data_3PS8 # _entry.id 3PS8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3PS8 RCSB RCSB062753 WWPDB D_1000062753 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1G96 'Dimeric form of human cystatin C' unspecified PDB 1R4C 'Dimeric form of N-truncated human cystatin C' unspecified PDB 1TIJ 'Dimeric form of human cystatin C' unspecified PDB 3GAX 'monomeric form of human cystatin C (stab1)' unspecified PDB 3NX0 'monomeric form of human cystatin C (mutant V57N)' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3PS8 _pdbx_database_status.recvd_initial_deposition_date 2010-12-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Orlikowska, M.' 1 'Borek, D.' 2 'Otwinowski, Z.' 3 'Skowron, P.' 4 'Szymanska, A.' 5 # _citation.id primary _citation.title 'Crystal structure of L68V mutant of human cystatin C' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Orlikowska, M.' 1 primary 'Szymanska, A.' 2 primary 'Borek, D.' 3 primary 'Otwinowski, Z.' 4 primary 'Skowron, P.' 5 primary 'Jankowska, E.' 6 # _cell.entry_id 3PS8 _cell.length_a 139.801 _cell.length_b 139.801 _cell.length_c 139.801 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 48 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3PS8 _symmetry.space_group_name_H-M 'I 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 211 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Cystatin-C 13351.114 1 ? L68V ? ? 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 3 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 4 water nat water 18.015 80 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cystatin-3, Gamma-trace, Neuroendocrine basic polypeptide, Post-gamma-globulin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNL DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA ; _entity_poly.pdbx_seq_one_letter_code_can ;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNL DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 PRO n 1 4 GLY n 1 5 LYS n 1 6 PRO n 1 7 PRO n 1 8 ARG n 1 9 LEU n 1 10 VAL n 1 11 GLY n 1 12 GLY n 1 13 PRO n 1 14 MET n 1 15 ASP n 1 16 ALA n 1 17 SER n 1 18 VAL n 1 19 GLU n 1 20 GLU n 1 21 GLU n 1 22 GLY n 1 23 VAL n 1 24 ARG n 1 25 ARG n 1 26 ALA n 1 27 LEU n 1 28 ASP n 1 29 PHE n 1 30 ALA n 1 31 VAL n 1 32 GLY n 1 33 GLU n 1 34 TYR n 1 35 ASN n 1 36 LYS n 1 37 ALA n 1 38 SER n 1 39 ASN n 1 40 ASP n 1 41 MET n 1 42 TYR n 1 43 HIS n 1 44 SER n 1 45 ARG n 1 46 ALA n 1 47 LEU n 1 48 GLN n 1 49 VAL n 1 50 VAL n 1 51 ARG n 1 52 ALA n 1 53 ARG n 1 54 LYS n 1 55 GLN n 1 56 ILE n 1 57 VAL n 1 58 ALA n 1 59 GLY n 1 60 VAL n 1 61 ASN n 1 62 TYR n 1 63 PHE n 1 64 LEU n 1 65 ASP n 1 66 VAL n 1 67 GLU n 1 68 VAL n 1 69 GLY n 1 70 ARG n 1 71 THR n 1 72 THR n 1 73 CYS n 1 74 THR n 1 75 LYS n 1 76 THR n 1 77 GLN n 1 78 PRO n 1 79 ASN n 1 80 LEU n 1 81 ASP n 1 82 ASN n 1 83 CYS n 1 84 PRO n 1 85 PHE n 1 86 HIS n 1 87 ASP n 1 88 GLN n 1 89 PRO n 1 90 HIS n 1 91 LEU n 1 92 LYS n 1 93 ARG n 1 94 LYS n 1 95 ALA n 1 96 PHE n 1 97 CYS n 1 98 SER n 1 99 PHE n 1 100 GLN n 1 101 ILE n 1 102 TYR n 1 103 ALA n 1 104 VAL n 1 105 PRO n 1 106 TRP n 1 107 GLN n 1 108 GLY n 1 109 THR n 1 110 MET n 1 111 THR n 1 112 LEU n 1 113 SER n 1 114 LYS n 1 115 SER n 1 116 THR n 1 117 CYS n 1 118 GLN n 1 119 ASP n 1 120 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CST3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain C41 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PHD313 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYTC_HUMAN _struct_ref.pdbx_db_accession P01034 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNL DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA ; _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3PS8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01034 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 120 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3PS8 _struct_ref_seq_dif.mon_id VAL _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 68 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01034 _struct_ref_seq_dif.db_mon_id LEU _struct_ref_seq_dif.pdbx_seq_db_seq_num 94 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 68 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3PS8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.26 _exptl_crystal.density_percent_sol 71.15 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details '0.1M sodium acetate pH=4.6, 8% PEG 4000, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.pdbx_collection_date 2010-03-21 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97918 # _reflns.entry_id 3PS8 _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.55 _reflns.number_obs 7932 _reflns.number_all 7932 _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.pdbx_Rsym_value 0.115 _reflns.pdbx_netI_over_sigmaI 41.57 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 42.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.55 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.23 _reflns_shell.pdbx_redundancy 41.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3PS8 _refine.ls_number_reflns_obs 7087 _refine.ls_number_reflns_all 7932 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.00 _refine.ls_d_res_high 2.55 _refine.ls_percent_reflns_obs 94.01 _refine.ls_R_factor_obs 0.19069 _refine.ls_R_factor_R_work 0.18769 _refine.ls_R_factor_R_free 0.25055 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 356 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.935 _refine.correlation_coeff_Fo_to_Fc_free 0.891 _refine.B_iso_mean 34.265 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.245 _refine.overall_SU_ML 0.162 _refine.overall_SU_B 15.921 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_R_factor_all ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 859 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 80 _refine_hist.number_atoms_total 964 _refine_hist.d_res_high 2.55 _refine_hist.d_res_low 33.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 900 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.643 1.953 ? 1209 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.921 5.000 ? 108 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 38.345 23.864 ? 44 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 17.956 15.000 ? 146 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 17.817 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.110 0.200 ? 128 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.021 ? 686 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 3.967 1.500 ? 547 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 5.471 2.000 ? 879 'X-RAY DIFFRACTION' ? r_scbond_it 12.744 3.000 ? 353 'X-RAY DIFFRACTION' ? r_scangle_it 15.769 4.500 ? 330 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.55 _refine_ls_shell.d_res_low 2.617 _refine_ls_shell.number_reflns_R_work 405 _refine_ls_shell.R_factor_R_work 0.245 _refine_ls_shell.percent_reflns_obs 76.18 _refine_ls_shell.R_factor_R_free 0.430 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 30 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3PS8 _struct.title 'Crystal structure of L68V mutant of human cystatin C' _struct.pdbx_descriptor Cystatin-C _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3PS8 _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' _struct_keywords.text 'cysteine protease inhibitor, 3D domain swapping, Hereditary Cystatin C Amyloid Angiopathy, Protease inhibitor, HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 20 ? SER A 38 ? GLU A 20 SER A 38 1 ? 19 HELX_P HELX_P2 2 ASN A 79 ? CYS A 83 ? ASN A 79 CYS A 83 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 73 SG ? ? ? 1_555 A CYS 83 SG ? ? A CYS 73 A CYS 83 1_555 ? ? ? ? ? ? ? 2.055 ? disulf2 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 97 A CYS 117 1_555 ? ? ? ? ? ? ? 2.162 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 14 ? ASP A 15 ? MET A 14 ASP A 15 A 2 ARG A 53 ? LYS A 54 ? ARG A 53 LYS A 54 B 1 VAL A 60 ? GLY A 69 ? VAL A 60 GLY A 69 B 2 LYS A 94 ? VAL A 104 ? LYS A 94 VAL A 104 B 3 THR A 109 ? ASP A 119 ? THR A 109 ASP A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 14 ? N MET A 14 O LYS A 54 ? O LYS A 54 B 1 2 N VAL A 60 ? N VAL A 60 O ALA A 103 ? O ALA A 103 B 2 3 N TYR A 102 ? N TYR A 102 O THR A 111 ? O THR A 111 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PEG A 121' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PEG A 122' AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PEG A 123' AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ACT A 124' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ARG A 51 ? ARG A 51 . ? 1_555 ? 2 AC1 2 PEG C . ? PEG A 122 . ? 1_555 ? 3 AC2 5 TYR A 42 ? TYR A 42 . ? 17_555 ? 4 AC2 5 ARG A 51 ? ARG A 51 . ? 1_555 ? 5 AC2 5 ARG A 53 ? ARG A 53 . ? 1_555 ? 6 AC2 5 THR A 72 ? THR A 72 . ? 18_655 ? 7 AC2 5 PEG B . ? PEG A 121 . ? 1_555 ? 8 AC3 5 THR A 76 ? THR A 76 . ? 20_555 ? 9 AC3 5 GLN A 100 ? GLN A 100 . ? 1_555 ? 10 AC3 5 HOH F . ? HOH A 168 . ? 1_555 ? 11 AC3 5 HOH F . ? HOH A 189 . ? 2_655 ? 12 AC3 5 HOH F . ? HOH A 202 . ? 1_555 ? 13 AC4 6 TYR A 34 ? TYR A 34 . ? 1_555 ? 14 AC4 6 SER A 44 ? SER A 44 . ? 1_555 ? 15 AC4 6 VAL A 68 ? VAL A 68 . ? 2_655 ? 16 AC4 6 GLY A 69 ? GLY A 69 . ? 2_655 ? 17 AC4 6 ARG A 70 ? ARG A 70 . ? 2_655 ? 18 AC4 6 HOH F . ? HOH A 165 . ? 19_655 ? # _database_PDB_matrix.entry_id 3PS8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3PS8 _atom_sites.fract_transf_matrix[1][1] 0.007153 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007153 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007153 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 VAL 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 TRP 106 106 106 TRP TRP A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 MET 110 110 110 MET MET A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 ALA 120 120 120 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7530 ? 1 MORE -34 ? 1 'SSA (A^2)' 14030 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 139.8010000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 204 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-12-21 2 'Structure model' 1 1 2013-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 86.6852 -5.2224 31.1056 0.2289 0.7393 0.1396 0.1488 -0.0306 0.0851 4.3944 33.4246 18.0301 -9.6954 -4.8366 3.5258 -0.9857 -1.1616 -0.0576 2.2765 0.6186 0.3608 -0.0022 1.4923 0.3671 'X-RAY DIFFRACTION' 2 ? refined 81.8861 -15.3875 28.8665 0.5336 0.3546 0.4504 0.1037 0.0724 0.2544 43.1899 25.1172 49.2917 -15.4321 29.6305 4.3882 0.4711 -1.9287 -2.9628 1.8288 0.1078 -0.2013 3.3855 -0.5387 -0.5789 'X-RAY DIFFRACTION' 3 ? refined 80.0893 -13.1461 16.0757 0.1355 0.0845 0.1509 0.0569 0.0928 0.0644 7.6345 2.8190 26.7931 -4.7349 -4.5896 3.9151 -0.2962 -0.2096 -0.3728 0.0705 -0.0143 -0.0157 0.5526 0.1922 0.3105 'X-RAY DIFFRACTION' 4 ? refined 86.4009 -13.9473 12.2409 0.1672 0.0937 0.1705 0.0176 0.0812 0.0911 2.5247 4.2182 14.9588 0.4237 1.9242 8.0311 -0.2247 -0.2456 -0.2374 0.1457 0.1928 0.0050 0.2080 0.1992 0.0319 'X-RAY DIFFRACTION' 5 ? refined 67.1625 2.4048 27.2229 0.1063 0.1579 0.0648 0.0290 0.0055 0.0600 19.4764 3.4547 5.3809 -7.9167 6.5135 -1.6240 -0.3084 -0.4672 0.3185 0.0829 0.1699 -0.1504 -0.0788 0.0482 0.1386 'X-RAY DIFFRACTION' 6 ? refined 49.9407 17.0617 9.0394 0.1795 0.1437 0.2212 0.1227 -0.0290 -0.0970 9.6098 8.4948 19.8134 3.4751 -2.6297 -13.0937 -0.0248 -0.7049 0.6190 0.2703 0.0330 0.3097 -0.2002 -0.1164 -0.0082 'X-RAY DIFFRACTION' 7 ? refined 55.9310 25.5524 10.5065 0.7836 0.5050 0.9176 -0.0271 -0.1424 -0.5697 -0.4571 16.0574 8.1252 0.0995 7.8240 -8.6025 -0.3453 -0.2275 0.7305 2.6624 0.1970 -0.1747 -2.0512 0.4939 0.1483 'X-RAY DIFFRACTION' 8 ? refined 44.1114 18.4418 3.3874 0.2240 0.3656 0.3247 0.0357 -0.1166 0.1616 21.3444 8.7275 36.6559 3.2718 9.6895 15.2654 -0.4082 0.8937 0.4612 -0.8045 -0.2154 1.1378 -1.0505 -2.0078 0.6236 'X-RAY DIFFRACTION' 9 ? refined 55.4549 6.7473 16.2705 0.0739 0.1107 0.0634 0.0527 -0.0104 -0.0255 9.7381 5.8239 10.3461 -2.5926 6.7344 -3.4641 -0.0945 0.0397 -0.0275 -0.1507 0.0533 0.4569 -0.0842 -0.2366 0.0413 'X-RAY DIFFRACTION' 10 ? refined 72.6646 10.2690 29.3744 0.3620 0.6846 0.4965 0.0401 -0.2951 -0.1414 13.6882 82.3060 9.8129 5.9798 -11.3557 -2.2364 0.4008 -1.7054 -0.0401 1.7115 -0.5261 -4.0397 -0.4828 2.3063 0.1253 'X-RAY DIFFRACTION' 11 ? refined 58.5615 4.9982 15.1253 0.1558 0.1298 0.0412 0.0525 0.0387 0.0238 21.1839 9.4436 11.8850 5.4609 10.9306 4.9727 -0.4115 0.5957 0.0785 -0.5294 0.2228 0.3159 -0.2802 0.1393 0.1887 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 12 ? ? A 18 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 19 ? ? A 25 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 26 ? ? A 35 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 36 ? ? A 52 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 53 ? ? A 66 ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 67 ? ? A 73 ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 74 ? ? A 83 ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 84 ? ? A 92 ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 93 ? ? A 103 ? ? ? ? 'X-RAY DIFFRACTION' 10 10 A 104 ? ? A 108 ? ? ? ? 'X-RAY DIFFRACTION' 11 11 A 109 ? ? A 120 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-3000 'data collection' . ? 1 MOLREP phasing . ? 2 REFMAC refinement 5.5.0102 ? 3 HKL-3000 'data reduction' . ? 4 HKL-3000 'data scaling' . ? 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 82 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -145.65 _pdbx_validate_torsion.psi 41.10 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A VAL 10 ? A VAL 10 11 1 Y 1 A GLY 11 ? A GLY 11 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 'ACETATE ION' ACT 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 121 1 PEG PEG A . C 2 PEG 1 122 2 PEG PEG A . D 2 PEG 1 123 3 PEG PEG A . E 3 ACT 1 124 1 ACT ACT A . F 4 HOH 1 125 1 HOH HOH A . F 4 HOH 2 126 2 HOH HOH A . F 4 HOH 3 127 3 HOH HOH A . F 4 HOH 4 128 4 HOH HOH A . F 4 HOH 5 129 5 HOH HOH A . F 4 HOH 6 130 6 HOH HOH A . F 4 HOH 7 131 7 HOH HOH A . F 4 HOH 8 132 8 HOH HOH A . F 4 HOH 9 133 9 HOH HOH A . F 4 HOH 10 134 10 HOH HOH A . F 4 HOH 11 135 11 HOH HOH A . F 4 HOH 12 136 12 HOH HOH A . F 4 HOH 13 137 14 HOH HOH A . F 4 HOH 14 138 15 HOH HOH A . F 4 HOH 15 139 16 HOH HOH A . F 4 HOH 16 140 17 HOH HOH A . F 4 HOH 17 141 18 HOH HOH A . F 4 HOH 18 142 19 HOH HOH A . F 4 HOH 19 143 20 HOH HOH A . F 4 HOH 20 144 21 HOH HOH A . F 4 HOH 21 145 22 HOH HOH A . F 4 HOH 22 146 23 HOH HOH A . F 4 HOH 23 147 24 HOH HOH A . F 4 HOH 24 148 25 HOH HOH A . F 4 HOH 25 149 26 HOH HOH A . F 4 HOH 26 150 27 HOH HOH A . F 4 HOH 27 151 28 HOH HOH A . F 4 HOH 28 152 29 HOH HOH A . F 4 HOH 29 153 30 HOH HOH A . F 4 HOH 30 154 31 HOH HOH A . F 4 HOH 31 155 32 HOH HOH A . F 4 HOH 32 156 33 HOH HOH A . F 4 HOH 33 157 34 HOH HOH A . F 4 HOH 34 158 35 HOH HOH A . F 4 HOH 35 159 36 HOH HOH A . F 4 HOH 36 160 37 HOH HOH A . F 4 HOH 37 161 38 HOH HOH A . F 4 HOH 38 162 39 HOH HOH A . F 4 HOH 39 163 40 HOH HOH A . F 4 HOH 40 164 41 HOH HOH A . F 4 HOH 41 165 42 HOH HOH A . F 4 HOH 42 166 43 HOH HOH A . F 4 HOH 43 167 44 HOH HOH A . F 4 HOH 44 168 45 HOH HOH A . F 4 HOH 45 169 47 HOH HOH A . F 4 HOH 46 170 48 HOH HOH A . F 4 HOH 47 171 49 HOH HOH A . F 4 HOH 48 172 50 HOH HOH A . F 4 HOH 49 173 51 HOH HOH A . F 4 HOH 50 174 52 HOH HOH A . F 4 HOH 51 175 53 HOH HOH A . F 4 HOH 52 176 54 HOH HOH A . F 4 HOH 53 177 55 HOH HOH A . F 4 HOH 54 178 56 HOH HOH A . F 4 HOH 55 179 57 HOH HOH A . F 4 HOH 56 180 58 HOH HOH A . F 4 HOH 57 181 59 HOH HOH A . F 4 HOH 58 182 60 HOH HOH A . F 4 HOH 59 183 61 HOH HOH A . F 4 HOH 60 184 62 HOH HOH A . F 4 HOH 61 185 63 HOH HOH A . F 4 HOH 62 186 64 HOH HOH A . F 4 HOH 63 187 65 HOH HOH A . F 4 HOH 64 188 66 HOH HOH A . F 4 HOH 65 189 67 HOH HOH A . F 4 HOH 66 190 68 HOH HOH A . F 4 HOH 67 191 69 HOH HOH A . F 4 HOH 68 192 70 HOH HOH A . F 4 HOH 69 193 71 HOH HOH A . F 4 HOH 70 194 72 HOH HOH A . F 4 HOH 71 195 73 HOH HOH A . F 4 HOH 72 196 74 HOH HOH A . F 4 HOH 73 197 75 HOH HOH A . F 4 HOH 74 198 76 HOH HOH A . F 4 HOH 75 199 77 HOH HOH A . F 4 HOH 76 200 78 HOH HOH A . F 4 HOH 77 201 79 HOH HOH A . F 4 HOH 78 202 80 HOH HOH A . F 4 HOH 79 203 81 HOH HOH A . F 4 HOH 80 204 82 HOH HOH A . #