data_3OAN # _entry.id 3OAN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3OAN RCSB RCSB060875 WWPDB D_1000060875 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3N7C . unspecified TargetDB NYSGXRC-15002c . unspecified # _pdbx_database_status.entry_id 3OAN _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-08-05 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Malashkevich, V.N.' 1 ? 'Toro, R.' 2 ? 'Sauder, J.M.' 3 0000-0002-0254-4955 'Burley, S.K.' 4 0000-0002-2487-9713 'Almo, S.C.' 5 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 6 ? # _citation.id primary _citation.title ;Crystal structure of the Ran Binding Domain From The Nuclear Complex Component Nup2 From Ashbya Gossypii ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Malashkevich, V.N.' 1 ? primary 'Toro, R.' 2 ? primary 'Sauder, J.M.' 3 ? primary 'Burley, S.K.' 4 0000-0002-2487-9713 primary 'Almo, S.C.' 5 ? # _cell.entry_id 3OAN _cell.length_a 65.691 _cell.length_b 65.691 _cell.length_c 72.869 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3OAN _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ABR034Wp 14895.514 1 ? C54M 'C-terminal residues 497-615' ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 water nat water 18.015 37 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SLTNGEENEEVLFCEKAKLLIFDSDTKGYTSRGVGELKLLRKKDDKGKVRVL(MSE)RSEG(MSE)GHVLLNTSV VKSFKYQPIDADNENLIKWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQA(MSE)EGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLTNGEENEEVLFCEKAKLLIFDSDTKGYTSRGVGELKLLRKKDDKGKVRVLMRSEGMGHVLLNTSVVKSFKYQPIDAD NENLIKWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQAMEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-15002c # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 LEU n 1 4 THR n 1 5 ASN n 1 6 GLY n 1 7 GLU n 1 8 GLU n 1 9 ASN n 1 10 GLU n 1 11 GLU n 1 12 VAL n 1 13 LEU n 1 14 PHE n 1 15 CYS n 1 16 GLU n 1 17 LYS n 1 18 ALA n 1 19 LYS n 1 20 LEU n 1 21 LEU n 1 22 ILE n 1 23 PHE n 1 24 ASP n 1 25 SER n 1 26 ASP n 1 27 THR n 1 28 LYS n 1 29 GLY n 1 30 TYR n 1 31 THR n 1 32 SER n 1 33 ARG n 1 34 GLY n 1 35 VAL n 1 36 GLY n 1 37 GLU n 1 38 LEU n 1 39 LYS n 1 40 LEU n 1 41 LEU n 1 42 ARG n 1 43 LYS n 1 44 LYS n 1 45 ASP n 1 46 ASP n 1 47 LYS n 1 48 GLY n 1 49 LYS n 1 50 VAL n 1 51 ARG n 1 52 VAL n 1 53 LEU n 1 54 MSE n 1 55 ARG n 1 56 SER n 1 57 GLU n 1 58 GLY n 1 59 MSE n 1 60 GLY n 1 61 HIS n 1 62 VAL n 1 63 LEU n 1 64 LEU n 1 65 ASN n 1 66 THR n 1 67 SER n 1 68 VAL n 1 69 VAL n 1 70 LYS n 1 71 SER n 1 72 PHE n 1 73 LYS n 1 74 TYR n 1 75 GLN n 1 76 PRO n 1 77 ILE n 1 78 ASP n 1 79 ALA n 1 80 ASP n 1 81 ASN n 1 82 GLU n 1 83 ASN n 1 84 LEU n 1 85 ILE n 1 86 LYS n 1 87 TRP n 1 88 PRO n 1 89 ILE n 1 90 ILE n 1 91 THR n 1 92 ASP n 1 93 GLY n 1 94 LYS n 1 95 LEU n 1 96 GLU n 1 97 THR n 1 98 PHE n 1 99 ILE n 1 100 ILE n 1 101 LYS n 1 102 VAL n 1 103 LYS n 1 104 GLN n 1 105 LYS n 1 106 ALA n 1 107 ASP n 1 108 GLY n 1 109 ARG n 1 110 ARG n 1 111 LEU n 1 112 VAL n 1 113 GLY n 1 114 ALA n 1 115 VAL n 1 116 ALA n 1 117 ASP n 1 118 ALA n 1 119 GLN n 1 120 GLN n 1 121 ALA n 1 122 MSE n 1 123 GLU n 1 124 GLY n 1 125 HIS n 1 126 HIS n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ABR034W, AGOS_ABR034W' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'TCC 10895' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ashbya gossypii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 33169 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)CODON+RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'BC-PSGX3(BC)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q75DJ0_ASHGO _struct_ref.pdbx_db_accession Q75DJ0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TNGEENEEVLFCEKAKLLIFDSDTKGYTSRGVGELKLLRKKDDKGKVRVLCRSEGMGHVLLNTSVVKSFKYQPIDADNEN LIKWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQAM ; _struct_ref.pdbx_align_begin 497 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3OAN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q75DJ0 _struct_ref_seq.db_align_beg 497 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 615 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 122 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3OAN MSE A 1 ? UNP Q75DJ0 ? ? 'expression tag' 1 1 1 3OAN SER A 2 ? UNP Q75DJ0 ? ? 'expression tag' 2 2 1 3OAN LEU A 3 ? UNP Q75DJ0 ? ? 'expression tag' 3 3 1 3OAN MSE A 54 ? UNP Q75DJ0 CYS 547 'engineered mutation' 54 4 1 3OAN GLU A 123 ? UNP Q75DJ0 ? ? 'expression tag' 123 5 1 3OAN GLY A 124 ? UNP Q75DJ0 ? ? 'expression tag' 124 6 1 3OAN HIS A 125 ? UNP Q75DJ0 ? ? 'expression tag' 125 7 1 3OAN HIS A 126 ? UNP Q75DJ0 ? ? 'expression tag' 126 8 1 3OAN HIS A 127 ? UNP Q75DJ0 ? ? 'expression tag' 127 9 1 3OAN HIS A 128 ? UNP Q75DJ0 ? ? 'expression tag' 128 10 1 3OAN HIS A 129 ? UNP Q75DJ0 ? ? 'expression tag' 129 11 1 3OAN HIS A 130 ? UNP Q75DJ0 ? ? 'expression tag' 130 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3OAN _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_percent_sol 53.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '30% PEG8000, 0.1M na-cacodylate, 0.2 M sodium acetate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2010-05-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9791 # _reflns.entry_id 3OAN _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.200 _reflns.number_obs 15579 _reflns.number_all ? _reflns.percent_possible_obs 99.900 _reflns.pdbx_Rmerge_I_obs 0.055 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.500 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.500 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 2.200 2.240 99.400 0.830 ? ? 6.300 ? ? ? ? ? ? ? 1 2.240 2.280 99.800 0.738 ? ? 6.800 ? ? ? ? ? ? ? 2 2.280 2.320 100.000 0.623 ? ? 7.200 ? ? ? ? ? ? ? 3 2.320 2.370 100.000 0.518 ? ? 7.400 ? ? ? ? ? ? ? 4 2.370 2.420 100.000 0.457 ? ? 7.600 ? ? ? ? ? ? ? 5 2.420 2.480 100.000 0.365 ? ? 7.600 ? ? ? ? ? ? ? 6 2.480 2.540 100.000 0.319 ? ? 7.700 ? ? ? ? ? ? ? 7 2.540 2.610 100.000 0.266 ? ? 7.600 ? ? ? ? ? ? ? 8 2.610 2.690 100.000 0.231 ? ? 7.600 ? ? ? ? ? ? ? 9 2.690 2.770 100.000 0.207 ? ? 7.600 ? ? ? ? ? ? ? 10 2.770 2.870 100.000 0.146 ? ? 7.600 ? ? ? ? ? ? ? 11 2.870 2.990 100.000 0.124 ? ? 7.600 ? ? ? ? ? ? ? 12 2.990 3.120 100.000 0.088 ? ? 7.600 ? ? ? ? ? ? ? 13 3.120 3.290 100.000 0.067 ? ? 7.700 ? ? ? ? ? ? ? 14 3.290 3.490 100.000 0.054 ? ? 7.600 ? ? ? ? ? ? ? 15 3.490 3.760 100.000 0.049 ? ? 7.600 ? ? ? ? ? ? ? 16 3.760 4.140 100.000 0.043 ? ? 7.600 ? ? ? ? ? ? ? 17 4.140 4.740 100.000 0.036 ? ? 7.500 ? ? ? ? ? ? ? 18 4.740 5.970 100.000 0.030 ? ? 7.300 ? ? ? ? ? ? ? 19 5.970 50.000 98.900 0.026 ? ? 7.600 ? ? ? ? ? ? ? 20 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3OAN _refine.ls_number_reflns_obs 7153 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.98 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 99.96 _refine.ls_R_factor_obs 0.21302 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20934 _refine.ls_R_factor_R_free 0.28869 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 354 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min 0.500 _refine.occupancy_max 1.000 _refine.correlation_coeff_Fo_to_Fc 0.950 _refine.correlation_coeff_Fo_to_Fc_free 0.896 _refine.B_iso_mean 53.948 _refine.aniso_B[1][1] 0.21 _refine.aniso_B[2][2] 0.21 _refine.aniso_B[3][3] -0.42 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.266 _refine.pdbx_overall_ESU_R_Free 0.248 _refine.overall_SU_ML 0.171 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 15.354 _refine.overall_SU_R_Cruickshank_DPI 0.2704 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 916 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 959 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 19.98 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.009 0.022 ? 940 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.213 1.990 ? 1256 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.006 5.000 ? 117 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 41.423 24.634 ? 41 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.478 15.000 ? 196 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.370 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.089 0.200 ? 142 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.020 ? 671 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.838 3.500 ? 575 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 3.756 50.000 ? 925 'X-RAY DIFFRACTION' ? r_scbond_it 9.041 50.000 ? 365 'X-RAY DIFFRACTION' ? r_scangle_it 0.795 4.500 ? 330 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.300 _refine_ls_shell.d_res_low 2.359 _refine_ls_shell.number_reflns_R_work 516 _refine_ls_shell.R_factor_R_work 0.265 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.295 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 27 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 3OAN _struct.title 'Crystal structure of the Ran Binding Domain From The Nuclear Complex Component Nup2 From Ashbya Gossypii' _struct.pdbx_descriptor ABR034Wp _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3OAN _struct_keywords.text ;STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, PSI-2, New York SGX Research Center for Structural Genomics, TRANSPORT PROTEIN ; _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 104 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 123 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 104 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 123 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 53 C ? ? ? 1_555 A MSE 54 N ? ? A LEU 53 A MSE 54 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A MSE 54 C ? ? ? 1_555 A ARG 55 N ? ? A MSE 54 A ARG 55 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A GLY 58 C ? ? ? 1_555 A MSE 59 N ? ? A GLY 58 A MSE 59 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale4 covale both ? A MSE 59 C ? ? ? 1_555 A GLY 60 N ? ? A MSE 59 A GLY 60 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale5 covale both ? A ALA 121 C ? ? ? 1_555 A MSE 122 N ? ? A ALA 121 A MSE 122 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale6 covale both ? A MSE 122 C ? ? ? 1_555 A GLU 123 N ? ? A MSE 122 A GLU 123 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 62 ? SER A 67 ? VAL A 62 SER A 67 A 2 ASP A 46 ? SER A 56 ? ASP A 46 SER A 56 A 3 GLY A 29 ? LYS A 43 ? GLY A 29 LYS A 43 A 4 GLU A 10 ? ASP A 24 ? GLU A 10 ASP A 24 A 5 LYS A 94 ? LYS A 101 ? LYS A 94 LYS A 101 A 6 LEU A 84 ? THR A 91 ? LEU A 84 THR A 91 A 7 GLN A 75 ? PRO A 76 ? GLN A 75 PRO A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 63 ? O LEU A 63 N MSE A 54 ? N MSE A 54 A 2 3 O ARG A 51 ? O ARG A 51 N LEU A 41 ? N LEU A 41 A 3 4 O ARG A 33 ? O ARG A 33 N LEU A 20 ? N LEU A 20 A 4 5 N LEU A 21 ? N LEU A 21 O ILE A 99 ? O ILE A 99 A 5 6 O GLU A 96 ? O GLU A 96 N ILE A 89 ? N ILE A 89 A 6 7 O LYS A 86 ? O LYS A 86 N GLN A 75 ? N GLN A 75 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GOL _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE GOL A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASN A 65 ? ASN A 65 . ? 1_555 ? 2 AC1 3 THR A 66 ? THR A 66 . ? 1_555 ? 3 AC1 3 ILE A 89 ? ILE A 89 . ? 1_555 ? # _atom_sites.entry_id 3OAN _atom_sites.fract_transf_matrix[1][1] 0.015223 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015223 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013723 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 MSE 54 54 54 MSE MSE A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 MSE 59 59 59 MSE MSE A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 MSE 122 122 122 MSE MSE A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 GLY 124 124 ? ? ? A . n A 1 125 HIS 125 125 ? ? ? A . n A 1 126 HIS 126 126 ? ? ? A . n A 1 127 HIS 127 127 ? ? ? A . n A 1 128 HIS 128 128 ? ? ? A . n A 1 129 HIS 129 129 ? ? ? A . n A 1 130 HIS 130 130 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 300 300 GOL GOL A . C 3 HOH 1 131 1 HOH HOH A . C 3 HOH 2 132 2 HOH HOH A . C 3 HOH 3 133 4 HOH HOH A . C 3 HOH 4 134 5 HOH HOH A . C 3 HOH 5 135 6 HOH HOH A . C 3 HOH 6 136 8 HOH HOH A . C 3 HOH 7 137 11 HOH HOH A . C 3 HOH 8 138 12 HOH HOH A . C 3 HOH 9 139 14 HOH HOH A . C 3 HOH 10 140 16 HOH HOH A . C 3 HOH 11 141 17 HOH HOH A . C 3 HOH 12 142 18 HOH HOH A . C 3 HOH 13 143 20 HOH HOH A . C 3 HOH 14 144 22 HOH HOH A . C 3 HOH 15 145 25 HOH HOH A . C 3 HOH 16 146 26 HOH HOH A . C 3 HOH 17 147 27 HOH HOH A . C 3 HOH 18 148 28 HOH HOH A . C 3 HOH 19 149 29 HOH HOH A . C 3 HOH 20 150 30 HOH HOH A . C 3 HOH 21 151 32 HOH HOH A . C 3 HOH 22 152 34 HOH HOH A . C 3 HOH 23 153 35 HOH HOH A . C 3 HOH 24 154 37 HOH HOH A . C 3 HOH 25 155 38 HOH HOH A . C 3 HOH 26 156 41 HOH HOH A . C 3 HOH 27 157 43 HOH HOH A . C 3 HOH 28 158 44 HOH HOH A . C 3 HOH 29 159 46 HOH HOH A . C 3 HOH 30 160 47 HOH HOH A . C 3 HOH 31 161 49 HOH HOH A . C 3 HOH 32 162 51 HOH HOH A . C 3 HOH 33 163 52 HOH HOH A . C 3 HOH 34 164 53 HOH HOH A . C 3 HOH 35 165 54 HOH HOH A . C 3 HOH 36 166 55 HOH HOH A . C 3 HOH 37 167 56 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 54 A MSE 54 ? MET SELENOMETHIONINE 2 A MSE 59 A MSE 59 ? MET SELENOMETHIONINE 3 A MSE 122 A MSE 122 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-11-21 4 'Structure model' 1 3 2021-02-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Structure summary' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 4 'Structure model' audit_author 3 4 'Structure model' citation_author 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_audit_author.identifier_ORCID' 3 4 'Structure model' '_citation_author.identifier_ORCID' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 27.3961 _pdbx_refine_tls.origin_y 18.0178 _pdbx_refine_tls.origin_z 24.6684 _pdbx_refine_tls.T[1][1] 0.0282 _pdbx_refine_tls.T[2][2] 0.0329 _pdbx_refine_tls.T[3][3] 0.0189 _pdbx_refine_tls.T[1][2] 0.0058 _pdbx_refine_tls.T[1][3] -0.0093 _pdbx_refine_tls.T[2][3] -0.0120 _pdbx_refine_tls.L[1][1] 3.7463 _pdbx_refine_tls.L[2][2] 4.1817 _pdbx_refine_tls.L[3][3] 3.1785 _pdbx_refine_tls.L[1][2] 0.0540 _pdbx_refine_tls.L[1][3] -0.3909 _pdbx_refine_tls.L[2][3] 1.1660 _pdbx_refine_tls.S[1][1] 0.0648 _pdbx_refine_tls.S[1][2] 0.2792 _pdbx_refine_tls.S[1][3] -0.1241 _pdbx_refine_tls.S[2][1] -0.1679 _pdbx_refine_tls.S[2][2] -0.1537 _pdbx_refine_tls.S[2][3] 0.1921 _pdbx_refine_tls.S[3][1] -0.1845 _pdbx_refine_tls.S[3][2] -0.0535 _pdbx_refine_tls.S[3][3] 0.0890 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id -10 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 9999 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # _phasing.method SAD # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALEPACK . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 3 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 CBASS . ? ? ? ? 'data collection' ? ? ? 5 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 6 PHENIX . ? ? ? ? phasing ? ? ? # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 THR _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 91 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 92 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -133.93 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A GLY 124 ? A GLY 124 9 1 Y 1 A HIS 125 ? A HIS 125 10 1 Y 1 A HIS 126 ? A HIS 126 11 1 Y 1 A HIS 127 ? A HIS 127 12 1 Y 1 A HIS 128 ? A HIS 128 13 1 Y 1 A HIS 129 ? A HIS 129 14 1 Y 1 A HIS 130 ? A HIS 130 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH #