data_3QTJ # _entry.id 3QTJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3QTJ RCSB RCSB064084 WWPDB D_1000064084 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2011-12-14 _pdbx_database_PDB_obs_spr.pdb_id 3UQH _pdbx_database_PDB_obs_spr.replace_pdb_id 3QTJ _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 3QTJ _pdbx_database_status.recvd_initial_deposition_date 2011-02-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, H.' 1 'Wu, M.' 2 'Shi, C.' 3 'Zang, J.' 4 'Tian, C.' 5 # _citation.id primary _citation.title 'Crystal strcuture of ABA receptor PYL10' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wang, H.' 1 primary 'Wu, M.' 2 primary 'Shi, C.' 3 primary 'Zang, J.' 4 primary 'Tian, C.' 5 # _cell.entry_id 3QTJ _cell.length_a 80.466 _cell.length_b 80.466 _cell.length_c 124.929 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3QTJ _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Abscisic acid receptor PYL10' 21745.762 2 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ABI1-binding protein 8, PYR1-like protein 10, Regulatory components of ABA receptor 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLK SGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALI QCNLNSLADVTERLQAESMEKKILEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLK SGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALI QCNLNSLADVTERLQAESMEKKILEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 GLY n 1 4 ASP n 1 5 GLU n 1 6 THR n 1 7 LYS n 1 8 LYS n 1 9 VAL n 1 10 GLU n 1 11 SER n 1 12 GLU n 1 13 TYR n 1 14 ILE n 1 15 LYS n 1 16 LYS n 1 17 HIS n 1 18 HIS n 1 19 ARG n 1 20 HIS n 1 21 GLU n 1 22 LEU n 1 23 VAL n 1 24 GLU n 1 25 SER n 1 26 GLN n 1 27 CYS n 1 28 SER n 1 29 SER n 1 30 THR n 1 31 LEU n 1 32 VAL n 1 33 LYS n 1 34 HIS n 1 35 ILE n 1 36 LYS n 1 37 ALA n 1 38 PRO n 1 39 LEU n 1 40 HIS n 1 41 LEU n 1 42 VAL n 1 43 TRP n 1 44 SER n 1 45 ILE n 1 46 VAL n 1 47 ARG n 1 48 ARG n 1 49 PHE n 1 50 ASP n 1 51 GLU n 1 52 PRO n 1 53 GLN n 1 54 LYS n 1 55 TYR n 1 56 LYS n 1 57 PRO n 1 58 PHE n 1 59 ILE n 1 60 SER n 1 61 ARG n 1 62 CYS n 1 63 VAL n 1 64 VAL n 1 65 GLN n 1 66 GLY n 1 67 LYS n 1 68 LYS n 1 69 LEU n 1 70 GLU n 1 71 VAL n 1 72 GLY n 1 73 SER n 1 74 VAL n 1 75 ARG n 1 76 GLU n 1 77 VAL n 1 78 ASP n 1 79 LEU n 1 80 LYS n 1 81 SER n 1 82 GLY n 1 83 LEU n 1 84 PRO n 1 85 ALA n 1 86 THR n 1 87 LYS n 1 88 SER n 1 89 THR n 1 90 GLU n 1 91 VAL n 1 92 LEU n 1 93 GLU n 1 94 ILE n 1 95 LEU n 1 96 ASP n 1 97 ASP n 1 98 ASN n 1 99 GLU n 1 100 HIS n 1 101 ILE n 1 102 LEU n 1 103 GLY n 1 104 ILE n 1 105 ARG n 1 106 ILE n 1 107 VAL n 1 108 GLY n 1 109 GLY n 1 110 ASP n 1 111 HIS n 1 112 ARG n 1 113 LEU n 1 114 LYS n 1 115 ASN n 1 116 TYR n 1 117 SER n 1 118 SER n 1 119 THR n 1 120 ILE n 1 121 SER n 1 122 LEU n 1 123 HIS n 1 124 SER n 1 125 GLU n 1 126 THR n 1 127 ILE n 1 128 ASP n 1 129 GLY n 1 130 LYS n 1 131 THR n 1 132 GLY n 1 133 THR n 1 134 LEU n 1 135 ALA n 1 136 ILE n 1 137 GLU n 1 