data_3PV6 # _entry.id 3PV6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3PV6 RCSB RCSB062851 WWPDB D_1000062851 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3PV7 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3PV6 _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-12-06 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Li, Y.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Structure of the activating natural killer cell receptor NKp30 bound to its ligand B7-H6 reveals basis for tumor cell recognition in humans ; _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, Y.' 1 ? primary 'Wang, Q.' 2 ? primary 'Mariuzza, R.A.' 3 ? # _cell.length_a 50.874 _cell.length_b 74.868 _cell.length_c 125.534 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3PV6 _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 3PV6 _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21167' 27816.373 1 ? ? 'UNP residues 25-262' ? 2 polymer man 'Natural cytotoxicity triggering receptor 3' 12859.525 1 ? ? 'UNP residues 19-135' ? 3 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? 5 water nat water 18.015 15 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 B7-H6 2 'Activating natural killer receptor p30, Natural killer cell p30-related protein, NK-p30, NKp30' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;ADLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSG DASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQK FPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSA AAHHHHHH ; ;ADLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSG DASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQK FPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSA AAHHHHHH ; A ? 2 'polypeptide(L)' no no ;LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDV RGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG ; ;LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDV RGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 LEU n 1 4 LYS n 1 5 VAL n 1 6 GLU n 1 7 MET n 1 8 MET n 1 9 ALA n 1 10 GLY n 1 11 GLY n 1 12 THR n 1 13 GLN n 1 14 ILE n 1 15 THR n 1 16 PRO n 1 17 LEU n 1 18 ASN n 1 19 ASP n 1 20 ASN n 1 21 VAL n 1 22 THR n 1 23 ILE n 1 24 PHE n 1 25 CYS n 1 26 ASN n 1 27 ILE n 1 28 PHE n 1 29 TYR n 1 30 SER n 1 31 GLN n 1 32 PRO n 1 33 LEU n 1 34 ASN n 1 35 ILE n 1 36 THR n 1 37 SER n 1 38 MET n 1 39 GLY n 1 40 ILE n 1 41 THR n 1 42 TRP n 1 43 PHE n 1 44 TRP n 1 45 LYS n 1 46 SER n 1 47 LEU n 1 48 THR n 1 49 PHE n 1 50 ASP n 1 51 LYS n 1 52 GLU n 1 53 VAL n 1 54 LYS n 1 55 VAL n 1 56 PHE n 1 57 GLU n 1 58 PHE n 1 59 PHE n 1 60 GLY n 1 61 ASP n 1 62 HIS n 1 63 GLN n 1 64 GLU n 1 65 ALA n 1 66 PHE n 1 67 ARG n 1 68 PRO n 1 69 GLY n 1 70 ALA n 1 71 ILE n 1 72 VAL n 1 73 SER n 1 74 PRO n 1 75 TRP n 1 76 ARG n 1 77 LEU n 1 78 LYS n 1 79 SER n 1 80 GLY n 1 81 ASP n 1 82 ALA n 1 83 SER n 1 84 LEU n 1 85 ARG n 1 86 LEU n 1 87 PRO n 1 88 GLY n 1 89 ILE n 1 90 GLN n 1 91 LEU n 1 92 GLU n 1 93 GLU n 1 94 ALA n 1 95 GLY n 1 96 GLU n 1 97 TYR n 1 98 ARG n 1 99 CYS n 1 100 GLU n 1 101 VAL n 1 102 VAL n 1 103 VAL n 1 104 THR n 1 105 PRO n 1 106 LEU n 1 107 LYS n 1 108 ALA n 1 109 GLN n 1 110 GLY n 1 111 THR n 1 112 VAL n 1 113 GLN n 1 114 LEU n 1 115 GLU n 1 116 VAL n 1 117 VAL n 1 118 ALA n 1 119 SER n 1 120 PRO n 1 121 ALA n 1 122 SER n 1 123 ARG n 1 124 LEU n 1 125 LEU n 1 126 LEU n 1 127 ASP n 1 128 GLN n 1 129 VAL n 1 130 GLY n 1 131 MET n 1 132 LYS n 1 133 GLU n 1 134 ASN n 1 135 GLU n 1 136 ASP n 1 137 LYS n 1 138 TYR n 1 139 MET n 1 140 CYS n 1 141 GLU n 1 142 SER n 1 143 SER n 1 144 GLY n 1 145 PHE n 1 146 TYR n 1 147 PRO n 1 148 GLU n 1 149 ALA n 1 150 ILE n 1 151 ASN n 1 152 ILE n 1 153 THR n 1 154 TRP n 1 155 GLU n 1 156 LYS n 1 157 GLN n 1 158 THR n 1 159 GLN n 1 160 LYS n 1 161 PHE n 1 162 PRO n 1 163 HIS n 1 164 PRO n 1 165 ILE n 1 166 GLU n 1 167 ILE n 1 168 SER n 1 169 GLU n 1 170 ASP n 1 171 VAL n 1 172 ILE n 1 173 THR n 1 174 GLY n 1 175 PRO n 1 176 THR n 1 177 ILE n 1 178 LYS n 1 179 ASN n 1 180 MET n 1 181 ASP n 1 182 GLY n 1 183 THR n 1 184 PHE n 1 185 ASN n 1 186 VAL n 1 187 THR n 1 188 SER n 1 189 CYS n 1 190 LEU n 1 191 LYS n 1 192 LEU n 1 193 ASN n 1 194 SER n 1 195 SER n 1 196 GLN n 1 197 GLU n 1 198 ASP n 1 199 PRO n 1 200 GLY n 1 201 THR n 1 202 VAL n 1 203 TYR n 1 204 GLN n 1 205 CYS n 1 206 VAL n 1 207 VAL n 1 208 ARG n 1 209 