data_3OVE # _entry.id 3OVE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3OVE RCSB RCSB061621 WWPDB D_1000061621 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3S8O . unspecified PDB 3S8N . unspecified PDB 3S8L . unspecified PDB 3OV1 . unspecified PDB 3KFJ . unspecified PDB 3IMD . unspecified PDB 3IMJ . unspecified PDB 3IN7 . unspecified PDB 3IN8 . unspecified PDB 2H5K . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3OVE _pdbx_database_status.recvd_initial_deposition_date 2010-09-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clements, J.H.' 1 'Martin, S.F.' 2 # _citation.id primary _citation.title 'Protein-ligand interactions: thermodynamic effects associated with increasing nonpolar surface area.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 133 _citation.page_first 18518 _citation.page_last 18521 _citation.year 2011 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22007755 _citation.pdbx_database_id_DOI 10.1021/ja2068752 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Myslinski, J.M.' 1 primary 'Delorbe, J.E.' 2 primary 'Clements, J.H.' 3 primary 'Martin, S.F.' 4 # _cell.entry_id 3OVE _cell.length_a 41.935 _cell.length_b 41.935 _cell.length_c 108.971 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3OVE _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Growth factor receptor-bound protein 2' 13614.279 1 ? ? 'unp residues 53-163' ? 2 polymer syn PYAC7CN 553.502 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 90 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adapter protein GRB2, Protein Ash, SH2/SH3 adapter GRB2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQANNNNNN ; ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQANNNNNN ; A ? 2 'polypeptide(L)' no yes '(ACT)(PTR)(03E)N(NH2)' XYXNX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 GLU n 1 3 MET n 1 4 LYS n 1 5 PRO n 1 6 HIS n 1 7 PRO n 1 8 TRP n 1 9 PHE n 1 10 PHE n 1 11 GLY n 1 12 LYS n 1 13 ILE n 1 14 PRO n 1 15 ARG n 1 16 ALA n 1 17 LYS n 1 18 ALA n 1 19 GLU n 1 20 GLU n 1 21 MET n 1 22 LEU n 1 23 SER n 1 24 LYS n 1 25 GLN n 1 26 ARG n 1 27 HIS n 1 28 ASP n 1 29 GLY n 1 30 ALA n 1 31 PHE n 1 32 LEU n 1 33 ILE n 1 34 ARG n 1 35 GLU n 1 36 SER n 1 37 GLU n 1 38 SER n 1 39 ALA n 1 40 PRO n 1 41 GLY n 1 42 ASP n 1 43 PHE n 1 44 SER n 1 45 LEU n 1 46 SER n 1 47 VAL n 1 48 LYS n 1 49 PHE n 1 50 GLY n 1 51 ASN n 1 52 ASP n 1 53 VAL n 1 54 GLN n 1 55 HIS n 1 56 PHE n 1 57 LYS n 1 58 VAL n 1 59 LEU n 1 60 ARG n 1 61 ASP n 1 62 GLY n 1 63 ALA n 1 64 GLY n 1 65 LYS n 1 66 TYR n 1 67 PHE n 1 68 LEU n 1 69 TRP n 1 70 VAL n 1 71 VAL n 1 72 LYS n 1 73 PHE n 1 74 ASN n 1 75 SER n 1 76 LEU n 1 77 ASN n 1 78 GLU n 1 79 LEU n 1 80 VAL n 1 81 ASP n 1 82 TYR n 1 83 HIS n 1 84 ARG n 1 85 SER n 1 86 THR n 1 87 SER n 1 88 VAL n 1 89 SER n 1 90 ARG n 1 91 ASN n 1 92 GLN n 1 93 GLN n 1 94 ILE n 1 95 PHE n 1 96 LEU n 1 97 ARG n 1 98 ASP n 1 99 ILE n 1 100 GLU n 1 101 GLN n 1 102 VAL n 1 103 PRO n 1 104 GLN n 1 105 GLN n 1 106 PRO n 1 107 THR n 1 108 TYR n 1 109 VAL n 1 110 GLN n 1 111 ALA n 1 112 ASN n 1 113 ASN n 1 114 ASN n 1 115 ASN n 1 116 ASN n 1 117 ASN n 2 1 ACT n 2 2 PTR n 2 3 03E n 2 4 ASN n 2 5 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ASH, GRB2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain SG13009 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain SG13009 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pQE-60 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP GRB2_HUMAN 1 ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQA ; 53 P62993 ? 2 PDB 3OVE 2 ? ? 3OVE ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3OVE A 1 ? 111 ? P62993 53 ? 163 ? 53 163 2 2 3OVE B 1 ? 5 ? 3OVE 1 ? 5 ? 1 5 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3OVE ASN A 112 ? UNP P62993 ? ? 'EXPRESSION TAG' 164 1 1 3OVE ASN A 113 ? UNP P62993 ? ? 'EXPRESSION TAG' 165 2 1 3OVE ASN A 114 ? UNP P62993 ? ? 'EXPRESSION TAG' 166 3 1 3OVE ASN A 115 ? UNP P62993 ? ? 'EXPRESSION TAG' 167 4 1 3OVE ASN A 116 ? UNP P62993 ? ? 'EXPRESSION TAG' 168 5 1 3OVE ASN A 117 ? UNP P62993 ? ? 'EXPRESSION TAG' 169 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 03E 'peptide linking' . '1-aminocycloheptanecarboxylic acid' ? 'C8 H15 N O2' 157.210 ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3OVE _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.82 _exptl_crystal.density_percent_sol 30.97 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_details ;0.2 M magnesium chloride hexahydrate, 0.1 M TRIS,30% w/v polyethylene glycol 4,000, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2010-07-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Blue max-flux confocal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3OVE _reflns.observed_criterion_sigma_I . _reflns.observed_criterion_sigma_F . _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.82 _reflns.number_obs 8801 _reflns.number_all ? _reflns.percent_possible_obs 93.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.076 _reflns.pdbx_netI_over_sigmaI 22.5 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.82 _reflns_shell.d_res_low 1.89 _reflns_shell.percent_possible_all 96.4 _reflns_shell.pdbx_Rsym_value 0.223 _reflns_shell.meanI_over_sigI_obs 10.1 _reflns_shell.pdbx_redundancy 12.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 900 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3OVE _refine.ls_number_reflns_obs 8310 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I . _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 26.05 _refine.ls_d_res_high 1.82 _refine.ls_percent_reflns_obs 93.74 _refine.ls_R_factor_obs 0.18120 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17746 _refine.ls_R_factor_R_free 0.25970 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 411 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.952 _refine.correlation_coeff_Fo_to_Fc_free 0.909 _refine.B_iso_mean 21.029 _refine.aniso_B[1][1] -0.07 _refine.aniso_B[2][2] -0.07 _refine.aniso_B[3][3] 0.15 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB entry 3C7I' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.170 _refine.overall_SU_ML 0.095 _refine.overall_SU_B 3.055 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 872 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 90 _refine_hist.number_atoms_total 963 _refine_hist.d_res_high 1.82 _refine_hist.d_res_low 26.05 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.022 0.022 ? 936 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.033 1.972 ? 1271 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.481 5.000 ? 114 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 28.598 23.191 ? 47 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.186 15.000 ? 164 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 17.742 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.142 0.200 ? 129 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.011 0.021 ? 727 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.312 1.500 ? 529 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.022 2.000 ? 859 'X-RAY DIFFRACTION' ? r_scbond_it 2.986 3.000 ? 407 'X-RAY DIFFRACTION' ? r_scangle_it 4.233 4.500 ? 405 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.821 _refine_ls_shell.d_res_low 1.868 _refine_ls_shell.number_reflns_R_work 623 _refine_ls_shell.R_factor_R_work 0.213 _refine_ls_shell.percent_reflns_obs 98.48 _refine_ls_shell.R_factor_R_free 0.286 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3OVE _struct.title 'Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide' _struct.pdbx_descriptor 'Growth factor receptor-bound protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3OVE _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN/ANTAGONIST' _struct_keywords.text 'Grb2 SH2 Domain, Phosphotyrosine Binding, SIGNALING PROTEIN-ANTAGONIST complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 14 ? SER A 23 ? PRO A 66 SER A 75 1 ? 10 HELX_P HELX_P2 2 SER A 75 ? HIS A 83 ? SER A 127 HIS A 135 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? B 03E 3 C ? ? ? 1_555 B ASN 4 N ? ? B 03E 3 B ASN 4 1_555 ? ? ? ? ? ? ? 1.338 ? covale2 covale ? ? B ASN 4 C ? ? ? 1_555 B NH2 5 N ? ? B ASN 4 B NH2 5 1_555 ? ? ? ? ? ? ? 1.368 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 52 ? LYS A 57 ? ASP A 104 LYS A 109 A 2 PHE A 43 ? PHE A 49 ? PHE A 95 PHE A 101 A 3 ALA A 30 ? GLU A 35 ? ALA A 82 GLU A 87 A 4 ARG A 97 ? ASP A 98 ? ARG A 149 ASP A 150 B 1 LEU A 59 ? ARG A 60 ? LEU A 111 ARG A 112 B 2 TYR A 66 ? PHE A 67 ? TYR A 118 PHE A 119 B 3 LYS A 72 ? PHE A 73 ? LYS A 124 PHE A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 54 ? O GLN A 106 N VAL A 47 ? N VAL A 99 A 2 3 O SER A 46 ? O SER A 98 N LEU A 32 ? N LEU A 84 A 3 4 N PHE A 31 ? N PHE A 83 O ARG A 97 ? O ARG A 149 B 1 2 N LEU A 59 ? N LEU A 111 O PHE A 67 ? O PHE A 119 B 2 3 N TYR A 66 ? N TYR A 118 O PHE A 73 ? O PHE A 125 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 174 ? 2 'BINDING SITE FOR RESIDUE CL A 174' AC2 Software ? ? ? ? 19 'BINDING SITE FOR CHAIN B OF PYAC7CN' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 SER A 87 ? SER A 139 . ? 1_555 ? 2 AC1 2 GLN A 93 ? GLN A 145 . ? 1_555 ? 3 AC2 19 HOH D . ? HOH A 36 . ? 1_555 ? 4 AC2 19 ARG A 15 ? ARG A 67 . ? 1_555 ? 5 AC2 19 ARG A 26 ? ARG A 78 . ? 7_565 ? 6 AC2 19 ARG A 34 ? ARG A 86 . ? 1_555 ? 7 AC2 19 SER A 36 ? SER A 88 . ? 1_555 ? 8 AC2 19 SER A 38 ? SER A 90 . ? 1_555 ? 9 AC2 19 SER A 44 ? SER A 96 . ? 1_555 ? 10 AC2 19 HIS A 55 ? HIS A 107 . ? 1_555 ? 11 AC2 19 PHE A 56 ? PHE A 108 . ? 1_555 ? 12 AC2 19 LYS A 57 ? LYS A 109 . ? 1_555 ? 13 AC2 19 LEU A 68 ? LEU A 120 . ? 1_555 ? 14 AC2 19 TRP A 69 ? TRP A 121 . ? 1_555 ? 15 AC2 19 HOH D . ? HOH A 176 . ? 1_555 ? 16 AC2 19 HOH D . ? HOH A 177 . ? 1_555 ? 17 AC2 19 HOH D . ? HOH A 199 . ? 1_555 ? 18 AC2 19 HOH D . ? HOH A 202 . ? 1_555 ? 19 AC2 19 HOH D . ? HOH A 206 . ? 1_555 ? 20 AC2 19 HOH D . ? HOH A 207 . ? 1_555 ? 21 AC2 19 HOH D . ? HOH A 212 . ? 1_555 ? # _database_PDB_matrix.entry_id 3OVE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3OVE _atom_sites.fract_transf_matrix[1][1] 0.023846 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023846 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009177 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 53 ? ? ? A . n A 1 2 GLU 2 54 54 GLU GLU A . n A 1 3 MET 3 55 55 MET MET A . n A 1 4 LYS 4 56 56 LYS LYS A . n A 1 5 PRO 5 57 57 PRO PRO A . n A 1 6 HIS 6 58 58 HIS HIS A . n A 1 7 PRO 7 59 59 PRO PRO A . n A 1 8 TRP 8 60 60 TRP TRP A . n A 1 9 PHE 9 61 61 PHE PHE A . n A 1 10 PHE 10 62 62 PHE PHE A . n A 1 11 GLY 11 63 63 GLY GLY A . n A 1 12 LYS 12 64 64 LYS LYS A . n A 1 13 ILE 13 65 65 ILE ILE A . n A 1 14 PRO 14 66 66 PRO PRO A . n A 1 15 ARG 15 67 67 ARG ARG A . n A 1 16 ALA 16 68 68 ALA ALA A . n A 1 17 LYS 17 69 69 LYS LYS A . n A 1 18 ALA 18 70 70 ALA ALA A . n A 1 19 GLU 19 71 71 GLU GLU A . n A 1 20 GLU 20 72 72 GLU GLU A . n A 1 21 MET 21 73 73 MET MET A . n A 1 22 LEU 22 74 74 LEU LEU A . n A 1 23 SER 23 75 75 SER SER A . n A 1 24 LYS 24 76 76 LYS LYS A . n A 1 25 GLN 25 77 77 GLN GLN A . n A 1 26 ARG 26 78 78 ARG ARG A . n A 1 27 HIS 27 79 79 HIS HIS A . n A 1 28 ASP 28 80 80 ASP ASP A . n A 1 29 GLY 29 81 81 GLY GLY A . n A 1 30 ALA 30 82 82 ALA ALA A . n A 1 31 PHE 31 83 83 PHE PHE A . n A 1 32 LEU 32 84 84 LEU LEU A . n A 1 33 ILE 33 85 85 ILE ILE A . n A 1 34 ARG 34 86 86 ARG ARG A . n A 1 35 GLU 35 87 87 GLU GLU A . n A 1 36 SER 36 88 88 SER SER A . n A 1 37 GLU 37 89 89 GLU GLU A . n A 1 38 SER 38 90 90 SER SER A . n A 1 39 ALA 39 91 91 ALA ALA A . n A 1 40 PRO 40 92 92 PRO PRO A . n A 1 41 GLY 41 93 93 GLY GLY A . n A 1 42 ASP 42 94 94 ASP ASP A . n A 1 43 PHE 43 95 95 PHE PHE A . n A 1 44 SER 44 96 96 SER SER A . n A 1 45 LEU 45 97 97 LEU LEU A . n A 1 46 SER 46 98 98 SER SER A . n A 1 47 VAL 47 99 99 VAL VAL A . n A 1 48 LYS 48 100 100 LYS LYS A . n A 1 49 PHE 49 101 101 PHE PHE A . n A 1 50 GLY 50 102 102 GLY GLY A . n A 1 51 ASN 51 103 103 ASN ASN A . n A 1 52 ASP 52 104 104 ASP ASP A . n A 1 53 VAL 53 105 105 VAL VAL A . n A 1 54 GLN 54 106 106 GLN GLN A . n A 1 55 HIS 55 107 107 HIS HIS A . n A 1 56 PHE 56 108 108 PHE PHE A . n A 1 57 LYS 57 109 109 LYS LYS A . n A 1 58 VAL 58 110 110 VAL VAL A . n A 1 59 LEU 59 111 111 LEU LEU A . n A 1 60 ARG 60 112 112 ARG ARG A . n A 1 61 ASP 61 113 113 ASP ASP A . n A 1 62 GLY 62 114 114 GLY GLY A . n A 1 63 ALA 63 115 115 ALA ALA A . n A 1 64 GLY 64 116 116 GLY GLY A . n A 1 65 LYS 65 117 117 LYS LYS A . n A 1 66 TYR 66 118 118 TYR TYR A . n A 1 67 PHE 67 119 119 PHE PHE A . n A 1 68 LEU 68 120 120 LEU LEU A . n A 1 69 TRP 69 121 121 TRP TRP A . n A 1 70 VAL 70 122 122 VAL VAL A . n A 1 71 VAL 71 123 123 VAL VAL A . n A 1 72 LYS 72 124 124 LYS LYS A . n A 1 73 PHE 73 125 125 PHE PHE A . n A 1 74 ASN 74 126 126 ASN ASN A . n A 1 75 SER 75 127 127 SER SER A . n A 1 76 LEU 76 128 128 LEU LEU A . n A 1 77 ASN 77 129 129 ASN ASN A . n A 1 78 GLU 78 130 130 GLU GLU A . n A 1 79 LEU 79 131 131 LEU LEU A . n A 1 80 VAL 80 132 132 VAL VAL A . n A 1 81 ASP 81 133 133 ASP ASP A . n A 1 82 TYR 82 134 134 TYR TYR A . n A 1 83 HIS 83 135 135 HIS HIS A . n A 1 84 ARG 84 136 136 ARG ARG A . n A 1 85 SER 85 137 137 SER SER A . n A 1 86 THR 86 138 138 THR THR A . n A 1 87 SER 87 139 139 SER SER A . n A 1 88 VAL 88 140 140 VAL VAL A . n A 1 89 SER 89 141 141 SER SER A . n A 1 90 ARG 90 142 142 ARG ARG A . n A 1 91 ASN 91 143 143 ASN ASN A . n A 1 92 GLN 92 144 144 GLN GLN A . n A 1 93 GLN 93 145 145 GLN GLN A . n A 1 94 ILE 94 146 146 ILE ILE A . n A 1 95 PHE 95 147 147 PHE PHE A . n A 1 96 LEU 96 148 148 LEU LEU A . n A 1 97 ARG 97 149 149 ARG ARG A . n A 1 98 ASP 98 150 150 ASP ASP A . n A 1 99 ILE 99 151 151 ILE ILE A . n A 1 100 GLU 100 152 152 GLU GLU A . n A 1 101 GLN 101 153 153 GLN GLN A . n A 1 102 VAL 102 154 154 VAL VAL A . n A 1 103 PRO 103 155 ? ? ? A . n A 1 104 GLN 104 156 ? ? ? A . n A 1 105 GLN 105 157 ? ? ? A . n A 1 106 PRO 106 158 ? ? ? A . n A 1 107 THR 107 159 ? ? ? A . n A 1 108 TYR 108 160 ? ? ? A . n A 1 109 VAL 109 161 ? ? ? A . n A 1 110 GLN 110 162 ? ? ? A . n A 1 111 ALA 111 163 ? ? ? A . n A 1 112 ASN 112 164 ? ? ? A . n A 1 113 ASN 113 165 ? ? ? A . n A 1 114 ASN 114 166 ? ? ? A . n A 1 115 ASN 115 167 ? ? ? A . n A 1 116 ASN 116 168 ? ? ? A . n A 1 117 ASN 117 169 ? ? ? A . n B 2 1 ACT 1 1 1 ACT ACT B . n B 2 2 PTR 2 2 2 PTR PTR B . n B 2 3 03E 3 3 3 03E 03E B . n B 2 4 ASN 4 4 4 ASN ASN B . n B 2 5 NH2 5 5 5 NH2 NH2 B . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 2 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 2 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1200 ? 1 MORE -15 ? 1 'SSA (A^2)' 6230 ? 2 'ABSA (A^2)' 4800 ? 2 MORE -39 ? 2 'SSA (A^2)' 10060 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_465 y-1,x+1,-z 0.0000000000 1.0000000000 0.0000000000 -41.9350000000 1.0000000000 0.0000000000 0.0000000000 41.9350000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 50 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-02 2 'Structure model' 1 1 2011-12-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.5.0109 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 LYS _pdbx_validate_rmsd_bond.auth_seq_id_1 56 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 LYS _pdbx_validate_rmsd_bond.auth_seq_id_2 56 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.919 _pdbx_validate_rmsd_bond.bond_target_value 1.520 _pdbx_validate_rmsd_bond.bond_deviation 0.399 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.034 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LYS _pdbx_validate_rmsd_angle.auth_seq_id_1 56 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LYS _pdbx_validate_rmsd_angle.auth_seq_id_2 56 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LYS _pdbx_validate_rmsd_angle.auth_seq_id_3 56 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 91.41 _pdbx_validate_rmsd_angle.angle_target_value 111.60 _pdbx_validate_rmsd_angle.angle_deviation -20.19 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 121 ? ? -126.38 -67.87 2 1 VAL A 122 ? ? -134.93 -47.47 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLU 54 ? CG ? A GLU 2 CG 2 1 Y 0 A GLU 54 ? CD ? A GLU 2 CD 3 1 Y 0 A GLU 54 ? OE1 ? A GLU 2 OE1 4 1 Y 0 A GLU 54 ? OE2 ? A GLU 2 OE2 5 1 Y 0 A LYS 56 ? CD ? A LYS 4 CD 6 1 Y 0 A LYS 56 ? CE ? A LYS 4 CE 7 1 Y 0 A LYS 56 ? NZ ? A LYS 4 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 53 ? A ILE 1 2 1 Y 1 A PRO 155 ? A PRO 103 3 1 Y 1 A GLN 156 ? A GLN 104 4 1 Y 1 A GLN 157 ? A GLN 105 5 1 Y 1 A PRO 158 ? A PRO 106 6 1 Y 1 A THR 159 ? A THR 107 7 1 Y 1 A TYR 160 ? A TYR 108 8 1 Y 1 A VAL 161 ? A VAL 109 9 1 Y 1 A GLN 162 ? A GLN 110 10 1 Y 1 A ALA 163 ? A ALA 111 11 1 Y 1 A ASN 164 ? A ASN 112 12 1 Y 1 A ASN 165 ? A ASN 113 13 1 Y 1 A ASN 166 ? A ASN 114 14 1 Y 1 A ASN 167 ? A ASN 115 15 1 Y 1 A ASN 168 ? A ASN 116 16 1 Y 1 A ASN 169 ? A ASN 117 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CHLORIDE ION' CL 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CL 1 174 174 CL CL A . D 4 HOH 1 6 6 HOH HOH A . D 4 HOH 2 7 7 HOH HOH A . D 4 HOH 3 8 8 HOH HOH A . D 4 HOH 4 9 9 HOH HOH A . D 4 HOH 5 10 10 HOH HOH A . D 4 HOH 6 11 11 HOH HOH A . D 4 HOH 7 12 12 HOH HOH A . D 4 HOH 8 13 13 HOH HOH A . D 4 HOH 9 14 14 HOH HOH A . D 4 HOH 10 15 15 HOH HOH A . D 4 HOH 11 16 16 HOH HOH A . D 4 HOH 12 17 17 HOH HOH A . D 4 HOH 13 18 18 HOH HOH A . D 4 HOH 14 19 19 HOH HOH A . D 4 HOH 15 20 20 HOH HOH A . D 4 HOH 16 21 21 HOH HOH A . D 4 HOH 17 22 22 HOH HOH A . D 4 HOH 18 23 23 HOH HOH A . D 4 HOH 19 24 24 HOH HOH A . D 4 HOH 20 25 25 HOH HOH A . D 4 HOH 21 26 26 HOH HOH A . D 4 HOH 22 27 27 HOH HOH A . D 4 HOH 23 28 28 HOH HOH A . D 4 HOH 24 29 29 HOH HOH A . D 4 HOH 25 30 30 HOH HOH A . D 4 HOH 26 31 31 HOH HOH A . D 4 HOH 27 32 32 HOH HOH A . D 4 HOH 28 33 33 HOH HOH A . D 4 HOH 29 34 34 HOH HOH A . D 4 HOH 30 35 35 HOH HOH A . D 4 HOH 31 36 36 HOH HOH A . D 4 HOH 32 37 37 HOH HOH A . D 4 HOH 33 38 38 HOH HOH A . D 4 HOH 34 39 39 HOH HOH A . D 4 HOH 35 40 40 HOH HOH A . D 4 HOH 36 41 41 HOH HOH A . D 4 HOH 37 42 42 HOH HOH A . D 4 HOH 38 43 43 HOH HOH A . D 4 HOH 39 44 44 HOH HOH A . D 4 HOH 40 45 45 HOH HOH A . D 4 HOH 41 46 46 HOH HOH A . D 4 HOH 42 47 47 HOH HOH A . D 4 HOH 43 48 48 HOH HOH A . D 4 HOH 44 49 49 HOH HOH A . D 4 HOH 45 50 50 HOH HOH A . D 4 HOH 46 51 51 HOH HOH A . D 4 HOH 47 52 52 HOH HOH A . D 4 HOH 48 170 53 HOH HOH A . D 4 HOH 49 175 175 HOH HOH A . D 4 HOH 50 176 176 HOH HOH A . D 4 HOH 51 177 177 HOH HOH A . D 4 HOH 52 178 178 HOH HOH A . D 4 HOH 53 179 179 HOH HOH A . D 4 HOH 54 180 180 HOH HOH A . D 4 HOH 55 181 181 HOH HOH A . D 4 HOH 56 182 182 HOH HOH A . D 4 HOH 57 183 183 HOH HOH A . D 4 HOH 58 184 184 HOH HOH A . D 4 HOH 59 185 185 HOH HOH A . D 4 HOH 60 186 186 HOH HOH A . D 4 HOH 61 187 187 HOH HOH A . D 4 HOH 62 188 188 HOH HOH A . D 4 HOH 63 189 189 HOH HOH A . D 4 HOH 64 190 190 HOH HOH A . D 4 HOH 65 191 191 HOH HOH A . D 4 HOH 66 192 192 HOH HOH A . D 4 HOH 67 193 193 HOH HOH A . D 4 HOH 68 194 194 HOH HOH A . D 4 HOH 69 195 195 HOH HOH A . D 4 HOH 70 196 196 HOH HOH A . D 4 HOH 71 197 197 HOH HOH A . D 4 HOH 72 198 198 HOH HOH A . D 4 HOH 73 199 199 HOH HOH A . D 4 HOH 74 200 200 HOH HOH A . D 4 HOH 75 201 201 HOH HOH A . D 4 HOH 76 202 202 HOH HOH A . D 4 HOH 77 203 203 HOH HOH A . D 4 HOH 78 204 204 HOH HOH A . D 4 HOH 79 205 205 HOH HOH A . D 4 HOH 80 206 206 HOH HOH A . D 4 HOH 81 207 207 HOH HOH A . D 4 HOH 82 208 208 HOH HOH A . D 4 HOH 83 209 209 HOH HOH A . D 4 HOH 84 210 210 HOH HOH A . D 4 HOH 85 211 211 HOH HOH A . D 4 HOH 86 212 212 HOH HOH A . D 4 HOH 87 213 213 HOH HOH A . D 4 HOH 88 214 214 HOH HOH A . D 4 HOH 89 215 215 HOH HOH A . D 4 HOH 90 216 216 HOH HOH A . #