138 SER n 1 139 PHE n 1 140 VAL n 1 141 VAL n 1 142 ASP n 1 143 VAL n 1 144 PRO n 1 145 GLU n 1 146 GLY n 1 147 ASN n 1 148 THR n 1 149 LYS n 1 150 GLU n 1 151 GLU n 1 152 THR n 1 153 CYS n 1 154 PHE n 1 155 PHE n 1 156 VAL n 1 157 GLU n 1 158 ALA n 1 159 LEU n 1 160 ILE n 1 161 GLN n 1 162 CYS n 1 163 ASN n 1 164 LEU n 1 165 ASN n 1 166 SER n 1 167 LEU n 1 168 ALA n 1 169 ASP n 1 170 VAL n 1 171 THR n 1 172 GLU n 1 173 ARG n 1 174 LEU n 1 175 GLN n 1 176 ALA n 1 177 GLU n 1 178 SER n 1 179 MET n 1 180 GLU n 1 181 LYS n 1 182 LYS n 1 183 ILE n 1 184 LEU n 1 185 GLU n 1 186 HIS n 1 187 HIS n 1 188 HIS n 1 189 HIS n 1 190 HIS n 1 191 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'At4g27920, PYL10, RCAR4, T13J8.30' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Bl21(DE3) RP' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYL10_ARATH _struct_ref.pdbx_db_accession Q8H1R0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLK SGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALI QCNLNSLADVTERLQAESMEKKI ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3QTJ A 1 ? 183 ? Q8H1R0 1 ? 183 ? 1 183 2 1 3QTJ B 1 ? 183 ? Q8H1R0 1 ? 183 ? 1 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3QTJ LEU A 184 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 184 1 1 3QTJ GLU A 185 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 185 2 1 3QTJ HIS A 186 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 186 3 1 3QTJ HIS A 187 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 187 4 1 3QTJ HIS A 188 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 188 5 1 3QTJ HIS A 189 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 189 6 1 3QTJ HIS A 190 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 190 7 1 3QTJ HIS A 191 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 191 8 2 3QTJ LEU B 184 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 184 9 2 3QTJ GLU B 185 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 185 10 2 3QTJ HIS B 186 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 186 11 2 3QTJ HIS B 187 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 187 12 2 3QTJ HIS B 188 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 188 13 2 3QTJ HIS B 189 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 189 14 2 3QTJ HIS B 190 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 190 15 2 3QTJ HIS B 191 ? UNP Q8H1R0 ? ? 'EXPRESSION TAG' 191 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3QTJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_percent_sol 54.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '25% PEG 3350, 0.1M Bis-Tris pH 6.5, 0.2M (NH4)2SO4, VAPOR DIFFUSION, SITTING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2011-01-19 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.pdbx_synchrotron_site SSRF _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9791 # _reflns.entry_id 3QTJ _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 69.69 _reflns.d_resolution_high 3.0 _reflns.number_obs 9652 _reflns.number_all 9834 _reflns.percent_possible_obs 98.2 _reflns.pdbx_Rmerge_I_obs 0.134 _reflns.pdbx_Rsym_value 0.106 _reflns.pdbx_netI_over_sigmaI 12.7 _reflns.B_iso_Wilson_estimate 56.9 _reflns.pdbx_redundancy 4.