HIS n 1 210 ALA n 1 211 SER n 1 212 LEU n 1 213 HIS n 1 214 THR n 1 215 PRO n 1 216 LEU n 1 217 ARG n 1 218 SER n 1 219 ASN n 1 220 PHE n 1 221 THR n 1 222 LEU n 1 223 THR n 1 224 ALA n 1 225 ALA n 1 226 ARG n 1 227 HIS n 1 228 SER n 1 229 LEU n 1 230 SER n 1 231 GLU n 1 232 THR n 1 233 GLU n 1 234 LYS n 1 235 THR n 1 236 ASP n 1 237 ASN n 1 238 PHE n 1 239 SER n 1 240 ALA n 1 241 ALA n 1 242 ALA n 1 243 HIS n 1 244 HIS n 1 245 HIS n 1 246 HIS n 1 247 HIS n 1 248 HIS n 2 1 LEU n 2 2 TRP n 2 3 VAL n 2 4 SER n 2 5 GLN n 2 6 PRO n 2 7 PRO n 2 8 GLU n 2 9 ILE n 2 10 ARG n 2 11 THR n 2 12 LEU n 2 13 GLU n 2 14 GLY n 2 15 SER n 2 16 SER n 2 17 ALA n 2 18 PHE n 2 19 LEU n 2 20 PRO n 2 21 CYS n 2 22 SER n 2 23 PHE n 2 24 ASN n 2 25 ALA n 2 26 SER n 2 27 GLN n 2 28 GLY n 2 29 ARG n 2 30 LEU n 2 31 ALA n 2 32 ILE n 2 33 GLY n 2 34 SER n 2 35 VAL n 2 36 THR n 2 37 TRP n 2 38 PHE n 2 39 ARG n 2 40 ASP n 2 41 GLU n 2 42 VAL n 2 43 VAL n 2 44 PRO n 2 45 GLY n 2 46 LYS n 2 47 GLU n 2 48 VAL n 2 49 ARG n 2 50 ASN n 2 51 GLY n 2 52 THR n 2 53 PRO n 2 54 GLU n 2 55 PHE n 2 56 ARG n 2 57 GLY n 2 58 ARG n 2 59 LEU n 2 60 ALA n 2 61 PRO n 2 62 LEU n 2 63 ALA n 2 64 SER n 2 65 SER n 2 66 ARG n 2 67 PHE n 2 68 LEU n 2 69 HIS n 2 70 ASP n 2 71 HIS n 2 72 GLN n 2 73 ALA n 2 74 GLU n 2 75 LEU n 2 76 HIS n 2 77 ILE n 2 78 ARG n 2 79 ASP n 2 80 VAL n 2 81 ARG n 2 82 GLY n 2 83 HIS n 2 84 ASP n 2 85 ALA n 2 86 SER n 2 87 ILE n 2 88 TYR n 2 89 VAL n 2 90 CYS n 2 91 ARG n 2 92 VAL n 2 93 GLU n 2 94 VAL n 2 95 LEU n 2 96 GLY n 2 97 LEU n 2 98 GLY n 2 99 VAL n 2 100 GLY n 2 101 THR n 2 102 GLY n 2 103 ASN n 2 104 GLY n 2 105 THR n 2 106 ARG n 2 107 LEU n 2 108 VAL n 2 109 VAL n 2 110 GLU n 2 111 LYS n 2 112 GLU n 2 113 HIS n 2 114 PRO n 2 115 GLN n 2 116 LEU n 2 117 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? SP9 ? ? ? ? ? Baculovirus ? ? ? pAcGP67-B ? ? 2 1 sample ? ? ? human ? 'NCR3, 1C7, LY117' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET26b ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP YK047_HUMAN Q68D85 1 ;DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGD ASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKF PHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS ; 25 ? 2 UNP NCTR3_HUMAN O14931 2 ;LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDV RGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG ; 19 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3PV6 A 2 ? 239 ? Q68D85 25 ? 262 ? 25 262 2 2 3PV6 B 1 ? 117 ? O14931 19 ? 135 ? 19 135 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3PV6 ALA A 1 ? UNP Q68D85 ? ? 'expression tag' 24 1 1 3PV6 ALA A 240 ? UNP Q68D85 ? ? 'expression tag' 263 2 1 3PV6 ALA A 241 ? UNP Q68D85 ? ? 'expression tag' 264 3 1 3PV6 ALA A 242 ? UNP Q68D85 ? ? 'expression tag' 265 4 1 3PV6 HIS A 243 ? UNP Q68D85 ? ? 'expression tag' 266 5 1 3PV6 HIS A 244 ? UNP Q68D85 ? ? 'expression tag' 267 6 1 3PV6 HIS A 245 ? UNP Q68D85 ? ? 'expression tag' 268 7 1 3PV6 HIS A 246 ? UNP Q68D85 ? ? 'expression tag' 269 8 1 3PV6 HIS A 247 ? UNP Q68D85 ? ? 'expression tag' 270 9 1 3PV6 HIS A 248 ? UNP Q68D85 ? ? 'expression tag' 271 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3PV6 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.94 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 58.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'hanging drop' _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details 'PEG 3350, KF, pH 7.0, hanging drop, temperature 298K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2010-01-01 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.502 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_wavelength_list 1.502 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A # _reflns.entry_id 3PV6 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 500 _reflns.number_all 22003 _reflns.number_obs 21751 _reflns.percent_possible_obs 98.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.065 _reflns.pdbx_netI_over_sigmaI 53 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 14 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.38 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 88.2 _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_obs 3.3 _reflns_shell.pdbx_Rsym_value 0.485 _reflns_shell.pdbx_redundancy 11.8 _reflns_shell.number_unique_all 1909 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3PV6 _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 50.0000 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.4000 _refine.ls_number_reflns_obs 21661 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.2393 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2887 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 9.7000 _refine.ls_number_reflns_R_free 2137 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 51.5077 _refine.solvent_model_param_bsol 62.0383 _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -15.6840 _refine.aniso_B[2][2] 23.4390 _refine.aniso_B[3][3] -7.7550 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 90.240 _refine.B_iso_min 29.240 _refine.occupancy_max 1.000 _refine.occupancy_min 1.000 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2540 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 2611 _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 50.0000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.019 ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? 1.988 ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 CNS_TOPPAR:protein_rep.param ? 'X-RAY DIFFRACTION' 2 CNS_TOPPAR:carbohydrate.param ? 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water.param ? 'X-RAY DIFFRACTION' # _struct.entry_id 3PV6 _struct.title 'Crystal structure of NKp30 bound to its ligand B7-H6' _struct.pdbx_descriptor 'Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21167, Natural cytotoxicity triggering receptor 3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3PV6 _struct_keywords.text 'NK cell receptor, receptor-ligand complex, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? G N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 34 ? THR A 36 ? ASN A 57 THR A 59 5 ? 3 HELX_P HELX_P2 2 SER A 73 ? LYS A 78 ? SER A 96 LYS A 101 1 ? 6 HELX_P HELX_P3 3 GLN A 90 ? ALA A 94 ? GLN A 113 ALA A 117 5 ? 5 HELX_P HELX_P4 4 VAL B 43 ? GLY B 51 ? VAL B 61 GLY B 69 5 ? 9 HELX_P HELX_P5 5 THR B 52 ? ARG B 58 ? THR B 70 ARG B 76 1 ? 7 HELX_P HELX_P6 6 ALA B 63 ? HIS B 69 ? ALA B 81 HIS B 87 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 99 SG ? ? A CYS 48 A CYS 122 1_555 ? ? ? ? ? ? ? 2.063 ? ? disulf2 disulf ? ? A CYS 140 SG ? ? ? 1_555 A CYS 205 SG ? ? A CYS 163 A CYS 228 1_555 ? ? ? ? ? ? ? 2.057 ? ? disulf3 disulf ? ? B CYS 21 SG ? ? ? 1_555 B CYS 90 SG ? ? B CYS 39 B CYS 108 1_555 ? ? ? ? ? ? ? 2.066 ? ? covale1 covale one ? A ASN 20 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 43 A NAG 820 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation covale2 covale one ? A ASN 34 ND2 ? ? ? 1_555 E NAG . C1 ? ? A ASN 57 A NAG 830 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation covale3 covale one ? A ASN 185 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 208 C NAG 1 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation covale4 covale both ? C NAG . O4 ? ? ? 1_555 C NAG . C1 ? ? C NAG 1 C NAG 2 1_555 ? ? ? ? ? ? ? 1.395 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 THR 104 A . ? THR 127 A PRO 105 A ? PRO 128 A 1 0.52 2 TYR 146 A . ? TYR 169 A PRO 147 A ? PRO 170 A 1 1.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 6 ? C ? 2 ? D ? 4 ? E ? 4 ? F ? 2 ? G ? 4 ? H ? 4 ? I ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel D 3 4 ? anti-parallel E 1 2 ? anti-parallel E 2 3 ? anti-parallel E 3 4 ? anti-parallel F 1 2 ? anti-parallel G 1 2 ? parallel G 2 3 ? anti-parallel G 3 4 ? anti-parallel H 1 2 ? parallel H 2 3 ? anti-parallel H 3 4 ? anti-parallel I 1 2 ? anti-parallel I 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 3 ? GLU A 6 ? LEU A 26 GLU A 29 A 2 ASN A 26 ? TYR A 29 ? ASN A 49 TYR A 52 B 1 THR A 12 ? PRO A 16 ? THR A 35 PRO A 39 B 2 LEU A 106 ? VAL A 117 ? LEU A 129 VAL A 140 B 3 GLY A 95 ? VAL A 103 ? GLY A 118 VAL A 126 B 4 MET A 38 ? LYS A 45 ? MET A 61 LYS A 68 B 5 GLU A 52 ? PHE A 59 ? GLU A 75 PHE A 82 B 6 HIS A 62 ? ALA A 65 ? HIS A 85 ALA A 88 C 1 VAL A 21 ? ILE A 23 ? VAL A 44 ILE A 46 C 2 LEU A 84 ? LEU A 86 ? LEU A 107 LEU A 109 D 1 ALA A 121 ? LEU A 125 ? ALA A 144 LEU A 148 D 2 LYS A 137 ? PHE A 145 ? LYS A 160 PHE A 168 D 3 PHE A 184 ? LYS A 191 ? PHE A 207 LYS A 214 D 4 VAL A 171 ? LYS A 178 ? VAL A 194 LYS A 201 E 1 PHE A 161 ? GLU A 166 ? PHE A 184 GLU A 189 E 2 ASN A 151 ? THR A 158 ? ASN A 174 THR A 181 E 3 VAL A 202 ? ARG A 208 ? VAL A 225 ARG A 231 E 4 LEU A 216 ? PHE A 220 ? LEU A 239 PHE A 243 F 1 VAL B 3 ? SER B 4 ? VAL B 21 SER B 22 F 2 SER B 22 ? PHE B 23 ? SER B 40 PHE B 41 G 1 GLU B 8 ? LEU B 12 ? GLU B 26 LEU B 30 G 2 THR B 105 ? GLU B 110 ? THR B 123 GLU B 128 G 3 SER B 86 ? VAL B 94 ? SER B 104 VAL B 112 G 4 GLY B 33 ? ARG B 39 ? GLY B 51 ARG B 57 H 1 GLU B 8 ? LEU B 12 ? GLU B 26 LEU B 30 H 2 THR B 105 ? GLU B 110 ? THR B 123 GLU B 128 H 3 SER B 86 ? VAL B 94 ? SER B 104 VAL B 112 H 4 GLY B 98 ? THR B 101 ? GLY B 116 THR B 119 I 1 ALA B 17 ? LEU B 19 ? ALA B 35 LEU B 37 I 2 LEU B 75 ? ILE B 77 ? LEU B 93 ILE B 95 I 3 LEU B 59 ? ALA B 60 ? LEU B 77 ALA B 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 6 ? N GLU A 29 O ASN A 26 ? O ASN A 49 B 1 2 N GLN A 13 ? N GLN A 36 O GLU A 115 ? O GLU A 138 B 2 3 O LEU A 114 ? O LEU A 137 N GLY A 95 ? N GLY A 118 B 3 4 O GLU A 100 ? O GLU A 123 N THR A 41 ? N THR A 64 B 4 5 N TRP A 42 ? N TRP A 65 O VAL A 55 ? O VAL A 78 B 5 6 N GLU A 57 ? N GLU A 80 O GLU A 64 ? O GLU A 87 C 1 2 N ILE A 23 ? N ILE A 46 O LEU A 84 ? O LEU A 107 D 1 2 N LEU A 125 ? N LEU A 148 O MET A 139 ? O MET A 162 D 2 3 N TYR A 138 ? N TYR A 161 O LEU A 190 ? O LEU A 213 D 3 4 O CYS A 189 ? O CYS A 212 N ILE A 172 ? N ILE A 195 E 1 2 O ILE A 165 ? O ILE A 188 N LYS A 156 ? N LYS A 179 E 2 3 N THR A 153 ? N THR A 176 O VAL A 206 ? O VAL A 229 E 3 4 N VAL A 207 ? N VAL A 230 O LEU A 216 ? O LEU A 239 F 1 2 N SER B 4 ? N SER B 22 O SER B 22 ? O SER B 40 G 1 2 N ILE B 9 ? N ILE B 27 O VAL B 108 ? O VAL B 126 G 2 3 O THR B 105 ? O THR B 123 N TYR B 88 ? N TYR B 106 G 3 4 O GLU B 93 ? O GLU B 111 N SER B 34 ? N SER B 52 H 1 2 N ILE B 9 ? N ILE B 27 O VAL B 108 ? O VAL B 126 H 2 3 O THR B 105 ? O THR B 123 N TYR B 88 ? N TYR B 106 H 3 4 N VAL B 92 ? N VAL B 110 O GLY B 100 ? O GLY B 118 I 1 2 N LEU B 19 ? N LEU B 37 O LEU B 75 ? O LEU B 93 I 2 3 O HIS B 76 ? O HIS B 94 N ALA B 60 ? N ALA B 78 # _atom_sites.entry_id 3PV6 _atom_sites.fract_transf_matrix[1][1] 0.019646 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013351 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007968 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 24 24 ALA ALA A . n A 1 2 ASP 2 25 25 ASP ASP A . n A 1 3 LEU 3 26 26 LEU LEU A . n A 1 4 LYS 4 27 27 LYS LYS A . n A 1 5 VAL 5 28 28 VAL VAL A . n A 1 6 GLU 6 29 29 GLU GLU A . n A 1 7 MET 7 30 30 MET MET A . n A 1 8 MET 8 31 31 MET MET A . n A 1 9 ALA 9 32 32 ALA ALA A . n A 1 10 GLY 10 33 33 GLY GLY A . n A 1 11 GLY 11 34 34 GLY GLY A . n A 1 12 THR 12 35 35 THR THR A . n A 1 13 GLN 13 36 36 GLN GLN A . n A 1 14 ILE 14 37 37 ILE ILE A . n A 1 15 THR 15 38 38 THR THR A . n A 1 16 PRO 16 39 39 PRO PRO A . n A 1 17 LEU 17 40 40 LEU LEU A . n A 1 18 ASN 18 41 41 ASN ASN A . n A 1 19 ASP 19 42 42 ASP ASP A . n A 1 20 ASN 20 43 43 ASN ASN A . n A 1 21 VAL 21 44 44 VAL VAL A . n A 1 22 THR 22 45 45 THR THR A . n A 1 23 ILE 23 46 46 ILE ILE A . n A 1 24 PHE 24 47 47 PHE PHE A . n A 1 25 CYS 25 48 48 CYS CYS A . n A 1 26 ASN 26 49 49 ASN ASN A . n A 1 27 ILE 27 50 50 ILE ILE A . n A 1 28 PHE 28 51 51 PHE PHE A . n A 1 29 TYR 29 52 52 TYR TYR A . n A 1 30 SER 30 53 53 SER SER A . n A 1 31 GLN 31 54 54 GLN GLN A . n A 1 32 PRO 32 55 55 PRO PRO A . n A 1 33 LEU 33 56 56 LEU LEU A . n A 1 34 ASN 34 57 57 ASN ASN A . n A 1 35 ILE 35 58 58 ILE ILE A . n A 1 36 THR 36 59 59 THR THR A . n A 1 37 SER 37 60 60 SER SER A . n A 1 38 MET 38 61 61 MET MET A . n A 1 39 GLY 39 62 62 GLY GLY A . n A 1 40 ILE 40 63 63 ILE ILE A . n A 1 41 THR 41 64 64 THR THR A . n A 1 42 TRP 42 65 65 TRP TRP A . n A 1 43 PHE 43 66 66 PHE PHE A . n A 1 44 TRP 44 67 67 TRP TRP A . n A 1 45 LYS 45 68 68 LYS LYS A . n A 1 46 SER 46 69 69 SER SER A . n A 1 47 LEU 47 70 70 LEU LEU A . n A 1 48 THR 48 71 71 THR THR A . n A 1 49 PHE 49 72 72 PHE PHE A . n A 1 50 ASP 50 73 73 ASP ASP A . n A 1 51 LYS 51 74 74 LYS LYS A . n A 1 52 GLU 52 75 75 GLU GLU A . n A 1 53 VAL 53 76 76 VAL VAL A . n A 1 54 LYS 54 77 77 LYS LYS A . n A 1 55 VAL 55 78 78 VAL VAL A . n A 1 56 PHE 56 79 79 PHE PHE A . n A 1 57 GLU 57 80 80 GLU GLU A . n A 1 58 PHE 58 81 81 PHE PHE A . n A 1 59 PHE 59 82 82 PHE PHE A . n A 1 60 GLY 60 83 83 GLY GLY A . n A 1 61 ASP 61 84 84 ASP ASP A . n A 1 62 HIS 62 85 85 HIS HIS A . n A 1 63 GLN 63 86 86 GLN GLN A . n A 1 64 GLU 64 87 87 GLU GLU A . n A 1 65 ALA 65 88 88 ALA ALA A . n A 1 66 PHE 66 89 89 PHE PHE A . n A 1 67 ARG 67 90 90 ARG ARG A . n A 1 68 PRO 68 91 91 PRO PRO A . n A 1 69 GLY 69 92 92 GLY GLY A . n A 1 70 ALA 70 93 93 ALA ALA A . n A 1 71 ILE 71 94 94 ILE ILE A . n A 1 72 VAL 72 95 95 VAL VAL A . n A 1 73 SER 73 96 96 SER SER A . n A 1 74 PRO 74 97 97 PRO PRO A . n A 1 75 TRP 75 98 98 TRP TRP A . n A 1 76 ARG 76 99 99 ARG ARG A . n A 1 77 LEU 77 100 100 LEU LEU A . n A 1 78 LYS 78 101 101 LYS LYS A . n A 1 79 SER 79 102 102 SER SER A . n A 1 80 GLY 80 103 103 GLY GLY A . n A 1 81 ASP 81 104 104 ASP ASP A . n A 1 82 ALA 82 105 105 ALA ALA A . n A 1 83 SER 83 106 106 SER SER A . n A 1 84 LEU 84 107 107 LEU LEU A . n A 1 85 ARG 85 108 108 ARG ARG A . n A 1 86 LEU 86 109 109 LEU LEU A . n A 1 87 PRO 87 110 110 PRO PRO A . n A 1 88 GLY 88 111 111 GLY GLY A . n A 1 89 ILE 89 112 112 ILE ILE A . n A 1 90 GLN 90 113 113 GLN GLN A . n A 1 91 LEU 91 114 114 LEU LEU A . n A 1 92 GLU 92 115 115 GLU GLU A . n A 1 93 GLU 93 116 116 GLU GLU A . n A 1 94 ALA 94 117 117 ALA ALA A . n A 1 95 GLY 95 118 118 GLY GLY A . n A 1 96 GLU 96 119 119 GLU GLU A . n A 1 97 TYR 97 120 120 TYR TYR A . n A 1 98 ARG 98 121 121 ARG ARG A . n A 1 99 CYS 99 122 122 CYS CYS A . n A 1 100 GLU 100 123 123 GLU GLU A . n A 1 101 VAL 101 124 124 VAL VAL A . n A 1 102 VAL 102 125 125 VAL VAL A . n A 1 103 VAL 103 126 126 VAL VAL A . n A 1 104 THR 104 127 127 THR THR A . n A 1 105 PRO 105 128 128 PRO PRO A . n A 1 106 LEU 106 129 129 LEU LEU A . n A 1 107 LYS 107 130 130 LYS LYS A . n A 1 108 ALA 108 131 131 ALA ALA A . n A 1 109 GLN 109 132 132 GLN GLN A . n A 1 110 GLY 110 133 133 GLY GLY A . n A 1 111 THR 111 134 134 THR THR A . n A 1 112 VAL 112 135 135 VAL VAL A . n A 1 113 GLN 113 136 136 GLN GLN A . n A 1 114 LEU 114 137 137 LEU LEU A . n A 1 115 GLU 115 138 138 GLU GLU A . n A 1 116 VAL 116 139 139 VAL VAL A . n A 1 117 VAL 117 140 140 VAL VAL A . n A 1 118 ALA 118 141 141 ALA ALA A . n A 1 119 SER 119 142 142 SER SER A . n A 1 120 PRO 120 143 143 PRO PRO A . n A 1 121 ALA 121 144 144 ALA ALA A . n A 1 122 SER 122 145 145 SER SER A . n A 1 123 ARG 123 146 146 ARG ARG A . n A 1 124 LEU 124 147 147 LEU LEU A . n A 1 125 LEU 125 148 148 LEU LEU A . n A 1 126 LEU 126 149 149 LEU LEU A . n A 1 127 ASP 127 150 ? ? ? A . n A 1 128 GLN 128 151 ? ? ? A . n A 1 129 VAL 129 152 ? ? ? A . n A 1 130 GLY 130 153 ? ? ? A . n A 1 131 MET 131 154 ? ? ? A . n A 1 132 LYS 132 155 ? ? ? A . n A 1 133 GLU 133 156 ? ? ? A . n A 1 134 ASN 134 157 ? ? ? A . n A 1 135 GLU 135 158 158 GLU ALA A . n A 1 136 ASP 136 159 159 ASP ASP A . n A 1 137 LYS 137 160 160 LYS LYS A . n A 1 138 TYR 138 161 161 TYR TYR A . n A 1 139 MET 139 162 162 MET MET A . n A 1 140 CYS 140 163 163 CYS CYS A . n A 1 141 GLU 141 164 164 GLU GLU A . n A 1 142 SER 142 165 165 SER SER A . n A 1 143 SER 143 166 166 SER SER A . n A 1 144 GLY 144 167 167 GLY GLY A . n A 1 145 PHE 145 168 168 PHE PHE A . n A 1 146 TYR 146 169 169 TYR TYR A . n A 1 147 PRO 147 170 170 PRO PRO A . n A 1 148 GLU 148 171 171 GLU GLU A . n A 1 149 ALA 149 172 172 ALA ALA A . n A 1 150 ILE 150 173 173 ILE ILE A . n A 1 151 ASN 151 174 174 ASN ASN A . n A 1 152 ILE 152 175 175 ILE ILE A . n A 1 153 THR 153 176 176 THR THR A . n A 1 154 TRP 154 177 177 TRP TRP A . n A 1 155 GLU 155 178 178 GLU GLU A . n A 1 156 LYS 156 179 179 LYS LYS A . n A 1 157 GLN 157 180 180 GLN GLN A . n A 1 158 THR 158 181 181 THR THR A . n A 1 159 GLN 159 182 182 GLN GLN A . n A 1 160 LYS 160 183 183 LYS LYS A . n A 1 161 PHE 161 184 184 PHE PHE A . n A 1 162 PRO 162 185 185 PRO PRO A . n A 1 163 HIS 163 186 186 HIS HIS A . n A 1 164 PRO 164 187 187 PRO PRO A . n A 1 165 ILE 165 188 188 ILE ILE A . n A 1 166 GLU 166 189 189 GLU GLU A . n A 1 167 ILE 167 190 190 ILE ILE A . n A 1 168 SER 168 191 191 SER SER A . n A 1 169 GLU 169 192 192 GLU GLU A . n A 1 170 ASP 170 193 193 ASP ASP A . n A 1 171 VAL 171 194 194 VAL VAL A . n A 1 172 ILE 172 195 195 ILE ILE A . n A 1 173 THR 173 196 196 THR THR A . n A 1 174 GLY 174 197 197 GLY GLY A . n A 1 175 PRO 175 198 198 PRO PRO A . n A 1 176 THR 176 199 199 THR THR A . n A 1 177 ILE 177 200 200 ILE ILE A . n A 1 178 LYS 178 201 201 LYS LYS A . n A 1 179 ASN 179 202 202 ASN ASN A . n A 1 180 MET 180 203 203 MET MET A . n A 1 181 ASP 181 204 204 ASP ASP A . n A 1 182 GLY 182 205 205 GLY GLY A . n A 1 183 THR 183 206 206 