data_3OP9 # _entry.id 3OP9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3OP9 RCSB RCSB061401 WWPDB D_1000061401 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id apc88435 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3OP9 _pdbx_database_status.recvd_initial_deposition_date 2010-08-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Michalska, K.' 1 'Li, H.' 2 'Gu, M.' 3 'Joachimiak, A.' 4 'Midwest Center for Structural Genomics (MCSG)' 5 # _citation.id primary _citation.title 'Crystal structure of transcriptional regulator from Listeria innocua' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Michalska, K.' 1 primary 'Li, H.' 2 primary 'Gu, M.' 3 primary 'Joachimiak, A.' 4 # _cell.entry_id 3OP9 _cell.length_a 71.12 _cell.length_b 71.12 _cell.length_c 122.13 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3OP9 _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Pli0006 protein' 13395.978 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 64 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)TIQHQFAENLSRLKKEHGLKNHQIAELLNVQTRTVAYY(MSE)SGETKPDIEKLIRLATYFHLSIDELVGYV QEDKVWNDLSLKQWLLSLNLRSEEEIAKIKILVDTVETLYPN ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMTIQHQFAENLSRLKKEHGLKNHQIAELLNVQTRTVAYYMSGETKPDIEKLIRLATYFHLSIDELVGYVQEDKVWND LSLKQWLLSLNLRSEEEIAKIKILVDTVETLYPN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier apc88435 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 THR n 1 6 ILE n 1 7 GLN n 1 8 HIS n 1 9 GLN n 1 10 PHE n 1 11 ALA n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 SER n 1 16 ARG n 1 17 LEU n 1 18 LYS n 1 19 LYS n 1 20 GLU n 1 21 HIS n 1 22 GLY n 1 23 LEU n 1 24 LYS n 1 25 ASN n 1 26 HIS n 1 27 GLN n 1 28 ILE n 1 29 ALA n 1 30 GLU n 1 31 LEU n 1 32 LEU n 1 33 ASN n 1 34 VAL n 1 35 GLN n 1 36 THR n 1 37 ARG n 1 38 THR n 1 39 VAL n 1 40 ALA n 1 41 TYR n 1 42 TYR n 1 43 MSE n 1 44 SER n 1 45 GLY n 1 46 GLU n 1 47 THR n 1 48 LYS n 1 49 PRO n 1 50 ASP n 1 51 ILE n 1 52 GLU n 1 53 LYS n 1 54 LEU n 1 55 ILE n 1 56 ARG n 1 57 LEU n 1 58 ALA n 1 59 THR n 1 60 TYR n 1 61 PHE n 1 62 HIS n 1 63 LEU n 1 64 SER n 1 65 ILE n 1 66 ASP n 1 67 GLU n 1 68 LEU n 1 69 VAL n 1 70 GLY n 1 71 TYR n 1 72 VAL n 1 73 GLN n 1 74 GLU n 1 75 ASP n 1 76 LYS n 1 77 VAL n 1 78 TRP n 1 79 ASN n 1 80 ASP n 1 81 LEU n 1 82 SER n 1 83 LEU n 1 84 LYS n 1 85 GLN n 1 86 TRP n 1 87 LEU n 1 88 LEU n 1 89 SER n 1 90 LEU n 1 91 ASN n 1 92 LEU n 1 93 ARG n 1 94 SER n 1 95 GLU n 1 96 GLU n 1 97 GLU n 1 98 ILE n 1 99 ALA n 1 100 LYS n 1 101 ILE n 1 102 LYS n 1 103 ILE n 1 104 LEU n 1 105 VAL n 1 106 ASP n 1 107 THR n 1 108 VAL n 1 109 GLU n 1 110 THR n 1 111 LEU n 1 112 TYR n 1 113 PRO n 1 114 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pli0006 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Clip11262 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria innocua' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1642 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q926P6_LISIN _struct_ref.pdbx_db_accession Q926P6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTIQHQFAENLSRLKKEHGLKNHQIAELLNVQTRTVAYYMSGETKPDIEKLIRLATYFHLSIDELVGYVQEDKVWNDLSL KQWLLSLNLRSEEEIAKIKILVDTVETLYPN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3OP9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q926P6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 111 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3OP9 SER A 1 ? UNP Q926P6 ? ? 'EXPRESSION TAG' -2 1 1 3OP9 ASN A 2 ? UNP Q926P6 ? ? 'EXPRESSION TAG' -1 2 1 3OP9 ALA A 3 ? UNP Q926P6 ? ? 'EXPRESSION TAG' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3OP9 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_percent_sol 57.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '1.0 M K/Na tartrate, 0.1 M Tris/HCl, 0.2 M Li2SO4, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.pdbx_collection_date 2010-07-29 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97967 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97967 # _reflns.entry_id 3OP9 _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 1.9 _reflns.number_obs 12741 _reflns.number_all ? _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.053 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 38.9 _reflns.B_iso_Wilson_estimate 27.6 _reflns.pdbx_redundancy 8.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 1.93 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.591 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.0 _reflns_shell.pdbx_redundancy 8.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 639 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3OP9 _refine.ls_number_reflns_obs 12735 _refine.ls_number_reflns_all 12735 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 26.098 _refine.ls_d_res_high 1.898 _refine.ls_percent_reflns_obs 99.58 _refine.ls_R_factor_obs 0.1894 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1867 _refine.ls_R_factor_R_free 0.2226 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 7.51 _refine.ls_number_reflns_R_free 956 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 0.0460 _refine.aniso_B[2][2] 0.0460 _refine.aniso_B[3][3] -0.0921 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.454 _refine.solvent_model_param_bsol 52.313 _refine.pdbx_solvent_vdw_probe_radii 0.90 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.77 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.20 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error 19.06 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 885 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 950 _refine_hist.d_res_high 1.898 _refine_hist.d_res_low 26.098 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.011 ? ? 941 'X-RAY DIFFRACTION' ? f_angle_d 1.168 ? ? 1277 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.345 ? ? 359 'X-RAY DIFFRACTION' ? f_chiral_restr 0.074 ? ? 146 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 162 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 1.8984 1.9985 1653 0.2251 100.00 0.2662 . . 134 . . . . 'X-RAY DIFFRACTION' . 1.9985 2.1236 1638 0.1939 100.00 0.2192 . . 148 . . . . 'X-RAY DIFFRACTION' . 2.1236 2.2875 1673 0.1797 100.00 0.2442 . . 135 . . . . 'X-RAY DIFFRACTION' . 2.2875 2.5176 1672 0.1768 100.00 0.1970 . . 122 . . . . 'X-RAY DIFFRACTION' . 2.5176 2.8815 1693 0.1955 100.00 0.2219 . . 125 . . . . 'X-RAY DIFFRACTION' . 2.8815 3.6288 1701 0.1908 100.00 0.2429 . . 138 . . . . 'X-RAY DIFFRACTION' . 3.6288 26.1008 1749 0.1791 97.00 0.2091 . . 154 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 3OP9 _struct.title 'Crystal structure of transcriptional regulator from Listeria innocua' _struct.pdbx_descriptor 'Pli0006 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3OP9 _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATOR' _struct_keywords.text 'Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION REGULATOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'AUTHOR DETERMINED BIOLOGICAL ASSEMBLY: UNKNOWN' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 9 ? GLY A 22 ? GLN A 6 GLY A 19 1 ? 14 HELX_P HELX_P2 2 LYS A 24 ? ASN A 33 ? LYS A 21 ASN A 30 1 ? 10 HELX_P HELX_P3 3 GLN A 35 ? SER A 44 ? GLN A 32 SER A 41 1 ? 10 HELX_P HELX_P4 4 ASP A 50 ? HIS A 62 ? ASP A 47 HIS A 59 1 ? 13 HELX_P HELX_P5 5 SER A 64 ? GLY A 70 ? SER A 61 GLY A 67 1 ? 7 HELX_P HELX_P6 6 ASP A 80 ? LEU A 90 ? ASP A 77 LEU A 87 1 ? 11 HELX_P HELX_P7 7 ASN A 91 ? ARG A 93 ? ASN A 88 ARG A 90 5 ? 3 HELX_P HELX_P8 8 SER A 94 ? TYR A 112 ? SER A 91 TYR A 109 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A TYR 42 C ? ? ? 1_555 A MSE 43 N A ? A TYR 39 A MSE 40 1_555 ? ? ? ? ? ? ? 1.334 ? covale2 covale ? ? A TYR 42 C ? ? ? 1_555 A MSE 43 N B ? A TYR 39 A MSE 40 1_555 ? ? ? ? ? ? ? 1.325 ? covale3 covale ? ? A MSE 43 C A ? ? 1_555 A SER 44 N ? ? A MSE 40 A SER 41 1_555 ? ? ? ? ? ? ? 1.326 ? covale4 covale ? ? A MSE 43 C B ? ? 1_555 A SER 44 N ? ? A MSE 40 A SER 41 1_555 ? ? ? ? ? ? ? 1.322 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE CL A 112' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 VAL A 34 ? VAL A 31 . ? 1_555 ? 2 AC1 4 GLN A 35 ? GLN A 32 . ? 1_555 ? 3 AC1 4 THR A 38 ? THR A 35 . ? 1_555 ? 4 AC1 4 HIS A 62 ? HIS A 59 . ? 4_565 ? # _database_PDB_matrix.entry_id 3OP9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3OP9 _atom_sites.fract_transf_matrix[1][1] 0.014061 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014061 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008188 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MSE 4 1 ? ? ? A . n A 1 5 THR 5 2 ? ? ? A . n A 1 6 ILE 6 3 3 ILE ILE A . n A 1 7 GLN 7 4 4 GLN GLN A . n A 1 8 HIS 8 5 5 HIS HIS A . n A 1 9 GLN 9 6 6 GLN GLN A . n A 1 10 PHE 10 7 7 PHE PHE A . n A 1 11 ALA 11 8 8 ALA ALA A . n A 1 12 GLU 12 9 9 GLU GLU A . n A 1 13 ASN 13 10 10 ASN ASN A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 ARG 16 13 13 ARG ARG A . n A 1 17 LEU 17 14 14 LEU LEU A . n A 1 18 LYS 18 15 15 LYS LYS A . n A 1 19 LYS 19 16 16 LYS LYS A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 HIS 21 18 18 HIS HIS A . n A 1 22 GLY 22 19 19 GLY GLY A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 ASN 25 22 22 ASN ASN A . n A 1 26 HIS 26 23 23 HIS HIS A . n A 1 27 GLN 27 24 24 GLN GLN A . n A 1 28 ILE 28 25 25 ILE ILE A . n A 1 29 ALA 29 26 26 ALA ALA A . n A 1 30 GLU 30 27 27 GLU GLU A . n A 1 31 LEU 31 28 28 LEU LEU A . n A 1 32 LEU 32 29 29 LEU LEU A . n A 1 33 ASN 33 30 30 ASN ASN A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 GLN 35 32 32 GLN GLN A . n A 1 36 THR 36 33 33 THR THR A . n A 1 37 ARG 37 34 34 ARG ARG A . n A 1 38 THR 38 35 35 THR THR A . n A 1 39 VAL 39 36 36 VAL VAL A . n A 1 40 ALA 40 37 37 ALA ALA A . n A 1 41 TYR 41 38 38 TYR TYR A . n A 1 42 TYR 42 39 39 TYR TYR A . n A 1 43 MSE 43 40 40 MSE MSE A . n A 1 44 SER 44 41 41 SER SER A . n A 1 45 GLY 45 42 42 GLY GLY A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 THR 47 44 44 THR THR A . n A 1 48 LYS 48 45 45 LYS LYS A . n A 1 49 PRO 49 46 46 PRO PRO A . n A 1 50 ASP 50 47 47 ASP ASP A . n A 1 51 ILE 51 48 48 ILE ILE A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 LYS 53 50 50 LYS LYS A . n A 1 54 LEU 54 51 51 LEU LEU A . n A 1 55 ILE 55 52 52 ILE ILE A . n A 1 56 ARG 56 53 53 ARG ARG A . n A 1 57 LEU 57 54 54 LEU LEU A . n A 1 58 ALA 58 55 55 ALA ALA A . n A 1 59 THR 59 56 56 THR THR A . n A 1 60 TYR 60 57 57 TYR TYR A . n A 1 61 PHE 61 58 58 PHE PHE A . n A 1 62 HIS 62 59 59 HIS HIS A . n A 1 63 LEU 63 60 60 LEU LEU A . n A 1 64 SER 64 61 61 SER SER A . n A 1 65 ILE 65 62 62 ILE ILE A . n A 1 66 ASP 66 63 63 ASP ASP A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 LEU 68 65 65 LEU LEU A . n A 1 69 VAL 69 66 66 VAL VAL A . n A 1 70 GLY 70 67 67 GLY GLY A . n A 1 71 TYR 71 68 68 TYR TYR A . n A 1 72 VAL 72 69 69 VAL VAL A . n A 1 73 GLN 73 70 70 GLN GLN A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 ASP 75 72 ? ? ? A . n A 1 76 LYS 76 73 ? ? ? A . n A 1 77 VAL 77 74 74 VAL VAL A . n A 1 78 TRP 78 75 75 TRP TRP A . n A 1 79 ASN 79 76 76 ASN ASN A . n A 1 80 ASP 80 77 77 ASP ASP A . n A 1 81 LEU 81 78 78 LEU LEU A . n A 1 82 SER 82 79 79 SER SER A . n A 1 83 LEU 83 80 80 LEU LEU A . n A 1 84 LYS 84 81 81 LYS LYS A . n A 1 85 GLN 85 82 82 GLN GLN A . n A 1 86 TRP 86 83 83 TRP TRP A . n A 1 87 LEU 87 84 84 LEU LEU A . n A 1 88 LEU 88 85 85 LEU LEU A . n A 1 89 SER 89 86 86 SER SER A . n A 1 90 LEU 90 87 87 LEU LEU A . n A 1 91 ASN 91 88 88 ASN ASN A . n A 1 92 LEU 92 89 89 LEU LEU A . n A 1 93 ARG 93 90 90 ARG ARG A . n A 1 94 SER 94 91 91 SER SER A . n A 1 95 GLU 95 92 92 GLU GLU A . n A 1 96 GLU 96 93 93 GLU GLU A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 ILE 98 95 95 ILE ILE A . n A 1 99 ALA 99 96 96 ALA ALA A . n A 1 100 LYS 100 97 97 LYS LYS A . n A 1 101 ILE 101 98 98 ILE ILE A . n A 1 102 LYS 102 99 99 LYS LYS A . n A 1 103 ILE 103 100 100 ILE ILE A . n A 1 104 LEU 104 101 101 LEU LEU A . n A 1 105 VAL 105 102 102 VAL VAL A . n A 1 106 ASP 106 103 103 ASP ASP A . n A 1 107 THR 107 104 104 THR THR A . n A 1 108 VAL 108 105 105 VAL VAL A . n A 1 109 GLU 109 106 106 GLU GLU A . n A 1 110 THR 110 107 107 THR THR A . n A 1 111 LEU 111 108 108 LEU LEU A . n A 1 112 TYR 112 109 109 TYR TYR A . n A 1 113 PRO 113 110 110 PRO PRO A . n A 1 114 ASN 114 111 111 ASN ASN A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 43 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 40 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 13320 ? 1 MORE -106 ? 1 'SSA (A^2)' 22670 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 71.1200000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 15_545 y+1/2,x-1/2,-z+1/2 0.0000000000 1.0000000000 0.0000000000 35.5600000000 1.0000000000 0.0000000000 0.0000000000 -35.5600000000 0.0000000000 0.0000000000 -1.0000000000 61.0650000000 4 'crystal symmetry operation' 16_555 -y+1/2,-x+1/2,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 35.5600000000 -1.0000000000 0.0000000000 0.0000000000 35.5600000000 0.0000000000 0.0000000000 -1.0000000000 61.0650000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 144 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-09-15 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 27.6854 16.6862 44.2144 0.2704 0.2227 0.2006 -0.0025 -0.0383 0.0360 4.0523 5.1029 0.9882 1.4027 1.1097 0.7508 0.1546 -0.5415 0.1403 0.6145 -0.3010 0.1431 -0.1076 -0.2068 0.1145 'X-RAY DIFFRACTION' 2 ? refined 21.1708 23.6674 41.2615 0.3281 0.2522 0.3455 0.1125 0.1437 0.1114 3.5381 3.8591 0.4107 -1.1249 0.2806 -1.0880 -0.3311 -0.0156 0.4248 0.6514 0.4301 0.2811 -0.2727 0.0363 -0.0891 'X-RAY DIFFRACTION' 3 ? refined 29.1672 18.5583 32.6852 0.2171 0.2509 0.2076 -0.0131 -0.0152 0.0485 2.4242 2.9830 6.8243 -0.1128 2.2432 -0.7618 -0.1824 0.1031 -0.1717 -0.3733 0.1319 -0.0095 -0.4143 -0.6097 -0.0525 'X-RAY DIFFRACTION' 4 ? refined 26.9433 5.4980 34.8059 0.4040 0.1997 0.2274 -0.0113 -0.0304 0.0274 0.8802 2.1793 0.2827 0.0913 0.1153 -0.4502 0.0545 -0.0083 -0.4112 -0.2592 -0.0006 -0.3853 0.9633 0.2017 0.1120 'X-RAY DIFFRACTION' 5 ? refined 35.5787 -0.5164 12.0208 0.2171 0.2639 0.1424 0.0099 -0.0266 -0.0010 1.3247 1.4434 0.7093 -0.6626 0.7072 -0.7385 0.0827 0.1689 -0.2014 0.1768 0.1280 -0.0036 -0.1092 -0.1007 -0.1313 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 3:26)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 27:45)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(chain A and resid 46:59)' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(chain A and resid 60:71)' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(chain A and resid 74:111)' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SBC-Collect 'data collection' . ? 1 SHELX 'model building' . ? 2 MLPHARE phasing . ? 3 DM 'model building' . ? 4 ARP/wARP 'model building' . ? 5 Coot 'model building' . ? 6 PHENIX refinement '(phenix.refine: 1.6.4_486)' ? 7 HKL-3000 'data reduction' . ? 8 HKL-3000 'data scaling' . ? 9 SHELX phasing . ? 10 DM phasing . ? 11 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 63 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ASP _pdbx_validate_symm_contact.auth_seq_id_2 63 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 16_555 _pdbx_validate_symm_contact.dist 1.95 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MSE 1 ? A MSE 4 5 1 Y 1 A THR 2 ? A THR 5 6 1 Y 1 A ASP 72 ? A ASP 75 7 1 Y 1 A LYS 73 ? A LYS 76 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 112 1 CL CL A . C 3 HOH 1 113 1 HOH HOH A . C 3 HOH 2 114 2 HOH HOH A . C 3 HOH 3 115 3 HOH HOH A . C 3 HOH 4 116 4 HOH HOH A . C 3 HOH 5 117 5 HOH HOH A . C 3 HOH 6 118 6 HOH HOH A . C 3 HOH 7 119 7 HOH HOH A . C 3 HOH 8 120 8 HOH HOH A . C 3 HOH 9 121 9 HOH HOH A . C 3 HOH 10 122 10 HOH HOH A . C 3 HOH 11 123 11 HOH HOH A . C 3 HOH 12 124 12 HOH HOH A . C 3 HOH 13 125 13 HOH HOH A . C 3 HOH 14 126 14 HOH HOH A . C 3 HOH 15 127 15 HOH HOH A . C 3 HOH 16 128 16 HOH HOH A . C 3 HOH 17 129 17 HOH HOH A . C 3 HOH 18 130 18 HOH HOH A . C 3 HOH 19 131 19 HOH HOH A . C 3 HOH 20 132 20 HOH HOH A . C 3 HOH 21 133 21 HOH HOH A . C 3 HOH 22 134 22 HOH HOH A . C 3 HOH 23 135 23 HOH HOH A . C 3 HOH 24 136 24 HOH HOH A . C 3 HOH 25 137 25 HOH HOH A . C 3 HOH 26 138 26 HOH HOH A . C 3 HOH 27 139 27 HOH HOH A . C 3 HOH 28 140 28 HOH HOH A . C 3 HOH 29 141 29 HOH HOH A . C 3 HOH 30 142 30 HOH HOH A . C 3 HOH 31 143 31 HOH HOH A . C 3 HOH 32 144 32 HOH HOH A . C 3 HOH 33 145 33 HOH HOH A . C 3 HOH 34 146 34 HOH HOH A . C 3 HOH 35 147 35 HOH HOH A . C 3 HOH 36 148 36 HOH HOH A . C 3 HOH 37 149 37 HOH HOH A . C 3 HOH 38 150 38 HOH HOH A . C 3 HOH 39 151 39 HOH HOH A . C 3 HOH 40 152 40 HOH HOH A . C 3 HOH 41 153 41 HOH HOH A . C 3 HOH 42 154 42 HOH HOH A . C 3 HOH 43 155 43 HOH HOH A . C 3 HOH 44 156 44 HOH HOH A . C 3 HOH 45 157 45 HOH HOH A . C 3 HOH 46 158 46 HOH HOH A . C 3 HOH 47 159 47 HOH HOH A . C 3 HOH 48 160 48 HOH HOH A . C 3 HOH 49 161 49 HOH HOH A . C 3 HOH 50 162 50 HOH HOH A . C 3 HOH 51 163 51 HOH HOH A . C 3 HOH 52 164 52 HOH HOH A . C 3 HOH 53 165 53 HOH HOH A . C 3 HOH 54 166 54 HOH HOH A . C 3 HOH 55 167 55 HOH HOH A . C 3 HOH 56 168 56 HOH HOH A . C 3 HOH 57 169 57 HOH HOH A . C 3 HOH 58 170 58 HOH HOH A . C 3 HOH 59 171 59 HOH HOH A . C 3 HOH 60 172 60 HOH HOH A . C 3 HOH 61 173 61 HOH HOH A . C 3 HOH 62 174 62 HOH HOH A . C 3 HOH 63 175 63 HOH HOH A . C 3 HOH 64 176 64 HOH HOH A . #