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.00 _reflns_shell.d_res_low 3.05 _reflns_shell.percent_possible_all 99.4 _reflns_shell.Rmerge_I_obs 0.521 _reflns_shell.pdbx_Rsym_value 0.483 _reflns_shell.meanI_over_sigI_obs 3.2 _reflns_shell.pdbx_redundancy 4.2 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 486 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3QTJ _refine.ls_number_reflns_obs 8681 _refine.ls_number_reflns_all 8819 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.0 _refine.ls_d_res_high 3.00 _refine.ls_percent_reflns_obs 98.43 _refine.ls_R_factor_obs 0.23060 _refine.ls_R_factor_all 0.2343 _refine.ls_R_factor_R_work 0.22520 _refine.ls_R_factor_R_free 0.28071 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.1 _refine.ls_number_reflns_R_free 970 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.897 _refine.correlation_coeff_Fo_to_Fc_free 0.824 _refine.B_iso_mean 29.837 _refine.aniso_B[1][1] -0.34 _refine.aniso_B[2][2] -0.34 _refine.aniso_B[3][3] 0.52 _refine.aniso_B[1][2] -0.17 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 3KDH' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.470 _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2451 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 2494 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 50.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.009 0.022 ? 2493 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.257 1.973 ? 3369 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.321 5.000 ? 312 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.185 24.857 ? 105 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 19.626 15.000 ? 472 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 22.686 15.000 ? 14 'X-RAY DIFFRACTION' ? r_chiral_restr 0.086 0.200 ? 401 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.021 ? 1800 'X-RAY DIFFRACTION' ? r_mcbond_it 0.455 1.500 ? 1560 'X-RAY DIFFRACTION' ? r_mcangle_it 0.894 2.000 ? 2543 'X-RAY DIFFRACTION' ? r_scbond_it 1.854 3.000 ? 933 'X-RAY DIFFRACTION' ? r_scangle_it 2.959 4.500 ? 826 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 3.001 _refine_ls_shell.d_res_low 3.079 _refine_ls_shell.number_reflns_R_work 631 _refine_ls_shell.R_factor_R_work 0.306 _refine_ls_shell.percent_reflns_obs 99.58 _refine_ls_shell.R_factor_R_free 0.326 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 83 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 714 _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 3QTJ _struct.title 'Crystal strcuture of ABA receptor PYL10 (apo)' _struct.pdbx_descriptor 'Abscisic acid receptor PYL10' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3QTJ _struct_keywords.pdbx_keywords 'HORMONE RECEPTOR' _struct_keywords.text 'HELIX-GRIP FOLD, PYL10, APO FORM, ABA RECEPTOR, HORMONE RECEPTOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 38 ? ARG A 47 ? PRO A 38 ARG A 47 1 ? 10 HELX_P HELX_P2 2 GLU A 51 ? TYR A 55 ? GLU A 51 TYR A 55 5 ? 5 HELX_P HELX_P3 3 THR A 148 ? LYS A 181 ? THR A 148 LYS A 181 1 ? 34 HELX_P HELX_P4 4 PRO B 38 ? ARG B 47 ? PRO B 38 ARG B 47 1 ? 10 HELX_P HELX_P5 5 GLU B 51 ? TYR B 55 ? GLU B 51 TYR B 55 5 ? 5 HELX_P HELX_P6 6 THR B 148 ? SER B 178 ? THR B 148 SER B 178 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 153 SG ? ? A CYS 27 A CYS 153 1_555 ? ? ? ? ? ? ? 2.033 ? disulf2 disulf ? ? B CYS 27 SG ? ? ? 1_555 B CYS 153 SG ? ? B CYS 27 B CYS 153 1_555 ? ? ? ? ? ? ? 2.034 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 26 ? ILE A 35 ? GLN A 26 ILE A 35 A 2 LYS A 130 ? ASP A 142 ? LYS A 130 ASP A 142 A 3 SER A 117 ? ILE A 127 ? SER A 117 ILE A 127 A 4 ILE A 101 ? GLY A 108 ? ILE A 101 GLY A 108 A 5 LYS A 87 ? ASP A 96 ? LYS A 87 ASP A 96 A 6 VAL A 74 ? LEU A 79 ? VAL A 74 LEU A 79 A 7 ILE A 59 ? GLN A 65 ? ILE A 59 GLN A 65 B 1 GLN B 26 ? ILE B 35 ? GLN B 26 ILE B 35 B 2 LYS B 130 ? ASP B 142 ? LYS B 130 ASP B 142 B 3 SER B 117 ? ILE B 127 ? SER B 117 ILE B 127 B 4 ILE B 101 ? GLY B 108 ? ILE B 101 GLY B 108 B 5 LYS B 87 ? ASP B 96 ? LYS B 87 ASP B 96 B 6 VAL B 74 ? LEU B 79 ? VAL B 74 LEU B 79 B 7 ILE B 59 ? GLN B 65 ? ILE B 59 GLN B 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 35 ? N ILE A 35 O THR A 133 ? O THR A 133 A 2 3 O LEU A 134 ? O LEU A 134 N HIS A 123 ? N HIS A 123 A 3 4 O ILE A 120 ? O ILE A 120 N LEU A 102 ? N LEU A 102 A 4 5 O ARG A 105 ? O ARG A 105 N VAL A 91 ? N VAL A 91 A 5 6 O SER A 88 ? O SER A 88 N VAL A 77 ? N VAL A 77 A 6 7 O ASP A 78 ? O ASP A 78 N ARG A 61 ? N ARG A 61 B 1 2 N LEU B 31 ? N LEU B 31 O GLU B 137 ? O GLU B 137 B 2 3 O LEU B 134 ? O LEU B 134 N HIS B 123 ? N HIS B 123 B 3 4 O ILE B 120 ? O ILE B 120 N LEU B 102 ? N LEU B 102 B 4 5 O GLY B 103 ? O GLY B 103 N GLU B 93 ? N GLU B 93 B 5 6 O SER B 88 ? O SER B 88 N VAL B 77 ? N VAL B 77 B 6 7 O ASP B 78 ? O ASP B 78 N SER B 60 ? N SER B 60 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 B 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 61 ? ARG A 61 . ? 5_564 ? 2 AC1 3 LYS B 33 ? LYS B 33 . ? 1_555 ? 3 AC1 3 HIS B 34 ? HIS B 34 . ? 1_555 ? # _database_PDB_matrix.entry_id 3QTJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3QTJ _atom_sites.fract_transf_matrix[1][1] 0.012428 _atom_sites.fract_transf_matrix[1][2] 0.007175 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014350 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008005 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 THR 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 GLU 12 12 ? ? ? A . n A 1 13 TYR 13 13 ? ? ? A . n A 1 14 ILE 14 14 ? ? ? A . n A 1 15 LYS 15 15 ? ? ? A . n A 1 16 LYS 16 16 ? ? ? A . n A 1 17 HIS 17 17 ? ? ? A . n A 1 18 HIS 18 18 ? ? ? A . n A 1 19 ARG 19 19 ? ? ? A . n A 1 20 HIS 20 20 ? ? ? A . n A 1 21 GLU 21 21 ? ? ? A . n A 1 22 LEU 22 22 ? ? ? A . n A 1 23 VAL 23 23 ? ? ? A . n A 1 24 GLU 24 24 ? ? ? A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 CYS 153 153 153 CYS CYS A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 CYS 162 162 162 CYS CYS A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 LEU 184 184 ? ? ? A . n A 1 185 GLU 185 185 ? ? ? A . n A 1 186 HIS 186 186 ? ? ? A . n A 1 187 HIS 187 187 ? ? ? A . n A 1 188 HIS 188 188 ? ? ? A . n A 1 189 HIS 189 189 ? ? ? A . n A 1 190 HIS 190 190 ? ? ? A . n A 1 191 HIS 191 191 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ASN 2 2 ? ? ? B . n B 1 3 GLY 3 3 ? ? ? B . n B 1 4 ASP 4 4 ? ? ? B . n B 1 5 GLU 5 5 ? ? ? B . n B 1 6 THR 6 6 ? ? ? B . n B 1 7 LYS 7 7 ? ? ? B . n B 1 8 LYS 8 8 ? ? ? B . n B 1 9 VAL 9 9 ? ? ? B . n B 1 10 GLU 10 10 ? ? ? B . n B 1 11 SER 11 11 ? ? ? B . n B 1 12 GLU 12 12 ? ? ? B . n B 1 13 TYR 13 13 ? ? ? B . n B 1 14 ILE 14 14 ? ? ? B . n B 1 15 LYS 15 15 ? ? ? B . n B 1 16 LYS 16 16 ? ? ? B . n B 1 17 HIS 17 17 ? ? ? B . n B 1 18 HIS 18 18 ? ? ? B . n B 1 19 ARG 19 19 ? ? ? B . n B 1 20 HIS 20 20 ? ? ? B . n B 1 21 GLU 21 21 ? ? ? B . n B 1 22 LEU 22 22 ? ? ? B . n B 1 23 VAL 23 23 ? ? ? B . n B 1 24 GLU 24 24 ? ? ? B . n B 1 25 SER 25 25 25 SER SER B . n B 1 26 GLN 26 26 26 GLN GLN B . n B 1 27 CYS 27 27 27 CYS CYS B . n B 1 28 SER 28 28 28 SER SER B . n B 1 29 SER 29 29 29 SER SER B . n B 1 30 THR 30 30 30 THR THR B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 HIS 34 34 34 HIS HIS B . n B 1 35 ILE 35 35 35 ILE ILE B . n B 1 36 LYS 36 36 36 LYS LYS B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 PRO 38 38 38 PRO PRO B . n B 1 39 LEU 39 39 39 LEU LEU B . n B 1 40 HIS 40 40 40 HIS HIS B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 VAL 42 42 42 VAL VAL B . n B 1 43 TRP 43 43 43 TRP TRP B . n B 1 44 SER 44 44 44 SER SER B . n B 1 45 ILE 45 45 45 ILE ILE B . n B 1 46 VAL 46 46 46 VAL VAL B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 ARG 48 48 48 ARG ARG B . n B 1 49 PHE 49 49 49 PHE PHE B . n B 1 50 ASP 50 50 50 ASP ASP B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 PRO 52 52 52 PRO PRO B . n B 1 53 GLN 53 53 53 GLN GLN B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 TYR 55 55 55 TYR TYR B . n B 1 56 LYS 56 56 56 LYS LYS B . n B 1 57 PRO 57 57 57 PRO PRO B . n B 1 58 PHE 58 58 58 PHE PHE B . n B 1 59 ILE 59 59 59 ILE ILE B . n B 1 60 SER 60 60 60 SER SER B . n B 1 61 ARG 61 61 61 ARG ARG B . n B 1 62 CYS 62 62 62 CYS CYS B . n B 1 63 VAL 63 63 63 VAL VAL B . n B 1 64 VAL 64 64 64 VAL VAL B . n B 1 65 GLN 65 65 65 GLN GLN B . n B 1 66 GLY 66 66 66 GLY GLY B . n B 1 67 LYS 67 67 67 LYS LYS B . n B 1 68 LYS 68 68 68 LYS LYS B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 GLU 70 70 70 GLU GLU B . n B 1 71 VAL 71 71 71 VAL VAL