data_3QJM # _entry.id 3QJM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3QJM RCSB RCSB063727 WWPDB D_1000063727 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3QJN _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3QJM _pdbx_database_status.recvd_initial_deposition_date 2011-01-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, J.H.' 1 'Park, H.' 2 'Park, S.J.' 3 'Kim, H.J.' 4 'Eom, S.H.' 5 # _citation.id primary _citation.title 'The structural flexibility of the shank1 PDZ domain is important for its binding to different ligands' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 407 _citation.page_first 207 _citation.page_last 212 _citation.year 2011 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21376703 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2011.02.141 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lee, J.H.' 1 primary 'Park, H.' 2 primary 'Park, S.J.' 3 primary 'Kim, H.J.' 4 primary 'Eom, S.H.' 5 # _cell.entry_id 3QJM _cell.length_a 57.625 _cell.length_b 57.625 _cell.length_c 144.042 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3QJM _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SH3 and multiple ankyrin repeat domains protein 1' 12755.696 2 ? ? 'PDZ domain' ? 2 polymer syn Beta-PIX 590.581 2 ? ? ? ? 3 water nat water 18.015 80 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Shank1, GKAP/SAPAP-interacting protein, SPANK-1, Somatostatin receptor-interacting protein, SSTR-interacting protein, SSTRIP, Synamon ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKV GHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHK ; ;GSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKV GHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHK ; A,B ? 2 'polypeptide(L)' no no DETNL DETNL C,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASP n 1 4 TYR n 1 5 ILE n 1 6 ILE n 1 7 LYS n 1 8 GLU n 1 9 LYS n 1 10 THR n 1 11 VAL n 1 12 LEU n 1 13 LEU n 1 14 GLN n 1 15 LYS n 1 16 LYS n 1 17 ASP n 1 18 SER n 1 19 GLU n 1 20 GLY n 1 21 PHE n 1 22 GLY n 1 23 PHE n 1 24 VAL n 1 25 LEU n 1 26 ARG n 1 27 GLY n 1 28 ALA n 1 29 LYS n 1 30 ALA n 1 31 GLN n 1 32 THR n 1 33 PRO n 1 34 ILE n 1 35 GLU n 1 36 GLU n 1 37 PHE n 1 38 THR n 1 39 PRO n 1 40 THR n 1 41 PRO n 1 42 ALA n 1 43 PHE n 1 44 PRO n 1 45 ALA n 1 46 LEU n 1 47 GLN n 1 48 TYR n 1 49 LEU n 1 50 GLU n 1 51 SER n 1 52 VAL n 1 53 ASP n 1 54 GLU n 1 55 GLY n 1 56 GLY n 1 57 VAL n 1 58 ALA n 1 59 TRP n 1 60 ARG n 1 61 ALA n 1 62 GLY n 1 63 LEU n 1 64 ARG n 1 65 MET n 1 66 GLY n 1 67 ASP n 1 68 PHE n 1 69 LEU n 1 70 ILE n 1 71 GLU n 1 72 VAL n 1 73 ASN n 1 74 GLY n 1 75 GLN n 1 76 ASN n 1 77 VAL n 1 78 VAL n 1 79 LYS n 1 80 VAL n 1 81 GLY n 1 82 HIS n 1 83 ARG n 1 84 GLN n 1 85 VAL n 1 86 VAL n 1 87 ASN n 1 88 MET n 1 89 ILE n 1 90 ARG n 1 91 GLN n 1 92 GLY n 1 93 GLY n 1 94 ASN n 1 95 THR n 1 96 LEU n 1 97 MET n 1 98 VAL n 1 99 LYS n 1 100 VAL n 1 101 VAL n 1 102 MET n 1 103 VAL n 1 104 THR n 1 105 ARG n 1 106 HIS n 1 107 PRO n 1 108 ASP n 1 109 MET n 1 110 ASP n 1 111 GLU n 1 112 ALA n 1 113 VAL n 1 114 HIS n 1 115 LYS n 2 1 ASP n 2 2 GLU n 2 3 THR n 2 4 ASN n 2 5 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Shank1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'synthetic peptide' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP SHAN1_RAT Q9WV48 1 ;GSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKV GHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHK ; 654 ? 2 PDB 3QJM 3QJM 2 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3QJM A 1 ? 115 ? Q9WV48 654 ? 768 ? 654 768 2 1 3QJM B 1 ? 115 ? Q9WV48 654 ? 768 ? 654 768 3 2 3QJM C 1 ? 5 ? 3QJM 642 ? 646 ? 642 646 4 2 3QJM D 1 ? 5 ? 3QJM 642 ? 646 ? 642 646 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3QJM _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_percent_sol 45.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_details '100mM sodium acetate(pH 5.5-6.0), 0.8M lithium sulfate, 0.7M ammonium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 294K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0000 # _reflns.entry_id 3QJM _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.3 _reflns.number_obs 10106 _reflns.number_all 10106 _reflns.percent_possible_obs 89.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.percent_possible_all 83.7 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3QJM _refine.ls_number_reflns_obs 10087 _refine.ls_number_reflns_all 10106 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.47 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 25.368 _refine.ls_d_res_high 2.311 _refine.ls_percent_reflns_obs 89.48 _refine.ls_R_factor_obs 0.2362 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2346 _refine.ls_R_factor_R_free 0.2670 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.00 _refine.ls_number_reflns_R_free 504 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 25.9547 _refine.aniso_B[1][1] 5.4461 _refine.aniso_B[2][2] 5.4461 _refine.aniso_B[3][3] -10.8923 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.418 _refine.solvent_model_param_bsol 43.148 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.25 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8143 _refine.B_iso_max 74.850 _refine.B_iso_min 8.600 _refine.pdbx_overall_phase_error 24.6600 _refine.occupancy_max 1.000 _refine.occupancy_min 0.490 