data_3PU6 # _entry.id 3PU6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3PU6 RCSB RCSB062815 WWPDB D_1000062815 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-11294b _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3PU6 _pdbx_database_status.recvd_initial_deposition_date 2010-12-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, Z.' 1 ? 'Burley, S.K.' 2 0000-0002-2487-9713 'Swaminathan, S.' 3 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 4 ? # _citation.id primary _citation.title 'The crystal structure of an uncharacterized protein from Wolinella succinogenes' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, Z.' 1 ? primary 'Burley, S.K.' 2 0000-0002-2487-9713 primary 'Swaminathan, S.' 3 ? # _cell.entry_id 3PU6 _cell.length_a 45.202 _cell.length_b 50.728 _cell.length_c 66.676 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3PU6 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 17622.463 1 ? ? ? ? 2 water nat water 18.015 11 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SLKKVLLCVGNELRGDDGVAIALGRLVEEQ(MSE)PEWSVFFGYDTPESEFGKLRELAPDVIVVADA(MSE)SGF KEGEIEFLDLSDERTYLYSTHNLPTPILISYLRGICSKTIFLGISVLLENVLHFSEGLSQGASDSAFVALGRIKELDG (MSE)LKEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLKKVLLCVGNELRGDDGVAIALGRLVEEQMPEWSVFFGYDTPESEFGKLRELAPDVIVVADAMSGFKEGEIEFLDLSD ERTYLYSTHNLPTPILISYLRGICSKTIFLGISVLLENVLHFSEGLSQGASDSAFVALGRIKELDGMLKEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-11294b # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 LEU n 1 4 LYS n 1 5 LYS n 1 6 VAL n 1 7 LEU n 1 8 LEU n 1 9 CYS n 1 10 VAL n 1 11 GLY n 1 12 ASN n 1 13 GLU n 1 14 LEU n 1 15 ARG n 1 16 GLY n 1 17 ASP n 1 18 ASP n 1 19 GLY n 1 20 VAL n 1 21 ALA n 1 22 ILE n 1 23 ALA n 1 24 LEU n 1 25 GLY n 1 26 ARG n 1 27 LEU n 1 28 VAL n 1 29 GLU n 1 30 GLU n 1 31 GLN n 1 32 MSE n 1 33 PRO n 1 34 GLU n 1 35 TRP n 1 36 SER n 1 37 VAL n 1 38 PHE n 1 39 PHE n 1 40 GLY n 1 41 TYR n 1 42 ASP n 1 43 THR n 1 44 PRO n 1 45 GLU n 1 46 SER n 1 47 GLU n 1 48 PHE n 1 49 GLY n 1 50 LYS n 1 51 LEU n 1 52 ARG n 1 53 GLU n 1 54 LEU n 1 55 ALA n 1 56 PRO n 1 57 ASP n 1 58 VAL n 1 59 ILE n 1 60 VAL n 1 61 VAL n 1 62 ALA n 1 63 ASP n 1 64 ALA n 1 65 MSE n 1 66 SER n 1 67 GLY n 1 68 PHE n 1 69 LYS n 1 70 GLU n 1 71 GLY n 1 72 GLU n 1 73 ILE n 1 74 GLU n 1 75 PHE n 1 76 LEU n 1 77 ASP n 1 78 LEU n 1 79 SER n 1 80 ASP n 1 81 GLU n 1 82 ARG n 1 83 THR n 1 84 TYR n 1 85 LEU n 1 86 TYR n 1 87 SER n 1 88 THR n 1 89 HIS n 1 90 ASN n 1 91 LEU n 1 92 PRO n 1 93 THR n 1 94 PRO n 1 95 ILE n 1 96 LEU n 1 97 ILE n 1 98 SER n 1 99 TYR n 1 100 LEU n 1 101 ARG n 1 102 GLY n 1 103 ILE n 1 104 CYS n 1 105 SER n 1 106 LYS n 1 107 THR n 1 108 ILE n 1 109 PHE n 1 110 LEU n 1 111 GLY n 1 112 ILE n 1 113 SER n 1 114 VAL n 1 115 LEU n 1 116 LEU n 1 117 GLU n 1 118 ASN n 1 119 VAL n 1 120 LEU n 1 121 HIS n 1 122 PHE n 1 123 SER n 1 124 GLU n 1 125 GLY n 1 126 LEU n 1 127 SER n 1 128 GLN n 1 129 GLY n 1 130 ALA n 1 131 SER n 1 132 ASP n 1 133 SER n 1 134 ALA n 1 135 PHE n 1 136 VAL n 1 137 ALA n 1 138 LEU n 1 139 GLY n 1 140 ARG n 1 141 ILE n 1 142 LYS n 1 143 GLU n 1 144 LEU n 1 145 ASP n 1 146 GLY n 1 147 MSE n 1 148 LEU n 1 149 LYS n 1 150 GLU n 1 151 GLY n 1 152 HIS n 1 153 HIS n 1 154 HIS n 1 155 HIS n 1 156 HIS n 1 157 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene WS1834 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Wolinella succinogenes' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 844 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) - codon+RIL (p) -Stratagene' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BC-pSGX3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7MR08_WOLSU _struct_ref.pdbx_db_accession Q7MR08 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KKVLLCVGNELRGDDGVAIALGRLVEEQMPEWSVFFGYDTPESEFGKLRELAPDVIVVADAMSGFKEGEIEFLDLSDERT YLYSTHNLPTPILISYLRGICSKTIFLGISVLLENVLHFSEGLSQGASDSAFVALGRIKELDGMLK ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3PU6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7MR08 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 147 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3PU6 MSE A 1 ? UNP Q7MR08 ? ? 'expression tag' -1 1 1 3PU6 SER A 2 ? UNP Q7MR08 ? ? 'expression tag' 0 2 1 3PU6 LEU A 3 ? UNP Q7MR08 ? ? 'expression tag' 1 3 1 3PU6 GLU A 150 ? UNP Q7MR08 ? ? 'expression tag' 148 4 1 3PU6 GLY A 151 ? UNP Q7MR08 ? ? 'expression tag' 149 5 1 3PU6 HIS A 152 ? UNP Q7MR08 ? ? 'expression tag' 150 6 1 3PU6 HIS A 153 ? UNP Q7MR08 ? ? 'expression tag' 151 7 1 3PU6 HIS A 154 ? UNP Q7MR08 ? ? 'expression tag' 152 8 1 3PU6 HIS A 155 ? UNP Q7MR08 ? ? 'expression tag' 153 9 1 3PU6 HIS A 156 ? UNP Q7MR08 ? ? 'expression tag' 154 10 1 3PU6 HIS A 157 ? UNP Q7MR08 ? ? 'expression tag' 155 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3PU6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_percent_sol 43.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.2 M Sodium formate, 20% w/v PEG 3350, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2010-12-01 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9791 # _reflns.entry_id 3PU6 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 66.68 _reflns.d_resolution_high 2.6 _reflns.number_obs 5065 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.069 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.1 _reflns.B_iso_Wilson_estimate 47.45 _reflns.pdbx_redundancy 7.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.74 _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_obs 0.273 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 13.6 _reflns_shell.pdbx_redundancy 7.3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 705 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3PU6 _refine.ls_number_reflns_obs 5005 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.08 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.372 _refine.ls_d_res_high 2.600 _refine.ls_percent_reflns_obs 99.34 _refine.ls_R_factor_obs 0.2267 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2243 _refine.ls_R_factor_R_free 0.2750 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.60 _refine.ls_number_reflns_R_free 230 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -12.7266 _refine.aniso_B[2][2] 23.0507 _refine.aniso_B[3][3] -10.3241 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.382 _refine.solvent_model_param_bsol 54.539 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model Isotropic _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.49 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error 29.10 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1062 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 1073 _refine_hist.d_res_high 2.600 _refine_hist.d_res_low 40.372 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.010 ? ? 1078 'X-RAY DIFFRACTION' ? f_angle_d 1.179 ? ? 1453 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 17.018 ? ? 391 'X-RAY DIFFRACTION' ? f_chiral_restr 0.067 ? ? 170 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 183 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.6000 3.2755 2304 0.2466 99.00 0.3220 . . 120 . . . . 'X-RAY DIFFRACTION' . 3.2755 40.3767 2471 0.2135 100.00 0.2519 . . 110 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 3PU6 _struct.title 'The crystal structure of an uncharacterized protein from Wolinella succinogenes' _struct.pdbx_descriptor 'Uncharacterized protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3PU6 _struct_keywords.pdbx_keywords 'Structural genomics, Unknown function' _struct_keywords.text ;Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, PSI, Unknown function ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 15 ? ASP A 18 ? ARG A 13 ASP A 16 5 ? 4 HELX_P HELX_P2 2 GLY A 19 ? MSE A 32 ? GLY A 17 MSE A 30 1 ? 14 HELX_P HELX_P3 3 THR A 43 ? SER A 46 ? THR A 41 SER A 44 5 ? 4 HELX_P HELX_P4 4 GLU A 47 ? ALA A 55 ? GLU A 45 ALA A 53 1 ? 9 HELX_P HELX_P5 5 ASP A 80 ? TYR A 86 ? ASP A 78 TYR A 84 1 ? 7 HELX_P HELX_P6 6 THR A 93 ? CYS A 104 ? THR A 91 CYS A 102 1 ? 12 HELX_P HELX_P7 7 GLU A 117 ? LEU A 120 ? GLU A 115 LEU A 118 5 ? 4 HELX_P HELX_P8 8 SER A 127 ? LEU A 148 ? SER A 125 LEU A 146 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLN 31 C ? ? ? 1_555 A MSE 32 N ? ? A GLN 29 A MSE 30 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A MSE 32 C ? ? ? 1_555 A PRO 33 N ? ? A MSE 30 A PRO 31 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale3 covale both ? A ALA 64 C ? ? ? 1_555 A MSE 65 N ? ? A ALA 62 A MSE 63 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? A MSE 65 C ? ? ? 1_555 A SER 66 N ? ? A MSE 63 A SER 64 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale5 covale both ? A GLY 146 C ? ? ? 1_555 A MSE 147 N ? ? A GLY 144 A MSE 145 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale6 covale both ? A MSE 147 C ? ? ? 1_555 A LEU 148 N ? ? A MSE 145 A LEU 146 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 35 ? TYR A 41 ? TRP A 33 TYR A 39 A 2 LYS A 5 ? VAL A 10 ? LYS A 3 VAL A 8 A 3 VAL A 58 ? GLY A 67 ? VAL A 56 GLY A 65 A 4 LYS A 106 ? LEU A 115 ? LYS A 104 LEU A 113 A 5 ILE A 73 ? ASP A 77 ? ILE A 71 ASP A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 40 ? O GLY A 38 N CYS A 9 ? N CYS A 7 A 2 3 N VAL A 6 ? N VAL A 4 O VAL A 58 ? O VAL A 56 A 3 4 N ILE A 59 ? N ILE A 57 O ILE A 108 ? O ILE A 106 A 4 5 O PHE A 109 ? O PHE A 107 N LEU A 76 ? N LEU A 74 # _database_PDB_matrix.entry_id 3PU6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3PU6 _atom_sites.fract_transf_matrix[1][1] 0.022123 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019713 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014998 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 LEU 3 1 1 LEU LEU A . n A 1 4 LYS 4 2 2 LYS LYS A . n A 1 5 LYS 5 3 3 LYS LYS A . n A 1 6 VAL 6 4 4 VAL VAL A . n A 1 7 LEU 7 5 5 LEU LEU A . n A 1 8 LEU 8 6 6 LEU LEU A . n A 1 9 CYS 9 7 7 CYS CYS A . n A 1 10 VAL 10 8 8 VAL VAL A . n A 1 11 GLY 11 9 9 GLY GLY A . n A 1 12 ASN 12 10 10 ASN ASN A . n A 1 13 GLU 13 11 11 GLU GLU A . n A 1 14 LEU 14 12 12 LEU LEU A . n A 1 15 ARG 15 13 13 ARG ARG A . n A 1 16 GLY 16 14 14 GLY GLY A . n A 1 17 ASP 17 15 15 ASP ASP A . n A 1 18 ASP 18 16 16 ASP ASP A . n A 1 19 GLY 19 17 17 GLY GLY A . n A 1 20 VAL 20 18 18 VAL VAL A . n A 1 21 ALA 21 19 19 ALA ALA A . n A 1 22 ILE 22 20 20 ILE ILE A . n A 1 23 ALA 23 21 21 ALA ALA A . n A 1 24 LEU 24 22 22 LEU LEU A . n A 1 25 GLY 25 23 23 GLY GLY A . n A 1 26 ARG 26 24 24 ARG ARG A . n A 1 27 LEU 27 25 25 LEU LEU A . n A 1 28 VAL 28 26 26 VAL VAL A . n A 1 29 GLU 29 27 27 GLU GLU A . n A 1 30 GLU 30 28 28 GLU GLU A . n A 1 31 GLN 31 29 29 GLN GLN A . n A 1 32 MSE 32 30 30 MSE MSE A . n A 1 33 PRO 33 31 31 PRO PRO A . n A 1 34 GLU 34 32 32 GLU GLU A . n A 1 35 TRP 35 33 33 TRP TRP A . n A 1 36 SER 36 34 34 SER SER A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 PHE 38 36 36 PHE PHE A . n A 1 39 PHE 39 37 37 PHE PHE A . n A 1 40 GLY 40 38 38 GLY GLY A . n A 1 41 TYR 41 39 39 TYR TYR A . n A 1 42 ASP 42 40 40 ASP ASP A . n A 1 43 THR 43 41 41 THR THR A . n A 1 44 PRO 44 42 42 PRO PRO A . n A 1 45 GLU 45 43 43 GLU GLU A . n A 1 46 SER 46 44 44 SER SER A . n A 1 47 GLU 47 45 45 GLU GLU A . n A 1 48 PHE 48 46 46 PHE PHE A . n A 1 49 GLY 49 47 47 GLY GLY A . n A 1 50 LYS 50 48 48 LYS LYS A . n A 1 51 LEU 51 49 49 LEU LEU A . n A 1 52 ARG 52 50 50 ARG ARG A . n A 1 53 GLU 53 51 51 GLU GLU A . n A 1 54 LEU 54 52 52 LEU LEU A . n A 1 55 ALA 55 53 53 ALA ALA A . n A 1 56 PRO 56 54 54 PRO PRO A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 VAL 58 56 56 VAL VAL A . n A 1 59 ILE 59 57 57 ILE ILE A . n A 1 60 VAL 60 58 58 VAL VAL A . n A 1 61 VAL 61 59 59 VAL VAL A . n A 1 62 ALA 62 60 60 ALA ALA A . n A 1 63 ASP 63 61 61 ASP ASP A . n A 1 64 ALA 64 62 62 ALA ALA A . n A 1 65 MSE 65 63 63 MSE MSE A . n A 1 66 SER 66 64 64 SER SER A . n A 1 67 GLY 67 65 65 GLY GLY A . n A 1 68 PHE 68 66 ? ? ? A . n A 1 69 LYS 69 67 ? ? ? A . n A 1 70 GLU 70 68 ? ? ? A . n A 1 71 GLY 71 69 ? ? ? A . n A 1 72 GLU 72 70 70 GLU ALA A . n A 1 73 ILE 73 71 71 ILE ILE A . n A 1 74 GLU 74 72 72 GLU GLU A . n A 1 75 PHE 75 73 73 PHE PHE A . n A 1 76 LEU 76 74 74 LEU LEU A . n A 1 77 ASP 77 75 75 ASP ASP A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 SER 79 77 77 SER SER A . n A 1 80 ASP 80 78 78 ASP ASP A . n A 1 81 GLU 81 79 79 GLU GLU A . n A 1 82 ARG 82 80 80 ARG ARG A . n A 1 83 THR 83 81 81 THR THR A . n A 1 84 TYR 84 82 82 TYR TYR A . n A 1 85 LEU 85 83 83 LEU LEU A . n A 1 86 TYR 86 84 84 TYR TYR A . n A 1 87 SER 87 85 ? ? ? A . n A 1 88 THR 88 86 ? ? ? A . n A 1 89 HIS 89 87 ? ? ? A . n A 1 90 ASN 90 88 ? ? ? A . n A 1 91 LEU 91 89 ? ? ? A . n A 1 92 PRO 92 90 90 PRO PRO A . n A 1 93 THR 93 91 91 THR THR A . n A 1 94 PRO 94 92 92 PRO PRO A . n A 1 95 ILE 95 93 93 ILE ILE A . n A 1 96 LEU 96 94 94 LEU LEU A . n A 1 97 ILE 97 95 95 ILE ILE A . n A 1 98 SER 98 96 96 SER SER A . n A 1 99 TYR 99 97 97 TYR TYR A . n A 1 100 LEU 100 98 98 LEU LEU A . n A 1 101 ARG 101 99 99 ARG ARG A . n A 1 102 GLY 102 100 100 GLY GLY A . n A 1 103 ILE 103 101 101 ILE ILE A . n A 1 104 CYS 104 102 102 CYS CYS A . n A 1 105 SER 105 103 103 SER SER A . n A 1 106 LYS 106 104 104 LYS LYS A . n A 1 107 THR 107 105 105 THR THR A . n A 1 108 ILE 108 106 106 ILE ILE A . n A 1 109 PHE 109 107 107 PHE PHE A . n A 1 110 LEU 110 108 108 LEU LEU A . n A 1 111 GLY 111 109 109 GLY GLY A . n A 1 112 ILE 112 110 110 ILE ILE A . n A 1 113 SER 113 111 111 SER SER A . n A 1 114 VAL 114 112 112 VAL VAL A . n A 1 115 LEU 115 113 113 LEU LEU A . n A 1 116 LEU 116 114 114 LEU LEU A . n A 1 117 GLU 117 115 115 GLU GLU A . n A 1 118 ASN 118 116 116 ASN ASN A . n A 1 119 VAL 119 117 117 VAL VAL A . n A 1 120 LEU 120 118 118 LEU LEU A . n A 1 121 HIS 121 119 119 HIS HIS A . n A 1 122 PHE 122 120 120 PHE PHE A . n A 1 123 SER 123 121 121 SER SER A . n A 1 124 GLU 124 122 122 GLU GLU A . n A 1 125 GLY 125 123 123 GLY GLY A . n A 1 126 LEU 126 124 124 LEU LEU A . n A 1 127 SER 127 125 125 SER SER A . n A 1 128 GLN 128 126 126 GLN GLN A . n A 1 129 GLY 129 127 127 GLY GLY A . n A 1 130 ALA 130 128 128 ALA ALA A . n A 1 131 SER 131 129 129 SER SER A . n A 1 132 ASP 132 130 130 ASP ASP A . n A 1 133 SER 133 131 131 SER SER A . n A 1 134 ALA 134 132 132 ALA ALA A . n A 1 135 PHE 135 133 133 PHE PHE A . n A 1 136 VAL 136 134 134 VAL VAL A . n A 1 137 ALA 137 135 135 ALA ALA A . n A 1 138 LEU 138 136 136 LEU LEU A . n A 1 139 GLY 139 137 137 GLY GLY A . n A 1 140 ARG 140 138 138 ARG ARG A . n A 1 141 ILE 141 139 139 ILE ILE A . n A 1 142 LYS 142 140 140 LYS LYS A . n A 1 143 GLU 143 141 141 GLU GLU A . n A 1 144 LEU 144 142 142 LEU LEU A . n A 1 145 ASP 145 143 143 ASP ASP A . n A 1 146 GLY 146 144 144 GLY GLY A . n A 1 147 MSE 147 145 145 MSE MSE A . n A 1 148 LEU 148 146 146 LEU LEU A . n A 1 149 LYS 149 147 147 LYS LYS A . n A 1 150 GLU 150 148 ? ? ? A . n A 1 151 GLY 151 149 ? ? ? A . n A 1 152 HIS 152 150 ? ? ? A . n A 1 153 HIS 153 151 ? ? ? A . n A 1 154 HIS 154 152 ? ? ? A . n A 1 155 HIS 155 153 ? ? ? A . n A 1 156 HIS 156 154 ? ? ? A . n A 1 157 HIS 157 155 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 156 2 HOH HOH A . B 2 HOH 2 157 3 HOH HOH A . B 2 HOH 3 158 6 HOH HOH A . B 2 HOH 4 159 7 HOH HOH A . B 2 HOH 5 160 9 HOH HOH A . B 2 HOH 6 161 10 HOH HOH A . B 2 HOH 7 162 11 HOH HOH A . B 2 HOH 8 163 16 HOH HOH A . B 2 HOH 9 164 17 HOH HOH A . B 2 HOH 10 165 18 HOH HOH A . B 2 HOH 11 166 19 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 32 A MSE 30 ? MET SELENOMETHIONINE 2 A MSE 65 A MSE 63 ? MET SELENOMETHIONINE 3 A MSE 147 A MSE 145 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-01-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-02-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 3 'Structure model' citation_author 3 3 'Structure model' struct_conn 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.identifier_ORCID' 2 3 'Structure model' '_citation_author.identifier_ORCID' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CBASS 'data collection' . ? 1 SOLVE phasing . ? 2 PHENIX refinement '(phenix.refine)' ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 15 ? ? -67.98 3.33 2 1 TYR A 39 ? ? 41.21 -120.60 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 70 ? CG ? A GLU 72 CG 2 1 Y 1 A GLU 70 ? CD ? A GLU 72 CD 3 1 Y 1 A GLU 70 ? OE1 ? A GLU 72 OE1 4 1 Y 1 A GLU 70 ? OE2 ? A GLU 72 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -1 ? A MSE 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A PHE 66 ? A PHE 68 4 1 Y 1 A LYS 67 ? A LYS 69 5 1 Y 1 A GLU 68 ? A GLU 70 6 1 Y 1 A GLY 69 ? A GLY 71 7 1 Y 1 A SER 85 ? A SER 87 8 1 Y 1 A THR 86 ? A THR 88 9 1 Y 1 A HIS 87 ? A HIS 89 10 1 Y 1 A ASN 88 ? A ASN 90 11 1 Y 1 A LEU 89 ? A LEU 91 12 1 Y 1 A GLU 148 ? A GLU 150 13 1 Y 1 A GLY 149 ? A GLY 151 14 1 Y 1 A HIS 150 ? A HIS 152 15 1 Y 1 A HIS 151 ? A HIS 153 16 1 Y 1 A HIS 152 ? A HIS 154 17 1 Y 1 A HIS 153 ? A HIS 155 18 1 Y 1 A HIS 154 ? A HIS 156 19 1 Y 1 A HIS 155 ? A HIS 157 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #