data_3QON # _entry.id 3QON # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3QON RCSB RCSB063908 WWPDB D_1000063908 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2017-09-06 _pdbx_database_PDB_obs_spr.pdb_id 6AMF _pdbx_database_PDB_obs_spr.replace_pdb_id 3QON _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3BDC 'Staphylococcal nuclease variant D+PHS' unspecified PDB 3NHH 'Staphylococcal nuclease variant D+PHS/V23E/L36K' unspecified PDB 3QOJ 'Staphylococcal nuclease variant D+PHS/V23K' unspecified # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 3QON _pdbx_database_status.recvd_initial_deposition_date 2011-02-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Robinson, A.' 1 'Schlessman, J.L.' 2 'Garcia-Moreno, E.B.' 3 # _citation.id primary _citation.title 'Reversal of an internal ion pair in the hydrophobic interior of Staphylococcal nuclease' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Garcia-Morenoe, E.B.' 1 primary 'Robinson, A.' 2 primary 'Schlessman, J.L.' 3 primary 'Heroux, A.' 4 # _cell.entry_id 3QON _cell.length_a 31.137 _cell.length_b 60.263 _cell.length_c 38.288 _cell.angle_alpha 90.00 _cell.angle_beta 94.33 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3QON _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Thermonuclease 16189.471 1 3.1.31.1 V23K,L36E,G50F,V51N,P117G,H124L,S128A 'DELETION UNP RESIDUES 126-131' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn "THYMIDINE-3',5'-DIPHOSPHATE" 402.188 1 ? ? ? ? 4 water nat water 18.015 95 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TNase, Micrococcal nuclease, Staphylococcal nuclease, Nuclease B, Nuclease A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDTKKLMYKGQPMTFRELLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYG RGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_seq_one_letter_code_can ;ATSTKKLHKEPATLIKAIDGDTKKLMYKGQPMTFRELLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYG RGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 SER n 1 4 THR n 1 5 LYS n 1 6 LYS n 1 7 LEU n 1 8 HIS n 1 9 LYS n 1 10 GLU n 1 11 PRO n 1 12 ALA n 1 13 THR n 1 14 LEU n 1 15 ILE n 1 16 LYS n 1 17 ALA n 1 18 ILE n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 THR n 1 23 LYS n 1 24 LYS n 1 25 LEU n 1 26 MET n 1 27 TYR n 1 28 LYS n 1 29 GLY n 1 30 GLN n 1 31 PRO n 1 32 MET n 1 33 THR n 1 34 PHE n 1 35 ARG n 1 36 GLU n 1 37 LEU n 1 38 LEU n 1 39 VAL n 1 40 ASP n 1 41 THR n 1 42 PRO n 1 43 GLU n 1 44 PHE n 1 45 ASN n 1 46 GLU n 1 47 LYS n 1 48 TYR n 1 49 GLY n 1 50 PRO n 1 51 GLU n 1 52 ALA n 1 53 SER n 1 54 ALA n 1 55 PHE n 1 56 THR n 1 57 LYS n 1 58 LYS n 1 59 MET n 1 60 VAL n 1 61 GLU n 1 62 ASN n 1 63 ALA n 1 64 LYS n 1 65 LYS n 1 66 ILE n 1 67 GLU n 1 68 VAL n 1 69 GLU n 1 70 PHE n 1 71 ASP n 1 72 LYS n 1 73 GLY n 1 74 GLN n 1 75 ARG n 1 76 THR n 1 77 ASP n 1 78 LYS n 1 79 TYR n 1 80 GLY n 1 81 ARG n 1 82 GLY n 1 83 LEU n 1 84 ALA n 1 85 TYR n 1 86 ILE n 1 87 TYR n 1 88 ALA n 1 89 ASP n 1 90 GLY n 1 91 LYS n 1 92 MET n 1 93 VAL n 1 94 ASN n 1 95 GLU n 1 96 ALA n 1 97 LEU n 1 98 VAL n 1 99 ARG n 1 100 GLN n 1 101 GLY n 1 102 LEU n 1 103 ALA n 1 104 LYS n 1 105 VAL n 1 106 ALA n 1 107 TYR n 1 108 VAL n 1 109 TYR n 1 110 LYS n 1 111 GLY n 1 112 ASN n 1 113 ASN n 1 114 THR n 1 115 HIS n 1 116 GLU n 1 117 GLN n 1 118 LEU n 1 119 LEU n 1 120 ARG n 1 121 LYS n 1 122 ALA n 1 123 GLU n 1 124 ALA n 1 125 GLN n 1 126 ALA n 1 127 LYS n 1 128 LYS n 1 129 GLU n 1 130 LYS n 1 131 LEU n 1 132 ASN n 1 133 ILE n 1 134 TRP n 1 135 SER n 1 136 GLU n 1 137 ASP n 1 138 ASN n 1 139 ALA n 1 140 ASP n 1 141 SER n 1 142 GLY n 1 143 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene nuc _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET24a+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUC_STAAU _struct_ref.pdbx_db_accession P00644 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATSCLVLTLVVVSSLSSSANASQTDNGVNRSGSEDPTVYSATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVD TPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNT HEQHLRKSEAQAKKEKLNIWSEDNADSGQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3QON _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 143 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00644 _struct_ref_seq.db_align_beg 41 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3QON LYS A 23 ? UNP P00644 VAL 63 'ENGINEERED MUTATION' 23 1 1 3QON GLU A 36 ? UNP P00644 LEU 76 'ENGINEERED MUTATION' 36 2 1 3QON ? A ? ? UNP P00644 THR 84 DELETION ? 3 1 3QON ? A ? ? UNP P00644 LYS 85 DELETION ? 4 1 3QON ? A ? ? UNP P00644 HIS 86 DELETION ? 5 1 3QON ? A ? ? UNP P00644 PRO 87 DELETION ? 6 1 3QON ? A ? ? UNP P00644 LYS 88 DELETION ? 7 1 3QON ? A ? ? UNP P00644 LYS 89 DELETION ? 8 1 3QON PHE A 44 ? UNP P00644 GLY 90 'ENGINEERED MUTATION' 50 9 1 3QON ASN A 45 ? UNP P00644 VAL 91 'ENGINEERED MUTATION' 51 10 1 3QON GLY A 111 ? UNP P00644 PRO 157 'ENGINEERED MUTATION' 117 11 1 3QON LEU A 118 ? UNP P00644 HIS 164 'ENGINEERED MUTATION' 124 12 1 3QON ALA A 122 ? UNP P00644 SER 168 'ENGINEERED MUTATION' 128 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THP 'DNA linking' . "THYMIDINE-3',5'-DIPHOSPHATE" ? 'C10 H16 N2 O11 P2' 402.188 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3QON _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_percent_sol 44.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pdbx_details '25% MPD, 25 mM Potassium Phosphate, pdTp, CaCl2, pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'APEX II CCD' _diffrn_detector.pdbx_collection_date 2010-08-16 _diffrn_detector.details 'multi-layer optics' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GE111 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'SEALED TUBE' _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3QON _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 38.2 _reflns.d_resolution_high 2.0 _reflns.number_obs 9537 _reflns.number_all 9537 _reflns.percent_possible_obs 98.9 _reflns.pdbx_Rmerge_I_obs 0.0653 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 29.53 _reflns.B_iso_Wilson_estimate 23.8 _reflns.pdbx_redundancy 12.77 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.05 _reflns_shell.percent_possible_all 98.2 _reflns_shell.Rmerge_I_obs 0.2774 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 8.50 _reflns_shell.pdbx_redundancy 6.26 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1285 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3QON _refine.ls_number_reflns_obs 9083 _refine.ls_number_reflns_all 9083 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 38.18 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 99.07 _refine.ls_R_factor_obs 0.18690 _refine.ls_R_factor_all 0.18690 _refine.ls_R_factor_R_work 0.18466 _refine.ls_R_factor_R_free 0.23151 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 454 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.915 _refine.B_iso_mean 19.930 _refine.aniso_B[1][1] -0.03 _refine.aniso_B[2][2] 0.01 _refine.aniso_B[3][3] 0.03 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.02 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.169 _refine.overall_SU_ML 0.119 _refine.overall_SU_B 8.871 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1036 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 95 _refine_hist.number_atoms_total 1157 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 38.18 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 1080 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.664 2.004 ? 1451 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.697 5.000 ? 128 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 33.935 25.000 ? 48 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.208 15.000 ? 211 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 7.333 15.000 ? 5 'X-RAY DIFFRACTION' ? r_chiral_restr 0.127 0.200 ? 153 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.011 0.021 ? 785 'X-RAY DIFFRACTION' ? r_mcbond_it 1.258 1.500 ? 639 'X-RAY DIFFRACTION' ? r_mcangle_it 2.134 2.000 ? 1020 'X-RAY DIFFRACTION' ? r_scbond_it 3.497 3.000 ? 441 'X-RAY DIFFRACTION' ? r_scangle_it 5.234 4.500 ? 431 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.052 _refine_ls_shell.number_reflns_R_work 650 _refine_ls_shell.R_factor_R_work 0.220 _refine_ls_shell.percent_reflns_obs 95.30 _refine_ls_shell.R_factor_R_free 0.346 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 39 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3QON _struct.title 'Crystal structure of Staphylococcal nuclease variant D+PHS/V23K/L36E at pH 7 determined at 100 K' _struct.pdbx_descriptor 'Thermonuclease (E.C.3.1.31.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3QON _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Staphylococcal nuclease, ion pair, hyperstable, pdTp, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 48 ? ALA A 63 ? TYR A 54 ALA A 69 1 ? 16 HELX_P HELX_P2 2 VAL A 93 ? GLN A 100 ? VAL A 99 GLN A 106 1 ? 8 HELX_P HELX_P3 3 HIS A 115 ? GLU A 129 ? HIS A 121 GLU A 135 1 ? 15 HELX_P HELX_P4 4 LEU A 131 ? SER A 135 ? LEU A 137 SER A 141 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 150 A HOH 175 1_555 ? ? ? ? ? ? ? 2.751 ? metalc2 metalc ? ? A ASP 40 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 40 A CA 150 1_555 ? ? ? ? ? ? ? 2.832 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 150 A HOH 171 1_555 ? ? ? ? ? ? ? 2.843 ? metalc4 metalc ? ? A THR 41 O ? ? ? 1_555 B CA . CA ? ? A THR 41 A CA 150 1_555 ? ? ? ? ? ? ? 2.866 ? metalc5 metalc ? ? A GLU 43 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 43 A CA 150 1_555 ? ? ? ? ? ? ? 2.945 ? metalc6 metalc ? ? A ASP 21 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 21 A CA 150 1_555 ? ? ? ? ? ? ? 3.018 ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 C THP . O5P ? ? A CA 150 A THP 151 1_555 ? ? ? ? ? ? ? 3.183 ? metalc8 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 150 A HOH 254 1_555 ? ? ? ? ? ? ? 3.188 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 91 ? MET A 92 ? LYS A 97 MET A 98 A 2 GLY A 82 ? ALA A 88 ? GLY A 88 ALA A 94 A 3 ILE A 66 ? GLU A 69 ? ILE A 72 GLU A 75 A 4 GLU A 10 ? ALA A 17 ? GLU A 10 ALA A 17 A 5 THR A 22 ? TYR A 27 ? THR A 22 TYR A 27 A 6 GLN A 30 ? GLU A 36 ? GLN A 30 GLU A 36 A 7 GLY A 82 ? ALA A 88 ? GLY A 88 ALA A 94 B 1 VAL A 39 ? ASP A 40 ? VAL A 39 ASP A 40 B 2 LYS A 104 ? VAL A 105 ? LYS A 110 VAL A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 91 ? O LYS A 97 N ALA A 88 ? N ALA A 94 A 2 3 O TYR A 85 ? O TYR A 91 N GLU A 69 ? N GLU A 75 A 3 4 O VAL A 68 ? O VAL A 74 N GLU A 10 ? N GLU A 10 A 4 5 N LYS A 16 ? N LYS A 16 O LYS A 24 ? O LYS A 24 A 5 6 N LYS A 23 ? N LYS A 23 O PHE A 34 ? O PHE A 34 A 6 7 N THR A 33 ? N THR A 33 O GLY A 82 ? O GLY A 88 B 1 2 N ASP A 40 ? N ASP A 40 O LYS A 104 ? O LYS A 110 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 150' AC2 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE THP A 151' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASP A 21 ? ASP A 21 . ? 1_555 ? 2 AC1 7 ASP A 40 ? ASP A 40 . ? 1_555 ? 3 AC1 7 THR A 41 ? THR A 41 . ? 1_555 ? 4 AC1 7 GLU A 43 ? GLU A 43 . ? 1_555 ? 5 AC1 7 THP C . ? THP A 151 . ? 1_555 ? 6 AC1 7 HOH D . ? HOH A 171 . ? 1_555 ? 7 AC1 7 HOH D . ? HOH A 175 . ? 1_555 ? 8 AC2 19 ARG A 35 ? ARG A 35 . ? 1_555 ? 9 AC2 19 ASP A 40 ? ASP A 40 . ? 1_555 ? 10 AC2 19 LYS A 78 ? LYS A 84 . ? 1_555 ? 11 AC2 19 TYR A 79 ? TYR A 85 . ? 1_555 ? 12 AC2 19 ARG A 81 ? ARG A 87 . ? 1_555 ? 13 AC2 19 LEU A 83 ? LEU A 89 . ? 1_555 ? 14 AC2 19 TYR A 107 ? TYR A 113 . ? 1_555 ? 15 AC2 19 TYR A 109 ? TYR A 115 . ? 1_555 ? 16 AC2 19 LYS A 121 ? LYS A 127 . ? 1_655 ? 17 AC2 19 CA B . ? CA A 150 . ? 1_555 ? 18 AC2 19 HOH D . ? HOH A 158 . ? 1_555 ? 19 AC2 19 HOH D . ? HOH A 171 . ? 1_555 ? 20 AC2 19 HOH D . ? HOH A 176 . ? 1_555 ? 21 AC2 19 HOH D . ? HOH A 188 . ? 1_555 ? 22 AC2 19 HOH D . ? HOH A 203 . ? 1_555 ? 23 AC2 19 HOH D . ? HOH A 209 . ? 1_555 ? 24 AC2 19 HOH D . ? HOH A 213 . ? 1_555 ? 25 AC2 19 HOH D . ? HOH A 249 . ? 1_555 ? 26 AC2 19 HOH D . ? HOH A 262 . ? 1_555 ? # _database_PDB_matrix.entry_id 3QON _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3QON _atom_sites.fract_transf_matrix[1][1] 0.032116 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002430 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016594 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026192 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PHE 44 50 50 PHE PHE A . n A 1 45 ASN 45 51 51 ASN ASN A . n A 1 46 GLU 46 52 52 GLU GLU A . n A 1 47 LYS 47 53 53 LYS LYS A . n A 1 48 TYR 48 54 54 TYR TYR A . n A 1 49 GLY 49 55 55 GLY GLY A . n A 1 50 PRO 50 56 56 PRO PRO A . n A 1 51 GLU 51 57 57 GLU GLU A . n A 1 52 ALA 52 58 58 ALA ALA A . n A 1 53 SER 53 59 59 SER SER A . n A 1 54 ALA 54 60 60 ALA ALA A . n A 1 55 PHE 55 61 61 PHE PHE A . n A 1 56 THR 56 62 62 THR THR A . n A 1 57 LYS 57 63 63 LYS LYS A . n A 1 58 LYS 58 64 64 LYS LYS A . n A 1 59 MET 59 65 65 MET MET A . n A 1 60 VAL 60 66 66 VAL VAL A . n A 1 61 GLU 61 67 67 GLU GLU A . n A 1 62 ASN 62 68 68 ASN ASN A . n A 1 63 ALA 63 69 69 ALA ALA A . n A 1 64 LYS 64 70 70 LYS LYS A . n A 1 65 LYS 65 71 71 LYS LYS A . n A 1 66 ILE 66 72 72 ILE ILE A . n A 1 67 GLU 67 73 73 GLU GLU A . n A 1 68 VAL 68 74 74 VAL VAL A . n A 1 69 GLU 69 75 75 GLU GLU A . n A 1 70 PHE 70 76 76 PHE PHE A . n A 1 71 ASP 71 77 77 ASP ASP A . n A 1 72 LYS 72 78 78 LYS LYS A . n A 1 73 GLY 73 79 79 GLY GLY A . n A 1 74 GLN 74 80 80 GLN GLN A . n A 1 75 ARG 75 81 81 ARG ARG A . n A 1 76 THR 76 82 82 THR THR A . n A 1 77 ASP 77 83 83 ASP ASP A . n A 1 78 LYS 78 84 84 LYS LYS A . n A 1 79 TYR 79 85 85 TYR TYR A . n A 1 80 GLY 80 86 86 GLY GLY A . n A 1 81 ARG 81 87 87 ARG ARG A . n A 1 82 GLY 82 88 88 GLY GLY A . n A 1 83 LEU 83 89 89 LEU LEU A . n A 1 84 ALA 84 90 90 ALA ALA A . n A 1 85 TYR 85 91 91 TYR TYR A . n A 1 86 ILE 86 92 92 ILE ILE A . n A 1 87 TYR 87 93 93 TYR TYR A . n A 1 88 ALA 88 94 94 ALA ALA A . n A 1 89 ASP 89 95 95 ASP ASP A . n A 1 90 GLY 90 96 96 GLY GLY A . n A 1 91 LYS 91 97 97 LYS LYS A . n A 1 92 MET 92 98 98 MET MET A . n A 1 93 VAL 93 99 99 VAL VAL A . n A 1 94 ASN 94 100 100 ASN ASN A . n A 1 95 GLU 95 101 101 GLU GLU A . n A 1 96 ALA 96 102 102 ALA ALA A . n A 1 97 LEU 97 103 103 LEU LEU A . n A 1 98 VAL 98 104 104 VAL VAL A . n A 1 99 ARG 99 105 105 ARG ARG A . n A 1 100 GLN 100 106 106 GLN GLN A . n A 1 101 GLY 101 107 107 GLY GLY A . n A 1 102 LEU 102 108 108 LEU LEU A . n A 1 103 ALA 103 109 109 ALA ALA A . n A 1 104 LYS 104 110 110 LYS LYS A . n A 1 105 VAL 105 111 111 VAL VAL A . n A 1 106 ALA 106 112 112 ALA ALA A . n A 1 107 TYR 107 113 113 TYR TYR A . n A 1 108 VAL 108 114 114 VAL VAL A . n A 1 109 TYR 109 115 115 TYR TYR A . n A 1 110 LYS 110 116 116 LYS LYS A . n A 1 111 GLY 111 117 117 GLY GLY A . n A 1 112 ASN 112 118 118 ASN ASN A . n A 1 113 ASN 113 119 119 ASN ASN A . n A 1 114 THR 114 120 120 THR THR A . n A 1 115 HIS 115 121 121 HIS HIS A . n A 1 116 GLU 116 122 122 GLU GLU A . n A 1 117 GLN 117 123 123 GLN GLN A . n A 1 118 LEU 118 124 124 LEU LEU A . n A 1 119 LEU 119 125 125 LEU LEU A . n A 1 120 ARG 120 126 126 ARG ARG A . n A 1 121 LYS 121 127 127 LYS LYS A . n A 1 122 ALA 122 128 128 ALA ALA A . n A 1 123 GLU 123 129 129 GLU GLU A . n A 1 124 ALA 124 130 130 ALA ALA A . n A 1 125 GLN 125 131 131 GLN GLN A . n A 1 126 ALA 126 132 132 ALA ALA A . n A 1 127 LYS 127 133 133 LYS LYS A . n A 1 128 LYS 128 134 134 LYS LYS A . n A 1 129 GLU 129 135 135 GLU GLU A . n A 1 130 LYS 130 136 136 LYS LYS A . n A 1 131 LEU 131 137 137 LEU LEU A . n A 1 132 ASN 132 138 138 ASN ASN A . n A 1 133 ILE 133 139 139 ILE ILE A . n A 1 134 TRP 134 140 140 TRP TRP A . n A 1 135 SER 135 141 141 SER SER A . n A 1 136 GLU 136 142 ? ? ? A . n A 1 137 ASP 137 143 ? ? ? A . n A 1 138 ASN 138 144 ? ? ? A . n A 1 139 ALA 139 145 ? ? ? A . n A 1 140 ASP 140 146 ? ? ? A . n A 1 141 SER 141 147 ? ? ? A . n A 1 142 GLY 142 148 ? ? ? A . n A 1 143 GLN 143 149 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 150 1 CA CA A . C 3 THP 1 151 142 THP THP A . D 4 HOH 1 152 9 HOH HOH A . D 4 HOH 2 153 10 HOH HOH A . D 4 HOH 3 154 11 HOH HOH A . D 4 HOH 4 155 12 HOH HOH A . D 4 HOH 5 156 13 HOH HOH A . D 4 HOH 6 157 14 HOH HOH A . D 4 HOH 7 158 15 HOH HOH A . D 4 HOH 8 159 16 HOH HOH A . D 4 HOH 9 160 17 HOH HOH A . D 4 HOH 10 161 18 HOH HOH A . D 4 HOH 11 162 19 HOH HOH A . D 4 HOH 12 163 20 HOH HOH A . D 4 HOH 13 164 21 HOH HOH A . D 4 HOH 14 165 1 HOH HOH A . D 4 HOH 15 166 23 HOH HOH A . D 4 HOH 16 167 24 HOH HOH A . D 4 HOH 17 168 25 HOH HOH A . D 4 HOH 18 169 26 HOH HOH A . D 4 HOH 19 170 27 HOH HOH A . D 4 HOH 20 171 28 HOH HOH A . D 4 HOH 21 172 29 HOH HOH A . D 4 HOH 22 173 30 HOH HOH A . D 4 HOH 23 174 31 HOH HOH A . D 4 HOH 24 175 32 HOH HOH A . D 4 HOH 25 176 2 HOH HOH A . D 4 HOH 26 177 34 HOH HOH A . D 4 HOH 27 178 35 HOH HOH A . D 4 HOH 28 179 36 HOH HOH A . D 4 HOH 29 180 37 HOH HOH A . D 4 HOH 30 181 3 HOH HOH A . D 4 HOH 31 182 39 HOH HOH A . D 4 HOH 32 183 40 HOH HOH A . D 4 HOH 33 184 4 HOH HOH A . D 4 HOH 34 185 42 HOH HOH A . D 4 HOH 35 186 5 HOH HOH A . D 4 HOH 36 187 6 HOH HOH A . D 4 HOH 37 188 7 HOH HOH A . D 4 HOH 38 189 46 HOH HOH A . D 4 HOH 39 190 47 HOH HOH A . D 4 HOH 40 191 8 HOH HOH A . D 4 HOH 41 193 50 HOH HOH A . D 4 HOH 42 194 51 HOH HOH A . D 4 HOH 43 195 52 HOH HOH A . D 4 HOH 44 196 53 HOH HOH A . D 4 HOH 45 198 55 HOH HOH A . D 4 HOH 46 199 56 HOH HOH A . D 4 HOH 47 200 57 HOH HOH A . D 4 HOH 48 202 59 HOH HOH A . D 4 HOH 49 203 60 HOH HOH A . D 4 HOH 50 204 61 HOH HOH A . D 4 HOH 51 205 62 HOH HOH A . D 4 HOH 52 206 63 HOH HOH A . D 4 HOH 53 207 64 HOH HOH A . D 4 HOH 54 208 65 HOH HOH A . D 4 HOH 55 209 66 HOH HOH A . D 4 HOH 56 210 67 HOH HOH A . D 4 HOH 57 211 68 HOH HOH A . D 4 HOH 58 212 69 HOH HOH A . D 4 HOH 59 213 70 HOH HOH A . D 4 HOH 60 216 73 HOH HOH A . D 4 HOH 61 217 74 HOH HOH A . D 4 HOH 62 218 75 HOH HOH A . D 4 HOH 63 220 77 HOH HOH A . D 4 HOH 64 222 79 HOH HOH A . D 4 HOH 65 226 83 HOH HOH A . D 4 HOH 66 227 84 HOH HOH A . D 4 HOH 67 228 85 HOH HOH A . D 4 HOH 68 229 86 HOH HOH A . D 4 HOH 69 231 88 HOH HOH A . D 4 HOH 70 232 89 HOH HOH A . D 4 HOH 71 236 93 HOH HOH A . D 4 HOH 72 238 95 HOH HOH A . D 4 HOH 73 241 98 HOH HOH A . D 4 HOH 74 242 99 HOH HOH A . D 4 HOH 75 243 100 HOH HOH A . D 4 HOH 76 246 103 HOH HOH A . D 4 HOH 77 249 106 HOH HOH A . D 4 HOH 78 250 107 HOH HOH A . D 4 HOH 79 251 108 HOH HOH A . D 4 HOH 80 252 109 HOH HOH A . D 4 HOH 81 253 110 HOH HOH A . D 4 HOH 82 254 111 HOH HOH A . D 4 HOH 83 255 112 HOH HOH A . D 4 HOH 84 256 113 HOH HOH A . D 4 HOH 85 257 114 HOH HOH A . D 4 HOH 86 258 115 HOH HOH A . D 4 HOH 87 261 118 HOH HOH A . D 4 HOH 88 262 119 HOH HOH A . D 4 HOH 89 263 120 HOH HOH A . D 4 HOH 90 264 121 HOH HOH A . D 4 HOH 91 265 122 HOH HOH A . D 4 HOH 92 267 124 HOH HOH A . D 4 HOH 93 271 128 HOH HOH A . D 4 HOH 94 273 130 HOH HOH A . D 4 HOH 95 280 137 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? D HOH . ? A HOH 175 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 140.3 ? 2 O ? D HOH . ? A HOH 175 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 171 ? 1_555 73.3 ? 3 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 171 ? 1_555 134.0 ? 4 O ? D HOH . ? A HOH 175 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 67.8 ? 5 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 76.3 ? 6 O ? D HOH . ? A HOH 171 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 139.3 ? 7 O ? D HOH . ? A HOH 175 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 79.2 ? 8 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 128.2 ? 9 O ? D HOH . ? A HOH 171 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 77.8 ? 10 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 105.5 ? 11 O ? D HOH . ? A HOH 175 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 80.2 ? 12 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 80.9 ? 13 O ? D HOH . ? A HOH 171 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 75.6 ? 14 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 86.3 ? 15 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 150.1 ? 16 O ? D HOH . ? A HOH 175 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O5P ? C THP . ? A THP 151 ? 1_555 150.5 ? 17 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O5P ? C THP . ? A THP 151 ? 1_555 65.3 ? 18 O ? D HOH . ? A HOH 171 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O5P ? C THP . ? A THP 151 ? 1_555 77.3 ? 19 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O5P ? C THP . ? A THP 151 ? 1_555 141.1 ? 20 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O5P ? C THP . ? A THP 151 ? 1_555 93.5 ? 21 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O5P ? C THP . ? A THP 151 ? 1_555 93.9 ? 22 O ? D HOH . ? A HOH 175 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 254 ? 1_555 110.4 ? 23 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 254 ? 1_555 56.0 ? 24 O ? D HOH . ? A HOH 171 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 254 ? 1_555 159.4 ? 25 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 254 ? 1_555 53.8 ? 26 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 254 ? 1_555 82.9 ? 27 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 254 ? 1_555 124.8 ? 28 O5P ? C THP . ? A THP 151 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 254 ? 1_555 96.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-03-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-09-06 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 3 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_PDB_obs_spr 2 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code' 2 3 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 13.0480 -3.8730 4.0410 0.0702 0.0634 0.0544 0.0351 -0.0080 0.0025 0.9274 2.4437 0.0827 -0.1224 0.2636 0.5557 -0.0438 -0.0501 -0.1056 0.1129 0.0251 -0.0874 0.0698 0.0097 0.0188 'X-RAY DIFFRACTION' 2 ? refined 16.6660 -3.5870 -0.0400 0.0818 0.0840 0.0509 0.0082 -0.0083 0.0087 0.9061 3.5698 0.1479 -0.8301 -0.2732 1.7313 -0.0149 0.0289 0.0896 -0.1975 0.2239 -0.3029 -0.0747 0.0512 -0.2090 'X-RAY DIFFRACTION' 3 ? refined 10.1460 2.9250 9.0040 0.0686 0.0851 -0.0044 0.0119 -0.0089 0.0159 1.2804 1.9364 0.6601 -0.5860 0.0848 0.3348 -0.1156 -0.1523 -0.0609 0.1588 0.1366 -0.0018 0.0082 0.0155 -0.0210 'X-RAY DIFFRACTION' 4 ? refined 12.0870 1.7200 0.0300 0.0699 0.0541 0.0574 -0.0297 0.0217 -0.0269 2.7817 1.9877 -0.3141 0.4436 -0.2107 -0.6038 -0.0935 0.1558 -0.1280 -0.0228 0.0674 -0.0248 0.0448 -0.0135 0.0261 'X-RAY DIFFRACTION' 5 ? refined 3.5240 10.2360 3.1220 0.0474 0.0581 0.0780 0.0000 -0.0129 0.0154 1.8790 1.8044 -0.1135 -0.8678 -0.3672 0.6935 -0.0337 0.0642 0.1050 0.0156 0.0146 0.2329 0.0119 0.0270 0.0192 'X-RAY DIFFRACTION' 6 ? refined -0.5850 15.6680 15.0630 0.0566 0.0309 0.1628 0.0460 0.1436 -0.0752 10.7288 3.0852 7.5853 3.4775 4.3164 0.3525 -0.1807 -0.0706 1.0781 0.6698 -0.1286 0.9054 0.0288 0.1149 0.3094 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 7 ? ? A 26 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 27 ? ? A 36 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 37 ? ? A 80 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 81 ? ? A 97 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 98 ? ? A 130 ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 131 ? ? A 141 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal APEX 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.5.0110 ? 3 SAINT 'data reduction' . ? 4 XPREP 'data reduction' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 18 ? ? -122.09 -74.52 2 1 LYS A 28 ? ? 39.92 39.41 3 1 TYR A 54 ? ? 74.78 -0.02 4 1 ASP A 77 ? ? -90.99 -159.59 5 1 ASN A 138 ? ? 48.46 -109.00 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A GLU 142 ? A GLU 136 8 1 Y 1 A ASP 143 ? A ASP 137 9 1 Y 1 A ASN 144 ? A ASN 138 10 1 Y 1 A ALA 145 ? A ALA 139 11 1 Y 1 A ASP 146 ? A ASP 140 12 1 Y 1 A SER 147 ? A SER 141 13 1 Y 1 A GLY 148 ? A GLY 142 14 1 Y 1 A GLN 149 ? A GLN 143 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 "THYMIDINE-3',5'-DIPHOSPHATE" THP 4 water HOH #