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1602 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 80 _refine_hist.number_atoms_total 1682 _refine_hist.d_res_high 2.311 _refine_hist.d_res_low 25.368 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 1631 0.008 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2193 1.135 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 251 0.071 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 282 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 608 16.631 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.redundancy_reflns_obs 2.3105 2.5429 4 85.0000 2200 . 0.2249 0.2930 . 116 . 2316 . 'X-RAY DIFFRACTION' . 2.5429 2.9104 4 90.0000 2378 . 0.2374 0.2965 . 124 . 2502 . 'X-RAY DIFFRACTION' . 2.9104 3.6650 4 94.0000 2499 . 0.2212 0.2388 . 132 . 2631 . 'X-RAY DIFFRACTION' . 3.6650 25.3694 4 89.0000 2506 . 0.2346 0.2626 . 132 . 2638 . 'X-RAY DIFFRACTION' . # _struct.entry_id 3QJM _struct.title 'Structural flexibility of Shank PDZ domain is important for its binding to different ligands' _struct.pdbx_descriptor 'SH3 and multiple ankyrin repeat domains protein 1, Beta-PIX' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3QJM _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'PDZ domain, Protein-protein interaction, Beta-PIX, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 56 ? ALA A 61 ? GLY A 709 ALA A 714 1 ? 6 HELX_P HELX_P2 2 GLY A 81 ? GLY A 92 ? GLY A 734 GLY A 745 1 ? 12 HELX_P HELX_P3 3 GLY B 56 ? ALA B 61 ? GLY B 709 ALA B 714 1 ? 6 HELX_P HELX_P4 4 GLY B 81 ? GLY B 92 ? GLY B 734 GLY B 745 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 3 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 75 ? ASN A 76 ? GLN A 728 ASN A 729 A 2 PHE A 68 ? VAL A 72 ? PHE A 721 VAL A 725 A 3 THR A 95 ? THR A 104 ? THR A 748 THR A 757 A 4 TYR A 4 ? GLN A 14 ? TYR A 657 GLN A 667 A 5 SER B 2 ? GLN B 14 ? SER B 655 GLN B 667 A 6 THR B 95 ? THR B 104 ? THR B 748 THR B 757 A 7 PHE B 68 ? VAL B 72 ? PHE B 721 VAL B 725 A 8 GLN B 75 ? ASN B 76 ? GLN B 728 ASN B 729 B 1 GLN A 47 ? VAL A 52 ? GLN A 700 VAL A 705 B 2 PHE A 23 ? GLY A 27 ? PHE A 676 GLY A 680 B 3 GLU C 2 ? ASN C 4 ? GLU C 643 ASN C 645 C 1 GLN B 47 ? VAL B 52 ? GLN B 700 VAL B 705 C 2 PHE B 23 ? GLY B 27 ? PHE B 676 GLY B 680 C 3 GLU D 2 ? ASN D 4 ? GLU D 643 ASN D 645 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 75 ? O GLN A 728 N VAL A 72 ? N VAL A 725 A 2 3 N ILE A 70 ? N ILE A 723 O LYS A 99 ? O LYS A 752 A 3 4 O VAL A 100 ? O VAL A 753 N LYS A 9 ? N LYS A 662 A 4 5 N ILE A 6 ? N ILE A 659 O TYR B 4 ? O TYR B 657 A 5 6 N LYS B 7 ? N LYS B 660 O MET B 102 ? O MET B 755 A 6 7 O LYS B 99 ? O LYS B 752 N ILE B 70 ? N ILE B 723 A 7 8 N VAL B 72 ? N VAL B 725 O GLN B 75 ? O GLN B 728 B 1 2 O TYR A 48 ? O TYR A 701 N ARG A 26 ? N ARG A 679 B 2 3 N LEU A 25 ? N LEU A 678 O THR C 3 ? O THR C 644 C 1 2 O GLU B 50 ? O GLU B 703 N VAL B 24 ? N VAL B 677 C 2 3 N LEU B 25 ? N LEU B 678 O THR D 3 ? O THR D 644 # _database_PDB_matrix.entry_id 3QJM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3QJM _atom_sites.fract_transf_matrix[1][1] 0.017354 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017354 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006942 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 654 ? ? ? A . n A 1 2 SER 2 655 ? ? ? A . n A 1 3 ASP 3 656 656 ASP ASP A . n A 1 4 TYR 4 657 657 TYR TYR A . n A 1 5 ILE 5 658 658 ILE ILE A . n A 1 6 ILE 6 659 659 ILE ILE A . n A 1 7 LYS 7 660 660 LYS LYS A . n A 1 8 GLU 8 661 661 GLU GLU A . n A 1 9 LYS 9 662 662 LYS LYS A . n A 1 10 THR 10 663 663 THR THR A . n A 1 11 VAL 11 664 664 VAL VAL A . n A 1 12 LEU 12 665 665 LEU LEU A . n A 1 13 LEU 13 666 666 LEU LEU A . n A 1 14 GLN 14 667 667 GLN GLN A . n A 1 15 LYS 15 668 668 LYS LYS A . n A 1 16 LYS 16 669 669 LYS LYS A . n A 1 17 ASP 17 670 670 ASP ASP A . n A 1 18 SER 18 671 671 SER SER A . n A 1 19 GLU 19 672 672 GLU GLU A . n A 1 20 GLY 20 673 673 GLY GLY A . n A 1 21 PHE 21 674 674 PHE PHE A . n A 1 22 GLY 22 675 675 GLY GLY A . n A 1 23 PHE 23 676 676 PHE PHE A . n A 1 24 VAL 24 677 677 VAL VAL A . n A 1 25 LEU 25 678 678 LEU LEU A . n A 1 26 ARG 26 679 679 ARG ARG A . n A 1 27 GLY 27 680 680 GLY GLY A . n A 1 28 ALA 28 681 681 ALA ALA A . n A 1 29 LYS 29 682 ? ? ? A . n A 1 30 ALA 30 683 ? ? ? A . n A 1 31 GLN 31 684 ? ? ? A . n A 1 32 THR 32 685 ? ? ? A . n A 1 33 PRO 33 686 ? ? ? A . n A 1 34 ILE 34 687 687 ILE ILE A . n A 1 35 GLU 35 688 688 GLU ALA A . n A 1 36 GLU 36 689 689 GLU GLU A . n A 1 37 PHE 37 690 690 PHE PHE A . n A 1 38 THR 38 691 691 THR THR A . n A 1 39 PRO 39 692 692 PRO PRO A . n A 1 40 THR 40 693 693 THR THR A . n A 1 41 PRO 41 694 694 PRO PRO A . n A 1 42 ALA 42 695 695 ALA ALA A . n A 1 43 PHE 43 696 696 PHE PHE A . n A 1 44 PRO 44 697 697 PRO PRO A . n A 1 45 ALA 45 698 698 ALA ALA A . n A 1 46 LEU 46 699 699 LEU LEU A . n A 1 47 GLN 47 700 700 GLN GLN A . n A 1 48 TYR 48 701 701 TYR TYR A . n A 1 49 LEU 49 702 702 LEU LEU A . n A 1 50 GLU 50 703 703 GLU GLU A . n A 1 51 SER 51 704 704 SER SER A . n A 1 52 VAL 52 705 705 VAL VAL A . n A 1 53 ASP 53 706 706 ASP ASP A . n A 1 54 GLU 54 707 707 GLU GLU A . n A 1 55 GLY 55 708 708 GLY GLY A . n A 1 56 GLY 56 709 709 GLY GLY A . n A 1 57 VAL 57 710 710 VAL VAL A . n A 1 58 ALA 58 711 711 ALA ALA A . n A 1 59 TRP 59 712 712 TRP TRP A . n A 1 60 ARG 60 713 713 ARG ARG A . n A 1 61 ALA 61 714 714 ALA ALA A . n A 1 62 GLY 62 715 715 GLY GLY A . n A 1 63 LEU 63 716 716 LEU LEU A . n A 1 64 ARG 64 717 717 ARG ARG A . n A 1 65 MET 65 718 718 MET MET A . n A 1 66 GLY 66 719 719 GLY GLY A . n A 1 67 ASP 67 720 720 ASP ASP A . n A 1 68 PHE 68 721 721 PHE PHE A . n A 1 69 LEU 69 722 722 LEU LEU A . n A 1 70 ILE 70 723 723 ILE ILE A . n A 1 71 GLU 71 724 724 GLU GLU A . n A 1 72 VAL 72 725 725 VAL VAL A . n A 1 73 ASN 73 726 726 ASN ASN A . n A 1 74 GLY 74 727 727 GLY GLY A . n A 1 75 GLN 75 728 728 GLN GLN A . n A 1 76 ASN 76 729 729 ASN ASN A . n A 1 77 VAL 77 730 730 VAL VAL A . n A 1 78 VAL 78 731 731 VAL VAL A . n A 1 79 LYS 79 732 732 LYS LYS A . n A 1 80 VAL 80 733 733 VAL VAL A . n A 1 81 GLY 81 734 734 GLY GLY A . n A 1 82 HIS 82 735 735 HIS HIS A . n A 1 83 ARG 83 736 736 ARG ARG A . n A 1 84 GLN 84 737 737 GLN GLN A . n A 1 85 VAL 85 738 738 VAL VAL A . n A 1 86 VAL 86 739 739 VAL VAL A . n A 1 87 ASN 87 740 740 ASN ASN A . n A 1 88 MET 88 741 741 MET MET A . n A 1 89 ILE 89 742 742 ILE ILE A . n A 1 90 ARG 90 743 743 ARG ARG A . n A 1 91 GLN 91 744 744 GLN GLN A . n A 1 92 GLY 92 745 745 GLY GLY A . n A 1 93 GLY 93 746 746 GLY GLY A . n A 1 94 ASN 94 747 747 ASN ASN A . n A 1 95 THR 95 748 748 THR THR A . n A 1 96 LEU 96 749 749 LEU LEU A . n A 1 97 MET 97 750 750 MET MET A . n A 1 98 VAL 98 751 751 VAL VAL A . n A 1 99 LYS 99 752 752 LYS LYS A . n A 1 100 VAL 100 753 753 VAL VAL A . n A 1 101 VAL 101 754 754 VAL VAL A . n A 1 102 MET 102 755 755 MET MET A . n A 1 103 VAL 103 756 756 VAL VAL A . n A 1 104 THR 104 757 757 THR THR A . n A 1 105 ARG 105 758 758 ARG ARG A . n A 1 106 HIS 106 759 ? ? ? A . n A 1 107 PRO 107 760 ? ? ? A . n A 1 108 ASP 108 761 ? ? ? A . n A 1 109 MET 109 762 ? ? ? A . n A 1 110 ASP 110 763 ? ? ? A . n A 1 111 GLU 111 764 ? ? ? A . n A 1 112 ALA 112 765 ? ? ? A . n A 1 113 VAL 113 766 ? ? ? A . n A 1 114 HIS 114 767 ? ? ? A . n A 1 115 LYS 115 768 ? ? ? A . n B 1 1 GLY 1 654 654 GLY GLY B . n B 1 2 SER 2 655 655 SER SER B . n B 1 3 ASP 3 656 656 ASP ASP B . n B 1 4 TYR 4 657 657 TYR TYR B . n B 1 5 ILE 5 658 658 ILE ILE B . n B 1 6 ILE 6 659 659 ILE ILE B . n B 1 7 LYS 7 660 660 LYS LYS B . n B 1 8 GLU 8 661 661 GLU GLU B . n B 1 9 LYS 9 662 662 LYS LYS B . n B 1 10 THR 10 663 663 THR THR B . n B 1 11 VAL 11 664 664 VAL VAL B . n B 1 12 LEU 12 665 665 LEU LEU B . n B 1 13 LEU 13 666 666 LEU LEU B . n B 1 14 GLN 14 667 667 GLN GLN B . n B 1 15 LYS 15 668 668 LYS LYS B . n B 1 16 LYS 16 669 669 LYS LYS B . n B 1 17 ASP 17 670 670 ASP ASP B . n B 1 18 SER 18 671 671 SER SER B . n B 1 19 GLU 19 672 672 GLU GLU B . n B 1 20 GLY 20 673 673 GLY GLY B . n B 1 21 PHE 21 674 674 PHE PHE B . n B 1 22 GLY 22 675 675 GLY GLY B . n B 1 23 PHE 23 676 676 PHE PHE B . n B 1 24 VAL 24 677 677 VAL VAL B . n B 1 25 LEU 25 678 678 LEU LEU B . n B 1 26 ARG 26 679 679 ARG ARG B . n B 1 27 GLY 27 680 680 GLY GLY B . n B 1 28 ALA 28 681 681 ALA ALA B . n B 1 29 LYS 29 682 ? ? ? B . n B 1 30 ALA 30 683 ? ? ? B . n B 1 31 GLN 31 684 ? ? ? B . n B 1 32 THR 32 685 ? ? ? B . n B 1 33 PRO 33 686 ? ? ? B . n B 1 34 ILE 34 687 ? ? ? B . n B 1 35 GLU 35 688 ? ? ? B . n B 1 36 GLU 36 689 689 GLU GLU B . n B 1 37 PHE 37 690 690 PHE PHE B . n B 1 38 THR 38 691 691 THR THR B . n B 1 39 PRO 39 692 692 PRO PRO B . n B 1 40 THR 40 693 693 THR THR B . n B 1 41 PRO 41 694 694 PRO PRO B . n B 1 42 ALA 42 695 695 ALA ALA B . n B 1 43 PHE 43 696 696 PHE PHE B . n B 1 44 PRO 44 697 697 PRO PRO B . n B 1 45 ALA 45 698 698 ALA ALA B . n B 1 46 LEU 46 699 699 LEU LEU B . n B 1 47 GLN 47 700 700 GLN GLN B . n B 1 48 TYR 48 701 701 TYR TYR B . n B 1 49 LEU 49 702 702 LEU LEU B . n B 1 50 GLU 50 703 703 GLU GLU B . n B 1 51 SER 51 704 704 SER SER B . n B 1 52 VAL 52 705 705 VAL VAL B . n B 1 53 ASP 53 706 706 ASP ASP B . n B 1 54 GLU 54 707 707 GLU GLU B . n B 1 55 GLY 55 708 708 GLY GLY B . n B 1 56 GLY 56 709 709 GLY GLY B . n B 1 57 VAL 57 710 710 VAL VAL B . n B 1 58 ALA 58 711 711 ALA ALA B . n B 1 59 TRP 59 712 712 TRP TRP B . n B 1 60 ARG 60 713 713 ARG ARG B . n B 1 61 ALA 61 714 714 ALA ALA B . n B 1 62 GLY 62 715 715 GLY GLY B . n B 1 63 LEU 63 716 716 LEU LEU B . n B 1 64 ARG 64 717 717 ARG ARG B . n B 1 65 MET 65 718 718 MET MET B . n B 1 66 GLY 66 719 719 GLY GLY B . n B 1 67 ASP 67 720 720 ASP ASP B . n B 1 68 PHE 68 721 721 PHE PHE B . n B 1 69 LEU 69 722 722 LEU LEU B . n B 1 70 ILE 70 723 723 ILE ILE B . n B 1 71 GLU 71 724 724 GLU GLU B . n B 1 72 VAL 72 725 725 VAL VAL B . n B 1 73 ASN 73 726 726 ASN ASN B . n B 1 74 GLY 74 727 727 GLY GLY B . n B 1 75 GLN 75 728 728 GLN GLN B . n B 1 76 ASN 76 729 729 ASN ASN B . n B 1 77 VAL 77 730 730 VAL VAL B . n B 1 78 VAL 78 731 731 VAL VAL B . n B 1 79 LYS 79 732 732 LYS LYS B . n B 1 80 VAL 80 733 733 VAL VAL B . n B 1 81 GLY 81 734 734 GLY GLY B . n B 1 82 HIS 82 735 735 HIS HIS B . n B 1 83 ARG 83 736 736 ARG ARG B . n B 1 84 GLN 84 737 737 GLN GLN B . n B 1 85 VAL 85 738 738 VAL VAL B . n B 1 86 VAL 86 739 739 VAL VAL B . n B 1 87 ASN 87 740 740 ASN ASN B . n B 1 88 MET 88 741 741 MET MET B . n B 1 89 ILE 89 742 742 ILE ILE B . n B 1 90 ARG 90 743 743 ARG ARG B . n B 1 91 GLN 91 744 744 GLN GLN B . n B 1 92 GLY 92 745 745 GLY GLY B . n B 1 93 GLY 93 746 746 GLY GLY B . n B 1 94 ASN 94 747 747 ASN ASN B . n B 1 95 THR 95 748 748 THR THR B . n B 1 96 LEU 96 749 749 LEU LEU B . n B 1 97 MET 97 750 750 MET MET B . n B 1 98 VAL 98 751 751 VAL VAL B . n B 1 99 LYS 99 752 752 LYS LYS B . n B 1 100 VAL 100 753 753 VAL VAL B . n B 1 101 VAL 101 754 754 VAL VAL B . n B 1 102 MET 102 755 755 MET MET B . n B 1 103 VAL 103 756 756 VAL VAL B . n B 1 104 THR 104 757 757 THR THR B . n B 1 105 ARG 105 758 758 ARG ARG B . n B 1 106 HIS 106 759 ? ? ? B . n B 1 107 PRO 107 760 ? ? ? B . n B 1 108 ASP 108 761 ? ? ? B . n B 1 109 MET 109 762 ? ? ? B . n B 1 110 ASP 110 763 ? ? ? B . n B 1 111 GLU 111 764 ? ? ? B . n B 1 112 ALA 112 765 ? ? ? B . n B 1 113 VAL 113 766 ? ? ? B . n B 1 114 HIS 114 767 ? ? ? B . n B 1 115 LYS 115 768 ? ? ? B . n C 2 1 ASP 1 642 642 ASP ASP C . n C 2 2 GLU 2 643 643 GLU GLU C . n C 2 3 THR 3 644 644 THR THR C . n C 2 4 ASN 4 645 645 ASN ASN C . n C 2 5 LEU 5 646 646 LEU LEU C . n D 2 1 ASP 1 642 642 ASP ASP D . n D 2 2 GLU 2 643 643 GLU GLU D . n D 2 3 THR 3 644 644 THR THR D . n D 2 4 ASN 4 645 645 ASN ASN D . n D 2 5 LEU 5 646 646 LEU LEU D . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,E,G 2 1 B,D,F,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 780 ? 1 MORE -3 ? 1 'SSA (A^2)' 6030 ? 2 'ABSA (A^2)' 790 ? 2 MORE -3 ? 2 'SSA (A^2)' 6240 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id B _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 60 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-04-13 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing . ? 2 PHENIX refinement '(phenix.refine: 1.6.1_357)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O B ARG 758 ? ? O B HOH 32 ? ? 2.10 2 1 O A HOH 55 ? ? O A HOH 58 ? ? 2.18 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 688 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 173.57 _pdbx_validate_torsion.psi 11.68 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 688 ? CG ? A GLU 35 CG 2 1 Y 1 A GLU 688 ? CD ? A GLU 35 CD 3 1 Y 1 A GLU 688 ? OE1 ? A GLU 35 OE1 4 1 Y 1 A GLU 688 ? OE2 ? A GLU 35 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 654 ? A GLY 1 2 1 Y 1 A SER 655 ? A SER 2 3 1 Y 1 A LYS 682 ? A LYS 29 4 1 Y 1 A ALA 683 ? A ALA 30 5 1 Y 1 A GLN 684 ? A GLN 31 6 1 Y 1 A THR 685 ? A THR 32 7 1 Y 1 A PRO 686 ? A PRO 33 8 1 Y 1 A HIS 759 ? A HIS 106 9 1 Y 1 A PRO 760 ? A PRO 107 10 1 Y 1 A ASP 761 ? A ASP 108 11 1 Y 1 A MET 762 ? A MET 109 12 1 Y 1 A ASP 763 ? A ASP 110 13 1 Y 1 A GLU 764 ? A GLU 111 14 1 Y 1 A ALA 765 ? A ALA 112 15 1 Y 1 A VAL 766 ? A VAL 113 16 1 Y 1 A HIS 767 ? A HIS 114 17 1 Y 1 A LYS 768 ? A LYS 115 18 1 Y 1 B LYS 682 ? B LYS 29 19 1 Y 1 B ALA 683 ? B ALA 30 20 1 Y 1 B GLN 684 ? B GLN 31 21 1 Y 1 B THR 685 ? B THR 32 22 1 Y 1 B PRO 686 ? B PRO 33 23 1 Y 1 B ILE 687 ? B ILE 34 24 1 Y 1 B GLU 688 ? B GLU 35 25 1 Y 1 B HIS 759 ? B HIS 106 26 1 Y 1 B PRO 760 ? B PRO 107 27 1 Y 1 B ASP 761 ? B ASP 108 28 1 Y 1 B MET 762 ? B MET 109 29 1 Y 1 B ASP 763 ? B ASP 110 30 1 Y 1 B GLU 764 ? B GLU 111 31 1 Y 1 B ALA 765 ? B ALA 112 32 1 Y 1 B VAL 766 ? B VAL 113 33 1 Y 1 B HIS 767 ? B HIS 114 34 1 Y 1 B LYS 768 ? B LYS 115 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 HOH 1 1 1 HOH HOH A . E 3 HOH 2 3 3 HOH HOH A . E 3 HOH 3 11 11 HOH HOH A . E 3 HOH 4 13 13 HOH HOH A . E 3 HOH 5 14 14 HOH HOH A . E 3 HOH 6 19 19 HOH HOH A . E 3 HOH 7 22 22 HOH HOH A . E 3 HOH 8 23 23 HOH HOH A . E 3 HOH 9 36 36 HOH HOH A . E 3 HOH 10 37 37 HOH HOH A . E 3 HOH 11 38 38 HOH HOH A . E 3 HOH 12 40 40 HOH HOH A . E 3 HOH 13 42 42 HOH HOH A . E 3 HOH 14 44 44 HOH HOH A . E 3 HOH 15 47 47 HOH HOH A . E 3 HOH 16 49 49 HOH HOH A . E 3 HOH 17 52 52 HOH HOH A . E 3 HOH 18 55 55 HOH HOH A . E 3 HOH 19 58 58 HOH HOH A . E 3 HOH 20 59 59 HOH HOH A . E 3 HOH 21 63 63 HOH HOH A . E 3 HOH 22 65 65 HOH HOH A . E 3 HOH 23 68 68 HOH HOH A . E 3 HOH 24 69 69 HOH HOH A . E 3 HOH 25 72 72 HOH HOH A . E 3 HOH 26 73 73 HOH HOH A . E 3 HOH 27 76 76 HOH HOH A . F 3 HOH 1 2 2 HOH HOH B . F 3 HOH 2 4 4 HOH HOH B . F 3 HOH 3 6 6 HOH HOH B . F 3 HOH 4 7 7 HOH HOH B . F 3 HOH 5 8 8 HOH HOH B . F 3 HOH 6 9 9 HOH HOH B . F 3 HOH 7 10 10 HOH HOH B . F 3 HOH 8 12 12 HOH HOH B . F 3 HOH 9 15 15 HOH HOH B . F 3 HOH 10 16 16 HOH HOH B . F 3 HOH 11 17 17 HOH HOH B . F 3 HOH 12 18 18 HOH HOH B . F 3 HOH 13 20 20 HOH HOH B . F 3 HOH 14 21 21 HOH HOH B . F 3 HOH 15 24 24 HOH HOH B . F 3 HOH 16 25 25 HOH HOH B . F 3 HOH 17 26 26 HOH HOH B . F 3 HOH 18 27 27 HOH HOH B . F 3 HOH 19 28 28 HOH HOH B . F 3 HOH 20 29 29 HOH HOH B . F 3 HOH 21 30 30 HOH HOH B . F 3 HOH 22 31 31 HOH HOH B . F 3 HOH 23 32 32 HOH HOH B . F 3 HOH 24 33 33 HOH HOH B . F 3 HOH 25 34 34 HOH HOH B . F 3 HOH 26 35 35 HOH HOH B . F 3 HOH 27 39 39 HOH HOH B . F 3 HOH 28 41 41 HOH HOH B . F 3 HOH 29 43 43 HOH HOH B . F 3 HOH 30 45 45 HOH HOH B . F 3 HOH 31 46 46 HOH HOH B . F 3 HOH 32 48 48 HOH HOH B . F 3 HOH 33 50 50 HOH HOH B . F 3 HOH 34 51 51 HOH HOH B . F 3 HOH 35 53 53 HOH HOH B . F 3 HOH 36 54 54 HOH HOH B . F 3 HOH 37 57 57 HOH HOH B . F 3 HOH 38 60 60 HOH HOH B . F 3 HOH 39 61 61 HOH HOH B . F 3 HOH 40 62 62 HOH HOH B . F 3 HOH 41 66 66 HOH HOH B . F 3 HOH 42 70 70 HOH HOH B . F 3 HOH 43 71 71 HOH HOH B . F 3 HOH 44 74 74 HOH HOH B . F 3 HOH 45 75 75 HOH HOH B . F 3 HOH 46 77 77 HOH HOH B . F 3 HOH 47 78 78 HOH HOH B . F 3 HOH 48 79 79 HOH HOH B . F 3 HOH 49 80 80 HOH HOH B . G 3 HOH 1 5 5 HOH HOH C . G 3 HOH 2 56 56 HOH HOH C . H 3 HOH 1 64 64 HOH HOH D . H 3 HOH 2 67 67 HOH HOH D . #