B . n B 1 72 GLY 72 72 72 GLY GLY B . n B 1 73 SER 73 73 73 SER SER B . n B 1 74 VAL 74 74 74 VAL VAL B . n B 1 75 ARG 75 75 75 ARG ARG B . n B 1 76 GLU 76 76 76 GLU GLU B . n B 1 77 VAL 77 77 77 VAL VAL B . n B 1 78 ASP 78 78 78 ASP ASP B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 LYS 80 80 80 LYS LYS B . n B 1 81 SER 81 81 81 SER SER B . n B 1 82 GLY 82 82 82 GLY GLY B . n B 1 83 LEU 83 83 83 LEU LEU B . n B 1 84 PRO 84 84 84 PRO PRO B . n B 1 85 ALA 85 85 85 ALA ALA B . n B 1 86 THR 86 86 86 THR THR B . n B 1 87 LYS 87 87 87 LYS LYS B . n B 1 88 SER 88 88 88 SER SER B . n B 1 89 THR 89 89 89 THR THR B . n B 1 90 GLU 90 90 90 GLU GLU B . n B 1 91 VAL 91 91 91 VAL VAL B . n B 1 92 LEU 92 92 92 LEU LEU B . n B 1 93 GLU 93 93 93 GLU GLU B . n B 1 94 ILE 94 94 94 ILE ILE B . n B 1 95 LEU 95 95 95 LEU LEU B . n B 1 96 ASP 96 96 96 ASP ASP B . n B 1 97 ASP 97 97 97 ASP ASP B . n B 1 98 ASN 98 98 98 ASN ASN B . n B 1 99 GLU 99 99 99 GLU GLU B . n B 1 100 HIS 100 100 100 HIS HIS B . n B 1 101 ILE 101 101 101 ILE ILE B . n B 1 102 LEU 102 102 102 LEU LEU B . n B 1 103 GLY 103 103 103 GLY GLY B . n B 1 104 ILE 104 104 104 ILE ILE B . n B 1 105 ARG 105 105 105 ARG ARG B . n B 1 106 ILE 106 106 106 ILE ILE B . n B 1 107 VAL 107 107 107 VAL VAL B . n B 1 108 GLY 108 108 108 GLY GLY B . n B 1 109 GLY 109 109 109 GLY GLY B . n B 1 110 ASP 110 110 110 ASP ASP B . n B 1 111 HIS 111 111 111 HIS HIS B . n B 1 112 ARG 112 112 112 ARG ARG B . n B 1 113 LEU 113 113 113 LEU LEU B . n B 1 114 LYS 114 114 114 LYS LYS B . n B 1 115 ASN 115 115 115 ASN ASN B . n B 1 116 TYR 116 116 116 TYR TYR B . n B 1 117 SER 117 117 117 SER SER B . n B 1 118 SER 118 118 118 SER SER B . n B 1 119 THR 119 119 119 THR THR B . n B 1 120 ILE 120 120 120 ILE ILE B . n B 1 121 SER 121 121 121 SER SER B . n B 1 122 LEU 122 122 122 LEU LEU B . n B 1 123 HIS 123 123 123 HIS HIS B . n B 1 124 SER 124 124 124 SER SER B . n B 1 125 GLU 125 125 125 GLU GLU B . n B 1 126 THR 126 126 126 THR THR B . n B 1 127 ILE 127 127 127 ILE ILE B . n B 1 128 ASP 128 128 128 ASP ASP B . n B 1 129 GLY 129 129 129 GLY GLY B . n B 1 130 LYS 130 130 130 LYS LYS B . n B 1 131 THR 131 131 131 THR THR B . n B 1 132 GLY 132 132 132 GLY GLY B . n B 1 133 THR 133 133 133 THR THR B . n B 1 134 LEU 134 134 134 LEU LEU B . n B 1 135 ALA 135 135 135 ALA ALA B . n B 1 136 ILE 136 136 136 ILE ILE B . n B 1 137 GLU 137 137 137 GLU GLU B . n B 1 138 SER 138 138 138 SER SER B . n B 1 139 PHE 139 139 139 PHE PHE B . n B 1 140 VAL 140 140 140 VAL VAL B . n B 1 141 VAL 141 141 141 VAL VAL B . n B 1 142 ASP 142 142 142 ASP ASP B . n B 1 143 VAL 143 143 143 VAL VAL B . n B 1 144 PRO 144 144 144 PRO PRO B . n B 1 145 GLU 145 145 145 GLU GLU B . n B 1 146 GLY 146 146 146 GLY GLY B . n B 1 147 ASN 147 147 147 ASN ASN B . n B 1 148 THR 148 148 148 THR THR B . n B 1 149 LYS 149 149 149 LYS LYS B . n B 1 150 GLU 150 150 150 GLU GLU B . n B 1 151 GLU 151 151 151 GLU GLU B . n B 1 152 THR 152 152 152 THR THR B . n B 1 153 CYS 153 153 153 CYS CYS B . n B 1 154 PHE 154 154 154 PHE PHE B . n B 1 155 PHE 155 155 155 PHE PHE B . n B 1 156 VAL 156 156 156 VAL VAL B . n B 1 157 GLU 157 157 157 GLU GLU B . n B 1 158 ALA 158 158 158 ALA ALA B . n B 1 159 LEU 159 159 159 LEU LEU B . n B 1 160 ILE 160 160 160 ILE ILE B . n B 1 161 GLN 161 161 161 GLN GLN B . n B 1 162 CYS 162 162 162 CYS CYS B . n B 1 163 ASN 163 163 163 ASN ASN B . n B 1 164 LEU 164 164 164 LEU LEU B . n B 1 165 ASN 165 165 165 ASN ASN B . n B 1 166 SER 166 166 166 SER SER B . n B 1 167 LEU 167 167 167 LEU LEU B . n B 1 168 ALA 168 168 168 ALA ALA B . n B 1 169 ASP 169 169 169 ASP ASP B . n B 1 170 VAL 170 170 170 VAL VAL B . n B 1 171 THR 171 171 171 THR THR B . n B 1 172 GLU 172 172 172 GLU GLU B . n B 1 173 ARG 173 173 173 ARG ARG B . n B 1 174 LEU 174 174 174 LEU LEU B . n B 1 175 GLN 175 175 175 GLN GLN B . n B 1 176 ALA 176 176 176 ALA ALA B . n B 1 177 GLU 177 177 177 GLU GLU B . n B 1 178 SER 178 178 178 SER SER B . n B 1 179 MET 179 179 179 MET MET B . n B 1 180 GLU 180 180 ? ? ? B . n B 1 181 LYS 181 181 ? ? ? B . n B 1 182 LYS 182 182 ? ? ? B . n B 1 183 ILE 183 183 ? ? ? B . n B 1 184 LEU 184 184 ? ? ? B . n B 1 185 GLU 185 185 ? ? ? B . n B 1 186 HIS 186 186 ? ? ? B . n B 1 187 HIS 187 187 ? ? ? B . n B 1 188 HIS 188 188 ? ? ? B . n B 1 189 HIS 189 189 ? ? ? B . n B 1 190 HIS 190 190 ? ? ? B . n B 1 191 HIS 191 191 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 SO4 1 201 201 SO4 SO4 B . D 3 HOH 1 192 1 HOH HOH A . D 3 HOH 2 193 2 HOH HOH A . D 3 HOH 3 194 3 HOH HOH A . D 3 HOH 4 195 4 HOH HOH A . D 3 HOH 5 196 5 HOH HOH A . D 3 HOH 6 197 6 HOH HOH A . D 3 HOH 7 198 7 HOH HOH A . D 3 HOH 8 199 15 HOH HOH A . D 3 HOH 9 200 16 HOH HOH A . D 3 HOH 10 201 17 HOH HOH A . D 3 HOH 11 202 18 HOH HOH A . D 3 HOH 12 203 19 HOH HOH A . D 3 HOH 13 204 22 HOH HOH A . D 3 HOH 14 205 23 HOH HOH A . D 3 HOH 15 206 24 HOH HOH A . D 3 HOH 16 207 25 HOH HOH A . D 3 HOH 17 208 26 HOH HOH A . D 3 HOH 18 209 27 HOH HOH A . D 3 HOH 19 210 28 HOH HOH A . D 3 HOH 20 211 29 HOH HOH A . D 3 HOH 21 212 30 HOH HOH A . D 3 HOH 22 213 38 HOH HOH A . E 3 HOH 1 192 8 HOH HOH B . E 3 HOH 2 193 9 HOH HOH B . E 3 HOH 3 194 10 HOH HOH B . E 3 HOH 4 195 11 HOH HOH B . E 3 HOH 5 196 12 HOH HOH B . E 3 HOH 6 197 13 HOH HOH B . E 3 HOH 7 198 14 HOH HOH B . E 3 HOH 8 199 20 HOH HOH B . E 3 HOH 9 200 21 HOH HOH B . E 3 HOH 10 202 31 HOH HOH B . E 3 HOH 11 203 32 HOH HOH B . E 3 HOH 12 204 33 HOH HOH B . E 3 HOH 13 205 34 HOH HOH B . E 3 HOH 14 206 35 HOH HOH B . E 3 HOH 15 207 36 HOH HOH B . E 3 HOH 16 208 37 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1950 ? 1 MORE -12 ? 1 'SSA (A^2)' 15910 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-05-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2011-12-14 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 3 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Other # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal Blu-Ice 'data collection' . ? 1 PHASER 'model building' . ? 2 REFMAC refinement 5.5.0102 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 PHASER phasing . ? 6 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 180 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 180 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 180 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 97.38 _pdbx_validate_rmsd_angle.angle_target_value 110.40 _pdbx_validate_rmsd_angle.angle_deviation -13.02 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.00 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 29 ? ? 177.33 142.83 2 1 ARG A 48 ? ? -68.24 89.56 3 1 LEU A 69 ? ? -155.98 59.97 4 1 ASP A 110 ? ? -37.10 -31.90 5 1 ASP A 128 ? ? 52.91 -124.40 6 1 LYS A 181 ? ? -81.44 34.38 7 1 LYS A 182 ? ? -63.59 8.47 8 1 ALA B 37 ? ? -170.86 149.81 9 1 ARG B 48 ? ? -66.13 70.11 10 1 TYR B 55 ? ? -142.14 -10.61 11 1 SER B 60 ? ? -92.99 -63.73 12 1 ASN B 98 ? ? -90.20 -60.82 13 1 ASP B 110 ? ? -34.04 -32.72 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A THR 6 ? A THR 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A GLU 10 ? A GLU 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A GLU 12 ? A GLU 12 13 1 Y 1 A TYR 13 ? A TYR 13 14 1 Y 1 A ILE 14 ? A ILE 14 15 1 Y 1 A LYS 15 ? A LYS 15 16 1 Y 1 A LYS 16 ? A LYS 16 17 1 Y 1 A HIS 17 ? A HIS 17 18 1 Y 1 A HIS 18 ? A HIS 18 19 1 Y 1 A ARG 19 ? A ARG 19 20 1 Y 1 A HIS 20 ? A HIS 20 21 1 Y 1 A GLU 21 ? A GLU 21 22 1 Y 1 A LEU 22 ? A LEU 22 23 1 Y 1 A VAL 23 ? A VAL 23 24 1 Y 1 A GLU 24 ? A GLU 24 25 1 Y 1 A LEU 184 ? A LEU 184 26 1 Y 1 A GLU 185 ? A GLU 185 27 1 Y 1 A HIS 186 ? A HIS 186 28 1 Y 1 A HIS 187 ? A HIS 187 29 1 Y 1 A HIS 188 ? A HIS 188 30 1 Y 1 A HIS 189 ? A HIS 189 31 1 Y 1 A HIS 190 ? A HIS 190 32 1 Y 1 A HIS 191 ? A HIS 191 33 1 Y 1 B MET 1 ? B MET 1 34 1 Y 1 B ASN 2 ? B ASN 2 35 1 Y 1 B GLY 3 ? B GLY 3 36 1 Y 1 B ASP 4 ? B ASP 4 37 1 Y 1 B GLU 5 ? B GLU 5 38 1 Y 1 B THR 6 ? B THR 6 39 1 Y 1 B LYS 7 ? B LYS 7 40 1 Y 1 B LYS 8 ? B LYS 8 41 1 Y 1 B VAL 9 ? B VAL 9 42 1 Y 1 B GLU 10 ? B GLU 10 43 1 Y 1 B SER 11 ? B SER 11 44 1 Y 1 B GLU 12 ? B GLU 12 45 1 Y 1 B TYR 13 ? B TYR 13 46 1 Y 1 B ILE 14 ? B ILE 14 47 1 Y 1 B LYS 15 ? B LYS 15 48 1 Y 1 B LYS 16 ? B LYS 16 49 1 Y 1 B HIS 17 ? B HIS 17 50 1 Y 1 B HIS 18 ? B HIS 18 51 1 Y 1 B ARG 19 ? B ARG 19 52 1 Y 1 B HIS 20 ? B HIS 20 53 1 Y 1 B GLU 21 ? B GLU 21 54 1 Y 1 B LEU 22 ? B LEU 22 55 1 Y 1 B VAL 23 ? B VAL 23 56 1 Y 1 B GLU 24 ? B GLU 24 57 1 Y 1 B GLU 180 ? B GLU 180 58 1 Y 1 B LYS 181 ? B LYS 181 59 1 Y 1 B LYS 182 ? B LYS 182 60 1 Y 1 B ILE 183 ? B ILE 183 61 1 Y 1 B LEU 184 ? B LEU 184 62 1 Y 1 B GLU 185 ? B GLU 185 63 1 Y 1 B HIS 186 ? B HIS 186 64 1 Y 1 B HIS 187 ? B HIS 187 65 1 Y 1 B HIS 188 ? B HIS 188 66 1 Y 1 B HIS 189 ? B HIS 189 67 1 Y 1 B HIS 190 ? B HIS 190 68 1 Y 1 B HIS 191 ? B HIS 191 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #