data_3OC1 # _entry.id 3OC1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3OC1 RCSB RCSB060925 WWPDB D_1000060925 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3MGY . unspecified PDB 3MH2 . unspecified PDB 3MH0 . unspecified PDB 3MH1 . unspecified PDB 3MH3 . unspecified PDB 3O8P . unspecified PDB 3O8T . unspecified PDB 3O8U . unspecified PDB 3OBG . unspecified PDB 3OBJ . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3OC1 _pdbx_database_status.recvd_initial_deposition_date 2010-08-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Namboodiri, H.V.' 1 'Karpusas, M.' 2 'Bukhtiyarova, M.' 3 'Springman, E.B.' 4 # _citation.id primary _citation.title 'Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Namboodiri, H.V.' 1 primary 'Springman, E.B.' 2 primary 'Karpusas, M.' 3 primary 'Bukhtiyarova, M.' 4 primary 'Ramcharan, J.' 5 # _cell.entry_id 3OC1 _cell.length_a 65.764 _cell.length_b 74.157 _cell.length_c 77.924 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3OC1 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase 14' 41253.074 1 2.7.11.24 F169G 'kinase domain' ? 2 non-polymer syn '1-(5-TERT-BUTYL-2-METHYL-2H-PYRAZOL-3-YL)-3-(4-CHLORO-PHENYL)-UREA' 306.791 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 water nat water 18.015 45 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;MAP kinase 14, MAPK 14, Mitogen-activated protein kinase p38 alpha, MAP kinase p38 alpha, Cytokine suppressive anti-inflammatory drug-binding protein, CSAID-binding protein, CSBP, MAX-interacting protein 2, MAP kinase MXI2, SAPK2A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKILDGGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA DPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKILDGGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA DPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLN n 1 4 GLU n 1 5 ARG n 1 6 PRO n 1 7 THR n 1 8 PHE n 1 9 TYR n 1 10 ARG n 1 11 GLN n 1 12 GLU n 1 13 LEU n 1 14 ASN n 1 15 LYS n 1 16 THR n 1 17 ILE n 1 18 TRP n 1 19 GLU n 1 20 VAL n 1 21 PRO n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLN n 1 26 ASN n 1 27 LEU n 1 28 SER n 1 29 PRO n 1 30 VAL n 1 31 GLY n 1 32 SER n 1 33 GLY n 1 34 ALA n 1 35 TYR n 1 36 GLY n 1 37 SER n 1 38 VAL n 1 39 CYS n 1 40 ALA n 1 41 ALA n 1 42 PHE n 1 43 ASP n 1 44 THR n 1 45 LYS n 1 46 THR n 1 47 GLY n 1 48 LEU n 1 49 ARG n 1 50 VAL n 1 51 ALA n 1 52 VAL n 1 53 LYS n 1 54 LYS n 1 55 LEU n 1 56 SER n 1 57 ARG n 1 58 PRO n 1 59 PHE n 1 60 GLN n 1 61 SER n 1 62 ILE n 1 63 ILE n 1 64 HIS n 1 65 ALA n 1 66 LYS n 1 67 ARG n 1 68 THR n 1 69 TYR n 1 70 ARG n 1 71 GLU n 1 72 LEU n 1 73 ARG n 1 74 LEU n 1 75 LEU n 1 76 LYS n 1 77 HIS n 1 78 MET n 1 79 LYS n 1 80 HIS n 1 81 GLU n 1 82 ASN n 1 83 VAL n 1 84 ILE n 1 85 GLY n 1 86 LEU n 1 87 LEU n 1 88 ASP n 1 89 VAL n 1 90 PHE n 1 91 THR n 1 92 PRO n 1 93 ALA n 1 94 ARG n 1 95 SER n 1 96 LEU n 1 97 GLU n 1 98 GLU n 1 99 PHE n 1 100 ASN n 1 101 ASP n 1 102 VAL n 1 103 TYR n 1 104 LEU n 1 105 VAL n 1 106 THR n 1 107 HIS n 1 108 LEU n 1 109 MET n 1 110 GLY n 1 111 ALA n 1 112 ASP n 1 113 LEU n 1 114 ASN n 1 115 ASN n 1 116 ILE n 1 117 VAL n 1 118 LYS n 1 119 CYS n 1 120 GLN n 1 121 LYS n 1 122 LEU n 1 123 THR n 1 124 ASP n 1 125 ASP n 1 126 HIS n 1 127 VAL n 1 128 GLN n 1 129 PHE n 1 130 LEU n 1 131 ILE n 1 132 TYR n 1 133 GLN n 1 134 ILE n 1 135 LEU n 1 136 ARG n 1 137 GLY n 1 138 LEU n 1 139 LYS n 1 140 TYR n 1 141 ILE n 1 142 HIS n 1 143 SER n 1 144 ALA n 1 145 ASP n 1 146 ILE n 1 147 ILE n 1 148 HIS n 1 149 ARG n 1 150 ASP n 1 151 LEU n 1 152 LYS n 1 153 PRO n 1 154 SER n 1 155 ASN n 1 156 LEU n 1 157 ALA n 1 158 VAL n 1 159 ASN n 1 160 GLU n 1 161 ASP n 1 162 CYS n 1 163 GLU n 1 164 LEU n 1 165 LYS n 1 166 ILE n 1 167 LEU n 1 168 ASP n 1 169 GLY n 1 170 GLY n 1 171 LEU n 1 172 ALA n 1 173 ARG n 1 174 HIS n 1 175 THR n 1 176 ASP n 1 177 ASP n 1 178 GLU n 1 179 MET n 1 180 THR n 1 181 GLY n 1 182 TYR n 1 183 VAL n 1 184 ALA n 1 185 THR n 1 186 ARG n 1 187 TRP n 1 188 TYR n 1 189 ARG n 1 190 ALA n 1 191 PRO n 1 192 GLU n 1 193 ILE n 1 194 MET n 1 195 LEU n 1 196 ASN n 1 197 TRP n 1 198 MET n 1 199 HIS n 1 200 TYR n 1 201 ASN n 1 202 GLN n 1 203 THR n 1 204 VAL n 1 205 ASP n 1 206 ILE n 1 207 TRP n 1 208 SER n 1 209 VAL n 1 210 GLY n 1 211 CYS n 1 212 ILE n 1 213 MET n 1 214 ALA n 1 215 GLU n 1 216 LEU n 1 217 LEU n 1 218 THR n 1 219 GLY n 1 220 ARG n 1 221 THR n 1 222 LEU n 1 223 PHE n 1 224 PRO n 1 225 GLY n 1 226 THR n 1 227 ASP n 1 228 HIS n 1 229 ILE n 1 230 ASP n 1 231 GLN n 1 232 LEU n 1 233 LYS n 1 234 LEU n 1 235 ILE n 1 236 LEU n 1 237 ARG n 1 238 LEU n 1 239 VAL n 1 240 GLY n 1 241 THR n 1 242 PRO n 1 243 GLY n 1 244 ALA n 1 245 GLU n 1 246 LEU n 1 247 LEU n 1 248 LYS n 1 249 LYS n 1 250 ILE n 1 251 SER n 1 252 SER n 1 253 GLU n 1 254 SER n 1 255 ALA n 1 256 ARG n 1 257 ASN n 1 258 TYR n 1 259 ILE n 1 260 GLN n 1 261 SER n 1 262 LEU n 1 263 THR n 1 264 GLN n 1 265 MET n 1 266 PRO n 1 267 LYS n 1 268 MET n 1 269 ASN n 1 270 PHE n 1 271 ALA n 1 272 ASN n 1 273 VAL n 1 274 PHE n 1 275 ILE n 1 276 GLY n 1 277 ALA n 1 278 ASN n 1 279 PRO n 1 280 LEU n 1 281 ALA n 1 282 VAL n 1 283 ASP n 1 284 LEU n 1 285 LEU n 1 286 GLU n 1 287 LYS n 1 288 MET n 1 289 LEU n 1 290 VAL n 1 291 LEU n 1 292 ASP n 1 293 SER n 1 294 ASP n 1 295 LYS n 1 296 ARG n 1 297 ILE n 1 298 THR n 1 299 ALA n 1 300 ALA n 1 301 GLN n 1 302 ALA n 1 303 LEU n 1 304 ALA n 1 305 HIS n 1 306 ALA n 1 307 TYR n 1 308 PHE n 1 309 ALA n 1 310 GLN n 1 311 TYR n 1 312 HIS n 1 313 ASP n 1 314 PRO n 1 315 ASP n 1 316 ASP n 1 317 GLU n 1 318 PRO n 1 319 VAL n 1 320 ALA n 1 321 ASP n 1 322 PRO n 1 323 TYR n 1 324 ASP n 1 325 GLN n 1 326 SER n 1 327 PHE n 1 328 GLU n 1 329 SER n 1 330 ARG n 1 331 ASP n 1 332 LEU n 1 333 LEU n 1 334 ILE n 1 335 ASP n 1 336 GLU n 1 337 TRP n 1 338 LYS n 1 339 SER n 1 340 LEU n 1 341 THR n 1 342 TYR n 1 343 ASP n 1 344 GLU n 1 345 VAL n 1 346 ILE n 1 347 SER n 1 348 PHE n 1 349 VAL n 1 350 PRO n 1 351 PRO n 1 352 PRO n 1 353 LEU n 1 354 ASP n 1 355 GLN n 1 356 GLU n 1 357 GLU n 1 358 MET n 1 359 GLU n 1 360 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Rosetta _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name DE3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MK14_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA DPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q16539 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3OC1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 360 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16539 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 360 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 360 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3OC1 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 169 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q16539 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 169 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 169 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMU non-polymer . '1-(5-TERT-BUTYL-2-METHYL-2H-PYRAZOL-3-YL)-3-(4-CHLORO-PHENYL)-UREA' ? 'C15 H19 Cl N4 O' 306.791 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3OC1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_percent_sol 46.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details '10-20% PEG4000, 0.1M cacodylic acid, 50 mM n-octyl-beta-D-glucoside, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details Mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.98 # _reflns.entry_id 3OC1 _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F 1.0 _reflns.d_resolution_low 25.13 _reflns.d_resolution_high 2.6 _reflns.number_obs 13798 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.398 _reflns.pdbx_Rsym_value 0.362 _reflns.pdbx_netI_over_sigmaI 15.8 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 100 _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2703 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3OC1 _refine.ls_number_reflns_obs 11320 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 25.13 _refine.ls_d_res_high 2.59 _refine.ls_percent_reflns_obs 99.40 _refine.ls_R_factor_obs 0.22907 _refine.ls_R_factor_R_work 0.22306 _refine.ls_R_factor_R_free 0.30306 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 7.5 _refine.ls_number_reflns_R_free 918 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.928 _refine.correlation_coeff_Fo_to_Fc_free 0.858 _refine.B_iso_mean 43.164 _refine.aniso_B[1][1] -0.37 _refine.aniso_B[2][2] -1.31 _refine.aniso_B[3][3] 1.68 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB entry 1ZYJ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.397 _refine.overall_SU_ML 0.286 _refine.overall_SU_B 13.125 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_R_factor_all ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2666 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 45 _refine_hist.number_atoms_total 2736 _refine_hist.d_res_high 2.59 _refine_hist.d_res_low 25.13 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 2751 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.963 1.974 ? 3733 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.971 5.000 ? 327 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 40.080 23.984 ? 128 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 21.446 15.000 ? 480 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.916 15.000 ? 18 'X-RAY DIFFRACTION' ? r_chiral_restr 0.134 0.200 ? 419 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 2066 'X-RAY DIFFRACTION' ? r_nbd_refined 0.254 0.200 ? 1355 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.328 0.200 ? 1828 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.262 0.200 ? 126 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.194 0.200 ? 23 'X-RAY DIFFRACTION' ? r_mcbond_it 0.997 1.500 ? 1693 'X-RAY DIFFRACTION' ? r_mcangle_it 1.731 2.000 ? 2680 'X-RAY DIFFRACTION' ? r_scbond_it 2.232 3.000 ? 1200 'X-RAY DIFFRACTION' ? r_scangle_it 3.403 4.500 ? 1053 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.594 _refine_ls_shell.d_res_low 2.661 _refine_ls_shell.number_reflns_R_work 791 _refine_ls_shell.R_factor_R_work 0.245 _refine_ls_shell.percent_reflns_obs 96.20 _refine_ls_shell.R_factor_R_free 0.352 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 69 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3OC1 _struct.title 'Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding' _struct.pdbx_descriptor 'Mitogen-activated protein kinase 14 (E.C.2.7.11.24)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3OC1 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text Transferase # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 61 ? MET A 78 ? SER A 61 MET A 78 1 ? 18 HELX_P HELX_P2 2 ASP A 112 ? LYS A 118 ? ASP A 112 LYS A 118 1 ? 7 HELX_P HELX_P3 3 THR A 123 ? ALA A 144 ? THR A 123 ALA A 144 1 ? 22 HELX_P HELX_P4 4 LYS A 152 ? SER A 154 ? LYS A 152 SER A 154 5 ? 3 HELX_P HELX_P5 5 ALA A 184 ? ARG A 189 ? ALA A 184 ARG A 189 5 ? 6 HELX_P HELX_P6 6 ALA A 190 ? MET A 194 ? ALA A 190 MET A 194 5 ? 5 HELX_P HELX_P7 7 THR A 203 ? GLY A 219 ? THR A 203 GLY A 219 1 ? 17 HELX_P HELX_P8 8 ASP A 227 ? GLY A 240 ? ASP A 227 GLY A 240 1 ? 14 HELX_P HELX_P9 9 GLY A 243 ? LYS A 248 ? GLY A 243 LYS A 248 1 ? 6 HELX_P HELX_P10 10 SER A 252 ? GLN A 260 ? SER A 252 GLN A 260 1 ? 9 HELX_P HELX_P11 11 ASN A 269 ? PHE A 274 ? ASN A 269 PHE A 274 1 ? 6 HELX_P HELX_P12 12 ASN A 278 ? LEU A 289 ? ASN A 278 LEU A 289 1 ? 12 HELX_P HELX_P13 13 THR A 298 ? LEU A 303 ? THR A 298 LEU A 303 1 ? 6 HELX_P HELX_P14 14 ALA A 304 ? ALA A 309 ? ALA A 304 ALA A 309 5 ? 6 HELX_P HELX_P15 15 GLN A 325 ? ARG A 330 ? GLN A 325 ARG A 330 5 ? 6 HELX_P HELX_P16 16 LEU A 333 ? SER A 347 ? LEU A 333 SER A 347 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 8 ? TYR A 9 ? PHE A 8 TYR A 9 A 2 VAL A 20 ? PRO A 21 ? VAL A 20 PRO A 21 B 1 TYR A 24 ? PRO A 29 ? TYR A 24 PRO A 29 B 2 SER A 37 ? ASP A 43 ? SER A 37 ASP A 43 B 3 ARG A 49 ? LYS A 54 ? ARG A 49 LYS A 54 B 4 TYR A 103 ? HIS A 107 ? TYR A 103 HIS A 107 B 5 ASP A 88 ? PHE A 90 ? ASP A 88 PHE A 90 C 1 LEU A 156 ? VAL A 158 ? LEU A 156 VAL A 158 C 2 LEU A 164 ? ILE A 166 ? LEU A 164 ILE A 166 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 9 ? N TYR A 9 O VAL A 20 ? O VAL A 20 B 1 2 N SER A 28 ? N SER A 28 O ALA A 40 ? O ALA A 40 B 2 3 N ALA A 41 ? N ALA A 41 O VAL A 50 ? O VAL A 50 B 3 4 N ALA A 51 ? N ALA A 51 O THR A 106 ? O THR A 106 B 4 5 O VAL A 105 ? O VAL A 105 N ASP A 88 ? N ASP A 88 C 1 2 N ALA A 157 ? N ALA A 157 O LYS A 165 ? O LYS A 165 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE BMU A 361' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO A 362' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 LYS A 53 ? LYS A 53 . ? 1_555 ? 2 AC1 8 GLU A 71 ? GLU A 71 . ? 1_555 ? 3 AC1 8 LEU A 74 ? LEU A 74 . ? 1_555 ? 4 AC1 8 HIS A 148 ? HIS A 148 . ? 1_555 ? 5 AC1 8 ILE A 166 ? ILE A 166 . ? 1_555 ? 6 AC1 8 LEU A 167 ? LEU A 167 . ? 1_555 ? 7 AC1 8 ASP A 168 ? ASP A 168 . ? 1_555 ? 8 AC1 8 HOH D . ? HOH A 380 . ? 1_555 ? 9 AC2 3 HIS A 107 ? HIS A 107 . ? 1_555 ? 10 AC2 3 MET A 109 ? MET A 109 . ? 1_555 ? 11 AC2 3 ALA A 157 ? ALA A 157 . ? 1_555 ? # _database_PDB_matrix.entry_id 3OC1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3OC1 _atom_sites.fract_transf_matrix[1][1] 0.015206 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013485 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012833 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 SER 32 32 ? ? ? A . n A 1 33 GLY 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 TYR 35 35 ? ? ? A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 CYS 162 162 162 CYS CYS A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 GLY 170 170 ? ? ? A . n A 1 171 LEU 171 171 ? ? ? A . n A 1 172 ALA 172 172 ? ? ? A . n A 1 173 ARG 173 173 ? ? ? A . n A 1 174 HIS 174 174 ? ? ? A . n A 1 175 THR 175 175 ? ? ? A . n A 1 176 ASP 176 176 ? ? ? A . n A 1 177 ASP 177 177 ? ? ? A . n A 1 178 GLU 178 178 ? ? ? A . n A 1 179 MET 179 179 ? ? ? A . n A 1 180 THR 180 180 ? ? ? A . n A 1 181 GLY 181 181 ? ? ? A . n A 1 182 TYR 182 182 ? ? ? A . n A 1 183 VAL 183 183 ? ? ? A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 TRP 187 187 187 TRP TRP A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 TRP 197 197 197 TRP TRP A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 TRP 207 207 207 TRP TRP A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 CYS 211 211 211 CYS CYS A . n A 1 212 ILE 212 212 212 ILE ILE A . n A 1 213 MET 213 213 213 MET MET A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 HIS 228 228 228 HIS HIS A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 GLN 231 231 231 GLN GLN A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 ARG 237 237 237 ARG ARG A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 THR 241 241 241 THR THR A . n A 1 242 PRO 242 242 242 PRO PRO A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 LYS 249 249 249 LYS LYS A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 SER 252 252 252 SER SER A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 ASN 257 257 257 ASN ASN A . n A 1 258 TYR 258 258 258 TYR TYR A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 GLN 260 260 260 GLN GLN A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 GLN 264 264 264 GLN GLN A . n A 1 265 MET 265 265 265 MET MET A . n A 1 266 PRO 266 266 266 PRO PRO A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 MET 268 268 268 MET MET A . n A 1 269 ASN 269 269 269 ASN ASN A . n A 1 270 PHE 270 270 270 PHE PHE A . n A 1 271 ALA 271 271 271 ALA ALA A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 VAL 273 273 273 VAL VAL A . n A 1 274 PHE 274 274 274 PHE PHE A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 ASN 278 278 278 ASN ASN A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 ALA 281 281 281 ALA ALA A . n A 1 282 VAL 282 282 282 VAL VAL A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 GLU 286 286 286 GLU GLU A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 MET 288 288 288 MET MET A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 VAL 290 290 290 VAL VAL A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 SER 293 293 293 SER SER A . n A 1 294 ASP 294 294 294 ASP ASP A . n A 1 295 LYS 295 295 295 LYS LYS A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 ILE 297 297 297 ILE ILE A . n A 1 298 THR 298 298 298 THR THR A . n A 1 299 ALA 299 299 299 ALA ALA A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 GLN 301 301 301 GLN GLN A . n A 1 302 ALA 302 302 302 ALA ALA A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 ALA 304 304 304 ALA ALA A . n A 1 305 HIS 305 305 305 HIS HIS A . n A 1 306 ALA 306 306 306 ALA ALA A . n A 1 307 TYR 307 307 307 TYR TYR A . n A 1 308 PHE 308 308 308 PHE PHE A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 GLN 310 310 310 GLN GLN A . n A 1 311 TYR 311 311 311 TYR TYR A . n A 1 312 HIS 312 312 312 HIS HIS A . n A 1 313 ASP 313 313 313 ASP ASP A . n A 1 314 PRO 314 314 314 PRO PRO A . n A 1 315 ASP 315 315 315 ASP ASP A . n A 1 316 ASP 316 316 316 ASP ASP A . n A 1 317 GLU 317 317 317 GLU GLU A . n A 1 318 PRO 318 318 318 PRO PRO A . n A 1 319 VAL 319 319 319 VAL VAL A . n A 1 320 ALA 320 320 320 ALA ALA A . n A 1 321 ASP 321 321 321 ASP ASP A . n A 1 322 PRO 322 322 322 PRO PRO A . n A 1 323 TYR 323 323 323 TYR TYR A . n A 1 324 ASP 324 324 324 ASP ASP A . n A 1 325 GLN 325 325 325 GLN GLN A . n A 1 326 SER 326 326 326 SER SER A . n A 1 327 PHE 327 327 327 PHE PHE A . n A 1 328 GLU 328 328 328 GLU GLU A . n A 1 329 SER 329 329 329 SER SER A . n A 1 330 ARG 330 330 330 ARG ARG A . n A 1 331 ASP 331 331 331 ASP ASP A . n A 1 332 LEU 332 332 332 LEU LEU A . n A 1 333 LEU 333 333 333 LEU LEU A . n A 1 334 ILE 334 334 334 ILE ILE A . n A 1 335 ASP 335 335 335 ASP ASP A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 TRP 337 337 337 TRP TRP A . n A 1 338 LYS 338 338 338 LYS LYS A . n A 1 339 SER 339 339 339 SER SER A . n A 1 340 LEU 340 340 340 LEU LEU A . n A 1 341 THR 341 341 341 THR THR A . n A 1 342 TYR 342 342 342 TYR TYR A . n A 1 343 ASP 343 343 343 ASP ASP A . n A 1 344 GLU 344 344 344 GLU GLU A . n A 1 345 VAL 345 345 345 VAL VAL A . n A 1 346 ILE 346 346 346 ILE ILE A . n A 1 347 SER 347 347 347 SER SER A . n A 1 348 PHE 348 348 348 PHE PHE A . n A 1 349 VAL 349 349 349 VAL VAL A . n A 1 350 PRO 350 350 350 PRO PRO A . n A 1 351 PRO 351 351 351 PRO PRO A . n A 1 352 PRO 352 352 352 PRO PRO A . n A 1 353 LEU 353 353 ? ? ? A . n A 1 354 ASP 354 354 ? ? ? A . n A 1 355 GLN 355 355 ? ? ? A . n A 1 356 GLU 356 356 ? ? ? A . n A 1 357 GLU 357 357 ? ? ? A . n A 1 358 MET 358 358 ? ? ? A . n A 1 359 GLU 359 359 ? ? ? A . n A 1 360 SER 360 360 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-25 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 AMoRE phasing . ? 2 REFMAC refinement 5.2.0019 ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 162 ? ? O A HOH 377 ? ? 1.70 2 1 SG A CYS 162 ? ? O A HOH 407 ? ? 1.76 3 1 O A HOH 377 ? ? O A HOH 407 ? ? 1.97 4 1 NZ A LYS 76 ? ? OE1 A GLU 344 ? ? 2.05 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 39 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 39 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.716 _pdbx_validate_rmsd_bond.bond_target_value 1.812 _pdbx_validate_rmsd_bond.bond_deviation -0.096 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.016 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ARG 5 ? ? N A PRO 6 ? ? CA A PRO 6 ? ? 128.69 119.30 9.39 1.50 Y 2 1 C A PRO 351 ? ? N A PRO 352 ? ? CA A PRO 352 ? ? 132.48 119.30 13.18 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 6 ? ? -34.39 160.19 2 1 GLN A 11 ? ? -173.23 136.76 3 1 ASN A 14 ? ? 49.09 71.34 4 1 LYS A 15 ? ? 64.19 -80.08 5 1 THR A 16 ? ? -30.54 125.95 6 1 ARG A 57 ? ? 47.26 75.57 7 1 ASN A 82 ? ? -97.87 31.71 8 1 PHE A 99 ? ? -45.26 105.49 9 1 ILE A 116 ? ? -83.13 -72.23 10 1 VAL A 117 ? ? -49.85 -19.97 11 1 CYS A 119 ? ? -147.21 45.63 12 1 ARG A 149 ? ? 70.08 -9.86 13 1 LEU A 195 ? ? -104.76 55.89 14 1 ASN A 196 ? ? -15.46 91.15 15 1 MET A 198 ? ? 14.32 80.64 16 1 HIS A 199 ? ? -138.85 -33.47 17 1 TYR A 200 ? ? 26.71 121.94 18 1 ASP A 227 ? ? -167.00 -168.65 19 1 ALA A 244 ? ? -5.27 -66.53 20 1 SER A 254 ? ? -43.31 -72.26 21 1 SER A 293 ? ? -66.82 10.82 22 1 ASP A 313 ? ? -160.82 90.23 23 1 ASP A 316 ? ? -140.94 52.86 24 1 GLU A 317 ? ? -150.73 66.64 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LEU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 217 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 THR _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 218 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -149.86 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A SER 32 ? A SER 32 6 1 Y 1 A GLY 33 ? A GLY 33 7 1 Y 1 A ALA 34 ? A ALA 34 8 1 Y 1 A TYR 35 ? A TYR 35 9 1 Y 1 A GLY 170 ? A GLY 170 10 1 Y 1 A LEU 171 ? A LEU 171 11 1 Y 1 A ALA 172 ? A ALA 172 12 1 Y 1 A ARG 173 ? A ARG 173 13 1 Y 1 A HIS 174 ? A HIS 174 14 1 Y 1 A THR 175 ? A THR 175 15 1 Y 1 A ASP 176 ? A ASP 176 16 1 Y 1 A ASP 177 ? A ASP 177 17 1 Y 1 A GLU 178 ? A GLU 178 18 1 Y 1 A MET 179 ? A MET 179 19 1 Y 1 A THR 180 ? A THR 180 20 1 Y 1 A GLY 181 ? A GLY 181 21 1 Y 1 A TYR 182 ? A TYR 182 22 1 Y 1 A VAL 183 ? A VAL 183 23 1 Y 1 A LEU 353 ? A LEU 353 24 1 Y 1 A ASP 354 ? A ASP 354 25 1 Y 1 A GLN 355 ? A GLN 355 26 1 Y 1 A GLU 356 ? A GLU 356 27 1 Y 1 A GLU 357 ? A GLU 357 28 1 Y 1 A MET 358 ? A MET 358 29 1 Y 1 A GLU 359 ? A GLU 359 30 1 Y 1 A SER 360 ? A SER 360 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(5-TERT-BUTYL-2-METHYL-2H-PYRAZOL-3-YL)-3-(4-CHLORO-PHENYL)-UREA' BMU 3 1,2-ETHANEDIOL EDO 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BMU 1 361 1 BMU BMU A . C 3 EDO 1 362 1 EDO EDO A . D 4 HOH 1 363 1 HOH HOH A . D 4 HOH 2 364 2 HOH HOH A . D 4 HOH 3 365 3 HOH HOH A . D 4 HOH 4 366 4 HOH HOH A . D 4 HOH 5 367 5 HOH HOH A . D 4 HOH 6 368 6 HOH HOH A . D 4 HOH 7 369 7 HOH HOH A . D 4 HOH 8 370 8 HOH HOH A . D 4 HOH 9 371 9 HOH HOH A . D 4 HOH 10 372 10 HOH HOH A . D 4 HOH 11 373 11 HOH HOH A . D 4 HOH 12 374 12 HOH HOH A . D 4 HOH 13 375 13 HOH HOH A . D 4 HOH 14 376 14 HOH HOH A . D 4 HOH 15 377 15 HOH HOH A . D 4 HOH 16 378 16 HOH HOH A . D 4 HOH 17 379 17 HOH HOH A . D 4 HOH 18 380 18 HOH HOH A . D 4 HOH 19 381 19 HOH HOH A . D 4 HOH 20 382 20 HOH HOH A . D 4 HOH 21 383 21 HOH HOH A . D 4 HOH 22 384 22 HOH HOH A . D 4 HOH 23 385 23 HOH HOH A . D 4 HOH 24 386 24 HOH HOH A . D 4 HOH 25 387 25 HOH HOH A . D 4 HOH 26 388 26 HOH HOH A . D 4 HOH 27 389 27 HOH HOH A . D 4 HOH 28 390 28 HOH HOH A . D 4 HOH 29 391 29 HOH HOH A . D 4 HOH 30 392 30 HOH HOH A . D 4 HOH 31 393 31 HOH HOH A . D 4 HOH 32 394 32 HOH HOH A . D 4 HOH 33 395 33 HOH HOH A . D 4 HOH 34 396 34 HOH HOH A . D 4 HOH 35 397 35 HOH HOH A . D 4 HOH 36 398 36 HOH HOH A . D 4 HOH 37 399 37 HOH HOH A . D 4 HOH 38 400 38 HOH HOH A . D 4 HOH 39 401 39 HOH HOH A . D 4 HOH 40 402 40 HOH HOH A . D 4 HOH 41 403 41 HOH HOH A . D 4 HOH 42 404 42 HOH HOH A . D 4 HOH 43 405 43 HOH HOH A . D 4 HOH 44 406 44 HOH HOH A . D 4 HOH 45 407 45 HOH HOH A . #