THR THR A . n A 1 184 PHE 184 207 207 PHE PHE A . n A 1 185 ASN 185 208 208 ASN ASN A . n A 1 186 VAL 186 209 209 VAL VAL A . n A 1 187 THR 187 210 210 THR THR A . n A 1 188 SER 188 211 211 SER SER A . n A 1 189 CYS 189 212 212 CYS CYS A . n A 1 190 LEU 190 213 213 LEU LEU A . n A 1 191 LYS 191 214 214 LYS LYS A . n A 1 192 LEU 192 215 215 LEU LEU A . n A 1 193 ASN 193 216 216 ASN ASN A . n A 1 194 SER 194 217 217 SER SER A . n A 1 195 SER 195 218 218 SER SER A . n A 1 196 GLN 196 219 219 GLN GLN A . n A 1 197 GLU 197 220 220 GLU GLU A . n A 1 198 ASP 198 221 221 ASP ASP A . n A 1 199 PRO 199 222 222 PRO PRO A . n A 1 200 GLY 200 223 223 GLY GLY A . n A 1 201 THR 201 224 224 THR THR A . n A 1 202 VAL 202 225 225 VAL VAL A . n A 1 203 TYR 203 226 226 TYR TYR A . n A 1 204 GLN 204 227 227 GLN GLN A . n A 1 205 CYS 205 228 228 CYS CYS A . n A 1 206 VAL 206 229 229 VAL VAL A . n A 1 207 VAL 207 230 230 VAL VAL A . n A 1 208 ARG 208 231 231 ARG ARG A . n A 1 209 HIS 209 232 232 HIS HIS A . n A 1 210 ALA 210 233 233 ALA ALA A . n A 1 211 SER 211 234 234 SER SER A . n A 1 212 LEU 212 235 235 LEU LEU A . n A 1 213 HIS 213 236 236 HIS HIS A . n A 1 214 THR 214 237 237 THR THR A . n A 1 215 PRO 215 238 238 PRO PRO A . n A 1 216 LEU 216 239 239 LEU LEU A . n A 1 217 ARG 217 240 240 ARG ARG A . n A 1 218 SER 218 241 241 SER SER A . n A 1 219 ASN 219 242 242 ASN ASN A . n A 1 220 PHE 220 243 243 PHE PHE A . n A 1 221 THR 221 244 244 THR THR A . n A 1 222 LEU 222 245 245 LEU LEU A . n A 1 223 THR 223 246 ? ? ? A . n A 1 224 ALA 224 247 ? ? ? A . n A 1 225 ALA 225 248 ? ? ? A . n A 1 226 ARG 226 249 ? ? ? A . n A 1 227 HIS 227 250 ? ? ? A . n A 1 228 SER 228 251 ? ? ? A . n A 1 229 LEU 229 252 ? ? ? A . n A 1 230 SER 230 253 ? ? ? A . n A 1 231 GLU 231 254 ? ? ? A . n A 1 232 THR 232 255 ? ? ? A . n A 1 233 GLU 233 256 ? ? ? A . n A 1 234 LYS 234 257 ? ? ? A . n A 1 235 THR 235 258 ? ? ? A . n A 1 236 ASP 236 259 ? ? ? A . n A 1 237 ASN 237 260 ? ? ? A . n A 1 238 PHE 238 261 ? ? ? A . n A 1 239 SER 239 262 ? ? ? A . n A 1 240 ALA 240 263 ? ? ? A . n A 1 241 ALA 241 264 ? ? ? A . n A 1 242 ALA 242 265 ? ? ? A . n A 1 243 HIS 243 266 ? ? ? A . n A 1 244 HIS 244 267 ? ? ? A . n A 1 245 HIS 245 268 ? ? ? A . n A 1 246 HIS 246 269 ? ? ? A . n A 1 247 HIS 247 270 ? ? ? A . n A 1 248 HIS 248 271 ? ? ? A . n B 2 1 LEU 1 19 19 LEU LEU B . n B 2 2 TRP 2 20 20 TRP TRP B . n B 2 3 VAL 3 21 21 VAL VAL B . n B 2 4 SER 4 22 22 SER SER B . n B 2 5 GLN 5 23 23 GLN GLN B . n B 2 6 PRO 6 24 24 PRO PRO B . n B 2 7 PRO 7 25 25 PRO PRO B . n B 2 8 GLU 8 26 26 GLU GLU B . n B 2 9 ILE 9 27 27 ILE ILE B . n B 2 10 ARG 10 28 28 ARG ARG B . n B 2 11 THR 11 29 29 THR THR B . n B 2 12 LEU 12 30 30 LEU LEU B . n B 2 13 GLU 13 31 31 GLU GLU B . n B 2 14 GLY 14 32 32 GLY GLY B . n B 2 15 SER 15 33 33 SER SER B . n B 2 16 SER 16 34 34 SER SER B . n B 2 17 ALA 17 35 35 ALA ALA B . n B 2 18 PHE 18 36 36 PHE PHE B . n B 2 19 LEU 19 37 37 LEU LEU B . n B 2 20 PRO 20 38 38 PRO PRO B . n B 2 21 CYS 21 39 39 CYS CYS B . n B 2 22 SER 22 40 40 SER SER B . n B 2 23 PHE 23 41 41 PHE PHE B . n B 2 24 ASN 24 42 42 ASN ASN B . n B 2 25 ALA 25 43 43 ALA ALA B . n B 2 26 SER 26 44 44 SER SER B . n B 2 27 GLN 27 45 45 GLN GLN B . n B 2 28 GLY 28 46 46 GLY GLY B . n B 2 29 ARG 29 47 47 ARG ARG B . n B 2 30 LEU 30 48 48 LEU LEU B . n B 2 31 ALA 31 49 49 ALA ALA B . n B 2 32 ILE 32 50 50 ILE ILE B . n B 2 33 GLY 33 51 51 GLY GLY B . n B 2 34 SER 34 52 52 SER SER B . n B 2 35 VAL 35 53 53 VAL VAL B . n B 2 36 THR 36 54 54 THR THR B . n B 2 37 TRP 37 55 55 TRP TRP B . n B 2 38 PHE 38 56 56 PHE PHE B . n B 2 39 ARG 39 57 57 ARG ARG B . n B 2 40 ASP 40 58 58 ASP ASP B . n B 2 41 GLU 41 59 59 GLU GLU B . n B 2 42 VAL 42 60 60 VAL VAL B . n B 2 43 VAL 43 61 61 VAL VAL B . n B 2 44 PRO 44 62 62 PRO PRO B . n B 2 45 GLY 45 63 63 GLY GLY B . n B 2 46 LYS 46 64 64 LYS LYS B . n B 2 47 GLU 47 65 65 GLU GLU B . n B 2 48 VAL 48 66 66 VAL VAL B . n B 2 49 ARG 49 67 67 ARG ARG B . n B 2 50 ASN 50 68 68 ASN ASN B . n B 2 51 GLY 51 69 69 GLY GLY B . n B 2 52 THR 52 70 70 THR THR B . n B 2 53 PRO 53 71 71 PRO PRO B . n B 2 54 GLU 54 72 72 GLU GLU B . n B 2 55 PHE 55 73 73 PHE PHE B . n B 2 56 ARG 56 74 74 ARG ARG B . n B 2 57 GLY 57 75 75 GLY GLY B . n B 2 58 ARG 58 76 76 ARG ARG B . n B 2 59 LEU 59 77 77 LEU LEU B . n B 2 60 ALA 60 78 78 ALA ALA B . n B 2 61 PRO 61 79 79 PRO PRO B . n B 2 62 LEU 62 80 80 LEU LEU B . n B 2 63 ALA 63 81 81 ALA ALA B . n B 2 64 SER 64 82 82 SER SER B . n B 2 65 SER 65 83 83 SER SER B . n B 2 66 ARG 66 84 84 ARG ARG B . n B 2 67 PHE 67 85 85 PHE PHE B . n B 2 68 LEU 68 86 86 LEU LEU B . n B 2 69 HIS 69 87 87 HIS HIS B . n B 2 70 ASP 70 88 88 ASP ASP B . n B 2 71 HIS 71 89 89 HIS HIS B . n B 2 72 GLN 72 90 90 GLN GLN B . n B 2 73 ALA 73 91 91 ALA ALA B . n B 2 74 GLU 74 92 92 GLU GLU B . n B 2 75 LEU 75 93 93 LEU LEU B . n B 2 76 HIS 76 94 94 HIS HIS B . n B 2 77 ILE 77 95 95 ILE ILE B . n B 2 78 ARG 78 96 96 ARG ARG B . n B 2 79 ASP 79 97 97 ASP ASP B . n B 2 80 VAL 80 98 98 VAL VAL B . n B 2 81 ARG 81 99 99 ARG ARG B . n B 2 82 GLY 82 100 100 GLY GLY B . n B 2 83 HIS 83 101 101 HIS HIS B . n B 2 84 ASP 84 102 102 ASP ASP B . n B 2 85 ALA 85 103 103 ALA ALA B . n B 2 86 SER 86 104 104 SER SER B . n B 2 87 ILE 87 105 105 ILE ILE B . n B 2 88 TYR 88 106 106 TYR TYR B . n B 2 89 VAL 89 107 107 VAL VAL B . n B 2 90 CYS 90 108 108 CYS CYS B . n B 2 91 ARG 91 109 109 ARG ARG B . n B 2 92 VAL 92 110 110 VAL VAL B . n B 2 93 GLU 93 111 111 GLU GLU B . n B 2 94 VAL 94 112 112 VAL VAL B . n B 2 95 LEU 95 113 113 LEU LEU B . n B 2 96 GLY 96 114 114 GLY GLY B . n B 2 97 LEU 97 115 115 LEU LEU B . n B 2 98 GLY 98 116 116 GLY GLY B . n B 2 99 VAL 99 117 117 VAL VAL B . n B 2 100 GLY 100 118 118 GLY GLY B . n B 2 101 THR 101 119 119 THR THR B . n B 2 102 GLY 102 120 120 GLY GLY B . n B 2 103 ASN 103 121 121 ASN ASN B . n B 2 104 GLY 104 122 122 GLY GLY B . n B 2 105 THR 105 123 123 THR THR B . n B 2 106 ARG 106 124 124 ARG ARG B . n B 2 107 LEU 107 125 125 LEU LEU B . n B 2 108 VAL 108 126 126 VAL VAL B . n B 2 109 VAL 109 127 127 VAL VAL B . n B 2 110 GLU 110 128 128 GLU GLU B . n B 2 111 LYS 111 129 129 LYS ALA B . n B 2 112 GLU 112 130 130 GLU GLY B . n B 2 113 HIS 113 131 ? ? ? B . n B 2 114 PRO 114 132 ? ? ? B . n B 2 115 GLN 115 133 ? ? ? B . n B 2 116 LEU 116 134 ? ? ? B . n B 2 117 GLY 117 135 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 NAG 1 820 820 NAG NAG A . E 4 NAG 1 830 830 NAG NAG A . F 5 HOH 1 903 903 HOH HOH A . F 5 HOH 2 909 909 HOH HOH A . F 5 HOH 3 910 910 HOH HOH A . F 5 HOH 4 924 924 HOH HOH A . F 5 HOH 5 950 950 HOH HOH A . F 5 HOH 6 953 953 HOH HOH A . F 5 HOH 7 955 955 HOH HOH A . F 5 HOH 8 956 956 HOH HOH A . F 5 HOH 9 959 959 HOH HOH A . G 5 HOH 1 904 904 HOH HOH B . G 5 HOH 2 906 906 HOH HOH B . G 5 HOH 3 944 944 HOH HOH B . G 5 HOH 4 948 948 HOH HOH B . G 5 HOH 5 957 957 HOH HOH B . G 5 HOH 6 958 958 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ASN 185 A ASN 208 ? ASN 'GLYCOSYLATION SITE' 2 A ASN 20 A ASN 43 ? ASN 'GLYCOSYLATION SITE' 3 A ASN 34 A ASN 57 ? ASN 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-03-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-08 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' atom_site 3 4 'Structure model' chem_comp 4 4 'Structure model' entity 5 4 'Structure model' pdbx_branch_scheme 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_entity_branch 8 4 'Structure model' pdbx_entity_branch_descriptor 9 4 'Structure model' pdbx_entity_branch_link 10 4 'Structure model' pdbx_entity_branch_list 11 4 'Structure model' pdbx_entity_nonpoly 12 4 'Structure model' pdbx_nonpoly_scheme 13 4 'Structure model' pdbx_struct_assembly_gen 14 4 'Structure model' struct_asym 15 4 'Structure model' struct_conn 16 4 'Structure model' struct_ref_seq_dif 17 4 'Structure model' struct_site 18 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.auth_asym_id' 2 4 'Structure model' '_atom_site.auth_seq_id' 3 4 'Structure model' '_atom_site.label_asym_id' 4 4 'Structure model' '_atom_site.label_entity_id' 5 4 'Structure model' '_chem_comp.name' 6 4 'Structure model' '_chem_comp.type' 7 4 'Structure model' '_pdbx_entity_nonpoly.entity_id' 8 4 'Structure model' '_pdbx_entity_nonpoly.name' 9 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 10 4 'Structure model' '_struct_conn.pdbx_dist_value' 11 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 4 'Structure model' '_struct_conn.pdbx_role' 13 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 14 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 15 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 16 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 20 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 23 4 'Structure model' '_struct_ref_seq_dif.details' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 2.200 _diffrn_reflns.pdbx_d_res_low 50.000 _diffrn_reflns.pdbx_number_obs 24171 _diffrn_reflns.pdbx_Rmerge_I_obs 0.085 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared 1.07 _diffrn_reflns.av_sigmaI_over_netI ? _diffrn_reflns.pdbx_redundancy 13.40 _diffrn_reflns.pdbx_percent_possible_obs 96.00 _diffrn_reflns.number 323809 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 4.74 50.00 ? ? 0.051 ? 1.384 13.30 99.90 1 3.76 4.74 ? ? 0.057 ? 1.375 14.10 100.00 1 3.29 3.76 ? ? 0.071 ? 1.138 14.40 100.00 1 2.99 3.29 ? ? 0.114 ? 1.059 14.50 100.00 1 2.77 2.99 ? ? 0.181 ? 1.002 14.50 100.00 1 2.61 2.77 ? ? 0.296 ? 0.964 14.40 100.00 1 2.48 2.61 ? ? 0.419 ? 0.924 13.80 99.80 1 2.37 2.48 ? ? 0.543 ? 0.892 12.60 95.60 1 2.28 2.37 ? ? 0.608 ? 0.870 11.50 86.40 1 2.20 2.28 ? ? 0.644 ? 0.868 9.80 77.70 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns-online.org/ Fortran_77 ? 2 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 3 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 4 DENZO . ? ? ? ? 'data reduction' ? ? ? 5 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 6 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 7 PHASES . ? ? ? ? phasing ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 72 ? ? -122.58 -150.59 2 1 ASP A 73 ? ? -80.83 -71.29 3 1 LYS A 74 ? ? 0.74 125.02 4 1 PHE A 82 ? ? -172.56 133.88 5 1 THR A 127 ? ? -35.33 132.55 6 1 ASP A 159 ? ? 167.69 86.80 7 1 PHE A 184 ? ? -153.12 77.36 8 1 PRO A 185 ? ? -35.86 -38.40 9 1 LEU A 215 ? ? -98.11 -138.05 10 1 ASN A 216 ? ? 170.98 79.68 11 1 SER A 218 ? ? 59.09 7.58 12 1 THR A 244 ? ? -131.00 -50.39 13 1 GLN B 45 ? ? -25.50 -57.10 14 1 ASP B 58 ? ? 71.71 -41.83 15 1 ARG B 67 ? ? -73.25 26.29 16 1 HIS B 89 ? ? 74.06 41.97 17 1 ALA B 91 ? ? -140.33 38.95 18 1 GLU B 92 ? ? -48.84 157.91 19 1 SER B 104 ? ? -178.87 -175.44 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 169 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.066 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 158 ? CG ? A GLU 135 CG 2 1 Y 1 A GLU 158 ? CD ? A GLU 135 CD 3 1 Y 1 A GLU 158 ? OE1 ? A GLU 135 OE1 4 1 Y 1 A GLU 158 ? OE2 ? A GLU 135 OE2 5 1 Y 1 B LYS 129 ? CG ? B LYS 111 CG 6 1 Y 1 B LYS 129 ? CD ? B LYS 111 CD 7 1 Y 1 B LYS 129 ? CE ? B LYS 111 CE 8 1 Y 1 B LYS 129 ? NZ ? B LYS 111 NZ 9 1 Y 1 B GLU 130 ? CB ? B GLU 112 CB 10 1 Y 1 B GLU 130 ? CG ? B GLU 112 CG 11 1 Y 1 B GLU 130 ? CD ? B GLU 112 CD 12 1 Y 1 B GLU 130 ? OE1 ? B GLU 112 OE1 13 1 Y 1 B GLU 130 ? OE2 ? B GLU 112 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 150 ? A ASP 127 2 1 Y 1 A GLN 151 ? A GLN 128 3 1 Y 1 A VAL 152 ? A VAL 129 4 1 Y 1 A GLY 153 ? A GLY 130 5 1 Y 1 A MET 154 ? A MET 131 6 1 Y 1 A LYS 155 ? A LYS 132 7 1 Y 1 A GLU 156 ? A GLU 133 8 1 Y 1 A ASN 157 ? A ASN 134 9 1 Y 1 A THR 246 ? A THR 223 10 1 Y 1 A ALA 247 ? A ALA 224 11 1 Y 1 A ALA 248 ? A ALA 225 12 1 Y 1 A ARG 249 ? A ARG 226 13 1 Y 1 A HIS 250 ? A HIS 227 14 1 Y 1 A SER 251 ? A SER 228 15 1 Y 1 A LEU 252 ? A LEU 229 16 1 Y 1 A SER 253 ? A SER 230 17 1 Y 1 A GLU 254 ? A GLU 231 18 1 Y 1 A THR 255 ? A THR 232 19 1 Y 1 A GLU 256 ? A GLU 233 20 1 Y 1 A LYS 257 ? A LYS 234 21 1 Y 1 A THR 258 ? A THR 235 22 1 Y 1 A ASP 259 ? A ASP 236 23 1 Y 1 A ASN 260 ? A ASN 237 24 1 Y 1 A PHE 261 ? A PHE 238 25 1 Y 1 A SER 262 ? A SER 239 26 1 Y 1 A ALA 263 ? A ALA 240 27 1 Y 1 A ALA 264 ? A ALA 241 28 1 Y 1 A ALA 265 ? A ALA 242 29 1 Y 1 A HIS 266 ? A HIS 243 30 1 Y 1 A HIS 267 ? A HIS 244 31 1 Y 1 A HIS 268 ? A HIS 245 32 1 Y 1 A HIS 269 ? A HIS 246 33 1 Y 1 A HIS 270 ? A HIS 247 34 1 Y 1 A HIS 271 ? A HIS 248 35 1 Y 1 B HIS 131 ? B HIS 113 36 1 Y 1 B PRO 132 ? B PRO 114 37 1 Y 1 B GLN 133 ? B GLN 115 38 1 Y 1 B LEU 134 ? B LEU 116 39 1 Y 1 B GLY 135 ? B GLY 117 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero C 3 NAG 1 C NAG 1 A NAG 800 n C 3 NAG 2 C NAG 2 A NAG 801 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 3 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 3 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 3 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 3 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 3 NAG 1 n 3 NAG 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 5 water HOH #