.2162 _pdbx_refine_tls.L[2][2] 2.3270 _pdbx_refine_tls.L[3][3] 1.5725 _pdbx_refine_tls.L[1][2] 0.8994 _pdbx_refine_tls.L[1][3] -0.1353 _pdbx_refine_tls.L[2][3] -0.4745 _pdbx_refine_tls.S[1][1] 0.0961 _pdbx_refine_tls.S[2][2] 0.0070 _pdbx_refine_tls.S[3][3] -0.1031 _pdbx_refine_tls.S[1][2] -0.0758 _pdbx_refine_tls.S[1][3] 0.0058 _pdbx_refine_tls.S[2][3] -0.0307 _pdbx_refine_tls.S[2][1] 0.2530 _pdbx_refine_tls.S[3][1] -0.1105 _pdbx_refine_tls.S[3][2] 0.0246 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id -10 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 9999 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # _pdbx_phasing_MR.entry_id 3OA4 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor 59.380 _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.500 _pdbx_phasing_MR.d_res_low_rotation 36.900 _pdbx_phasing_MR.d_res_high_translation 2.500 _pdbx_phasing_MR.d_res_low_translation 36.900 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALEPACK . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 PHASER 2.1.4 'Fri Feb 26 23:55:22 2010' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 3 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 CBASS . ? ? ? ? 'data collection' ? ? ? 6 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? 76.98 -9.08 2 1 GLU A 141 ? ? 105.16 156.89 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 1 ? A VAL 1 2 1 Y 1 A MET 2 ? A MET 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A LEU 143 ? A LEU 143 6 1 Y 1 A TYR 144 ? A TYR 144 7 1 Y 1 A PHE 145 ? A PHE 145 8 1 Y 1 A GLN 146 ? A GLN 146 9 1 Y 1 A SER 147 ? A SER 147 10 1 Y 1 A HIS 148 ? A HIS 148 11 1 Y 1 A HIS 149 ? A HIS 149 12 1 Y 1 A HIS 150 ? A HIS 150 13 1 Y 1 A HIS 151 ? A HIS 151 14 1 Y 1 A HIS 152 ? A HIS 152 15 1 Y 1 A HIS 153 ? A HIS 153 16 1 Y 1 A TRP 154 ? A TRP 154 17 1 Y 1 A SER 155 ? A SER 155 18 1 Y 1 A HIS 156 ? A HIS 156 19 1 Y 1 A PRO 157 ? A PRO 157 20 1 Y 1 A GLN 158 ? A GLN 158 21 1 Y 1 A PHE 159 ? A PHE 159 22 1 Y 1 A GLU 160 ? A GLU 160 23 1 Y 1 A LYS 161 ? A LYS 161 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'SULFATE ION' SO4 4 GLYCEROL GOL 5 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 300 300 ZN ZN A . C 3 SO4 1 301 301 SO4 SO4 A . D 4 GOL 1 302 302 GOL GOL A . E 5 HOH 1 162 1 HOH HOH A . E 5 HOH 2 163 2 HOH HOH A . E 5 HOH 3 164 4 HOH HOH A . E 5 HOH 4 165 5 HOH HOH A . E 5 HOH 5 166 6 HOH HOH A . E 5 HOH 6 167 7 HOH HOH A . E 5 HOH 7 168 10 HOH HOH A . E 5 HOH 8 169 11 HOH HOH A . E 5 HOH 9 170 12 HOH HOH A . E 5 HOH 10 171 13 HOH HOH A . E 5 HOH 11 172 14 HOH HOH A . E 5 HOH 12 173 15 HOH HOH A . E 5 HOH 13 174 16 HOH HOH A . E 5 HOH 14 175 17 HOH HOH A . E 5 HOH 15 176 22 HOH HOH A . E 5 HOH 16 177 25 HOH HOH A . E 5 HOH 17 178 27 HOH HOH A . E 5 HOH 18 179 29 HOH HOH A . E 5 HOH 19 180 30 HOH HOH A . E 5 HOH 20 181 31 HOH HOH A . E 5 HOH 21 182 32 HOH HOH A . E 5 HOH 22 183 33 HOH HOH A . E 5 HOH 23 184 34 HOH HOH A . E 5 HOH 24 185 35 HOH HOH A . E 5 HOH 25 186 36 HOH HOH A . E 5 HOH 26 187 38 HOH HOH A . E 5 HOH 27 188 40 HOH HOH A . E 5 HOH 28 189 45 HOH HOH A . E 5 HOH 29 190 46 HOH HOH A . E 5 HOH 30 191 49 HOH HOH A . E 5 HOH 31 192 54 HOH HOH A . E 5 HOH 32 193 55 HOH HOH A . E 5 HOH 33 194 56 HOH HOH A . E 5 HOH 34 195 57 HOH HOH A . E 5 HOH 35 196 59 HOH HOH A . E 5 HOH 36 197 61 HOH HOH A . E 5 HOH 37 198 62 HOH HOH A . E 5 HOH 38 199 63 HOH HOH A . E 5 HOH 39 200 64 HOH HOH A . E 5 HOH 40 201 65 HOH HOH A . E 5 HOH 41 202 66 HOH HOH A . E 5 HOH 42 203 67 HOH HOH A . E 5 HOH 43 204 71 HOH HOH A . E 5 HOH 44 205 72 HOH HOH A . E 5 HOH 45 206 74 HOH HOH A . E 5 HOH 46 207 75 HOH HOH A . E 5 HOH 47 208 80 HOH HOH A . E 5 HOH 48 209 81 HOH HOH A . E 5 HOH 49 210 85 HOH HOH A . E 5 HOH 50 211 87 HOH HOH A . E 5 HOH 51 212 88 HOH HOH A . E 5 HOH 52 213 89 HOH HOH A . E 5 HOH 53 214 90 HOH HOH A . E 5 HOH 54 215 91 HOH HOH A . E 5 HOH 55 216 92 HOH HOH A . E 5 HOH 56 217 93 HOH HOH A . #