data_3QVB # _entry.id 3QVB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3QVB RCSB RCSB064148 WWPDB D_1000064148 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3Q4S _pdbx_database_related.details 'apo form' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3QVB _pdbx_database_status.recvd_initial_deposition_date 2011-02-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chaikuad, A.' 1 'Froese, D.S.' 2 'Yue, W.W.' 3 'Krysztofinska, E.' 4 'von Delft, F.' 5 'Weigelt, J.' 6 'Arrowsmith, C.H.' 7 'Edwards, A.M.' 8 'Bountra, C.' 9 'Oppermann, U.' 10 'Structural Genomics Consortium (SGC)' 11 # _citation.id primary _citation.title 'Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 108 _citation.page_first 21028 _citation.page_last 21033 _citation.year 2011 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22160680 _citation.pdbx_database_id_DOI 10.1073/pnas.1113921108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chaikuad, A.' 1 primary 'Froese, D.S.' 2 primary 'Berridge, G.' 3 primary 'von Delft, F.' 4 primary 'Oppermann, U.' 5 primary 'Yue, W.W.' 6 # _cell.entry_id 3QVB _cell.length_a 57.400 _cell.length_b 100.970 _cell.length_c 48.940 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3QVB _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Glycogenin-1 29595.639 1 2.4.1.186 Y195F 'glycogenin (residues 1-262)' ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 3 non-polymer syn "URIDINE-5'-DIPHOSPHATE" 404.161 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 5 ? ? ? ? 5 water nat water 18.015 136 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GN-1, GN1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPE LGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSF DGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIFSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPN MTHPEFLILWWNIFTTNVLPLLQ ; _entity_poly.pdbx_seq_one_letter_code_can ;SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPE LGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSF DGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIFSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPN MTHPEFLILWWNIFTTNVLPLLQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 THR n 1 4 ASP n 1 5 GLN n 1 6 ALA n 1 7 PHE n 1 8 VAL n 1 9 THR n 1 10 LEU n 1 11 THR n 1 12 THR n 1 13 ASN n 1 14 ASP n 1 15 ALA n 1 16 TYR n 1 17 ALA n 1 18 LYS n 1 19 GLY n 1 20 ALA n 1 21 LEU n 1 22 VAL n 1 23 LEU n 1 24 GLY n 1 25 SER n 1 26 SER n 1 27 LEU n 1 28 LYS n 1 29 GLN n 1 30 HIS n 1 31 ARG n 1 32 THR n 1 33 THR n 1 34 ARG n 1 35 ARG n 1 36 LEU n 1 37 VAL n 1 38 VAL n 1 39 LEU n 1 40 ALA n 1 41 THR n 1 42 PRO n 1 43 GLN n 1 44 VAL n 1 45 SER n 1 46 ASP n 1 47 SER n 1 48 MET n 1 49 ARG n 1 50 LYS n 1 51 VAL n 1 52 LEU n 1 53 GLU n 1 54 THR n 1 55 VAL n 1 56 PHE n 1 57 ASP n 1 58 GLU n 1 59 VAL n 1 60 ILE n 1 61 MET n 1 62 VAL n 1 63 ASP n 1 64 VAL n 1 65 LEU n 1 66 ASP n 1 67 SER n 1 68 GLY n 1 69 ASP n 1 70 SER n 1 71 ALA n 1 72 HIS n 1 73 LEU n 1 74 THR n 1 75 LEU n 1 76 MET n 1 77 LYS n 1 78 ARG n 1 79 PRO n 1 80 GLU n 1 81 LEU n 1 82 GLY n 1 83 VAL n 1 84 THR n 1 85 LEU n 1 86 THR n 1 87 LYS n 1 88 LEU n 1 89 HIS n 1 90 CYS n 1 91 TRP n 1 92 SER n 1 93 LEU n 1 94 THR n 1 95 GLN n 1 96 TYR n 1 97 SER n 1 98 LYS n 1 99 CYS n 1 100 VAL n 1 101 PHE n 1 102 MET n 1 103 ASP n 1 104 ALA n 1 105 ASP n 1 106 THR n 1 107 LEU n 1 108 VAL n 1 109 LEU n 1 110 ALA n 1 111 ASN n 1 112 ILE n 1 113 ASP n 1 114 ASP n 1 115 LEU n 1 116 PHE n 1 117 ASP n 1 118 ARG n 1 119 GLU n 1 120 GLU n 1 121 LEU n 1 122 SER n 1 123 ALA n 1 124 ALA n 1 125 PRO n 1 126 ASP n 1 127 PRO n 1 128 GLY n 1 129 TRP n 1 130 PRO n 1 131 ASP n 1 132 CYS n 1 133 PHE n 1 134 ASN n 1 135 SER n 1 136 GLY n 1 137 VAL n 1 138 PHE n 1 139 VAL n 1 140 TYR n 1 141 GLN n 1 142 PRO n 1 143 SER n 1 144 VAL n 1 145 GLU n 1 146 THR n 1 147 TYR n 1 148 ASN n 1 149 GLN n 1 150 LEU n 1 151 LEU n 1 152 HIS n 1 153 LEU n 1 154 ALA n 1 155 SER n 1 156 GLU n 1 157 GLN n 1 158 GLY n 1 159 SER n 1 160 PHE n 1 161 ASP n 1 162 GLY n 1 163 GLY n 1 164 ASP n 1 165 GLN n 1 166 GLY n 1 167 ILE n 1 168 LEU n 1 169 ASN n 1 170 THR n 1 171 PHE n 1 172 PHE n 1 173 SER n 1 174 SER n 1 175 TRP n 1 176 ALA n 1 177 THR n 1 178 THR n 1 179 ASP n 1 180 ILE n 1 181 ARG n 1 182 LYS n 1 183 HIS n 1 184 LEU n 1 185 PRO n 1 186 PHE n 1 187 ILE n 1 188 TYR n 1 189 ASN n 1 190 LEU n 1 191 SER n 1 192 SER n 1 193 ILE n 1 194 SER n 1 195 ILE n 1 196 PHE n 1 197 SER n 1 198 TYR n 1 199 LEU n 1 200 PRO n 1 201 ALA n 1 202 PHE n 1 203 LYS n 1 204 VAL n 1 205 PHE n 1 206 GLY n 1 207 ALA n 1 208 SER n 1 209 ALA n 1 210 LYS n 1 211 VAL n 1 212 VAL n 1 213 HIS n 1 214 PHE n 1 215 LEU n 1 216 GLY n 1 217 ARG n 1 218 VAL n 1 219 LYS n 1 220 PRO n 1 221 TRP n 1 222 ASN n 1 223 TYR n 1 224 THR n 1 225 TYR n 1 226 ASP n 1 227 PRO n 1 228 LYS n 1 229 THR n 1 230 LYS n 1 231 SER n 1 232 VAL n 1 233 LYS n 1 234 SER n 1 235 GLU n 1 236 ALA n 1 237 HIS n 1 238 ASP n 1 239 PRO n 1 240 ASN n 1 241 MET n 1 242 THR n 1 243 HIS n 1 244 PRO n 1 245 GLU n 1 246 PHE n 1 247 LEU n 1 248 ILE n 1 249 LEU n 1 250 TRP n 1 251 TRP n 1 252 ASN n 1 253 ILE n 1 254 PHE n 1 255 THR n 1 256 THR n 1 257 ASN n 1 258 VAL n 1 259 LEU n 1 260 PRO n 1 261 LEU n 1 262 LEU n 1 263 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GYG, GYG1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-R3-pRARE2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC28-Bsa4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLYG_HUMAN _struct_ref.pdbx_db_accession P46976 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPEL GVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFD GGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNM THPEFLILWWNIFTTNVLPLLQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3QVB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P46976 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 262 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3QVB SER A 1 ? UNP P46976 ? ? 'EXPRESSION TAG' 0 1 1 3QVB PHE A 196 ? UNP P46976 TYR 195 'ENGINEERED MUTATION' 195 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UDP 'RNA linking' . "URIDINE-5'-DIPHOSPHATE" ? 'C9 H14 N2 O12 P2' 404.161 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3QVB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_percent_sol 48.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_details '25% PEG 3350, 0.2M Ammonium sulfate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293.15K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2011-01-22 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Flat graphite crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3QVB _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 29.97 _reflns.d_resolution_high 2.26 _reflns.number_obs 13862 _reflns.number_all 13895 _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.093 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 10.7 _reflns.B_iso_Wilson_estimate 38.7 _reflns.pdbx_redundancy 3.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.26 _reflns_shell.d_res_low 2.38 _reflns_shell.percent_possible_all 99.1 _reflns_shell.Rmerge_I_obs 0.605 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy 3.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1970 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3QVB _refine.ls_number_reflns_obs 13168 _refine.ls_number_reflns_all 13862 _refine.pdbx_ls_sigma_I 2.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.03 _refine.ls_d_res_high 2.26 _refine.ls_percent_reflns_obs 99.72 _refine.ls_R_factor_obs 0.20201 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19929 _refine.ls_R_factor_R_free 0.25588 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 693 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.948 _refine.correlation_coeff_Fo_to_Fc_free 0.919 _refine.B_iso_mean 27.926 _refine.aniso_B[1][1] -0.39 _refine.aniso_B[2][2] -1.23 _refine.aniso_B[3][3] 1.61 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 3Q4S' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.239 _refine.overall_SU_ML 0.170 _refine.overall_SU_B 13.310 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3QVB _refine_analyze.Luzzati_coordinate_error_obs 0.28 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1972 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 46 _refine_hist.number_atoms_solvent 136 _refine_hist.number_atoms_total 2154 _refine_hist.d_res_high 2.26 _refine_hist.d_res_low 29.03 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.022 ? 2080 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 1365 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.487 1.969 ? 2826 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.991 3.000 ? 3340 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.450 5.000 ? 252 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.429 24.483 ? 87 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.704 15.000 ? 330 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 22.815 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.087 0.200 ? 326 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.021 ? 2247 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 412 'X-RAY DIFFRACTION' ? r_mcbond_it 0.746 1.500 ? 1258 'X-RAY DIFFRACTION' ? r_mcbond_other 0.150 1.500 ? 503 'X-RAY DIFFRACTION' ? r_mcangle_it 1.402 2.000 ? 2042 'X-RAY DIFFRACTION' ? r_scbond_it 2.194 3.000 ? 822 'X-RAY DIFFRACTION' ? r_scangle_it 3.445 4.500 ? 782 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.260 _refine_ls_shell.d_res_low 2.318 _refine_ls_shell.number_reflns_R_work 946 _refine_ls_shell.R_factor_R_work 0.306 _refine_ls_shell.percent_reflns_obs 98.53 _refine_ls_shell.R_factor_R_free 0.307 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 56 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3QVB _struct.title 'Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP' _struct.pdbx_descriptor 'Glycogenin-1 (E.C.2.4.1.186)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3QVB _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Structural Genomics, Structural Genomics Consortium, (SGC), TRANSFERASE, glycosyltransferase, glycogen biosynthesis, glycosylation' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 4 ? I N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 13 ? HIS A 30 ? ASN A 12 HIS A 29 1 ? 18 HELX_P HELX_P2 2 SER A 45 ? GLU A 53 ? SER A 44 GLU A 52 1 ? 9 HELX_P HELX_P3 3 ALA A 71 ? ARG A 78 ? ALA A 70 ARG A 77 1 ? 8 HELX_P HELX_P4 4 LEU A 81 ? LEU A 88 ? LEU A 80 LEU A 87 1 ? 8 HELX_P HELX_P5 5 HIS A 89 ? LEU A 93 ? HIS A 88 LEU A 92 5 ? 5 HELX_P HELX_P6 6 ILE A 112 ? ARG A 118 ? ILE A 111 ARG A 117 5 ? 7 HELX_P HELX_P7 7 SER A 143 ? GLY A 158 ? SER A 142 GLY A 157 1 ? 16 HELX_P HELX_P8 8 GLY A 163 ? PHE A 172 ? GLY A 162 PHE A 171 1 ? 10 HELX_P HELX_P9 9 ASP A 179 ? HIS A 183 ? ASP A 178 HIS A 182 5 ? 5 HELX_P HELX_P10 10 PRO A 185 ? ASN A 189 ? PRO A 184 ASN A 188 5 ? 5 HELX_P HELX_P11 11 LEU A 199 ? GLY A 206 ? LEU A 198 GLY A 205 1 ? 8 HELX_P HELX_P12 12 ALA A 207 ? ALA A 209 ? ALA A 206 ALA A 208 5 ? 3 HELX_P HELX_P13 13 LYS A 219 ? TYR A 223 ? LYS A 218 TYR A 222 5 ? 5 HELX_P HELX_P14 14 PRO A 244 ? VAL A 258 ? PRO A 243 VAL A 257 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B MN . MN ? ? ? 1_555 C UDP . O2B ? ? A MN 263 A UDP 264 1_555 ? ? ? ? ? ? ? 1.940 ? metalc2 metalc ? ? A ASP 103 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 102 A MN 263 1_555 ? ? ? ? ? ? ? 1.967 ? metalc3 metalc ? ? A ASP 105 OD1 ? ? ? 1_555 B MN . MN ? ? A ASP 104 A MN 263 1_555 ? ? ? ? ? ? ? 2.044 ? metalc4 metalc ? ? A HIS 213 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 212 A MN 263 1_555 ? ? ? ? ? ? ? 2.095 ? metalc5 metalc ? ? B MN . MN ? ? ? 1_555 C UDP . O1A ? ? A MN 263 A UDP 264 1_555 ? ? ? ? ? ? ? 2.279 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 120 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 119 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 LEU _struct_mon_prot_cis.pdbx_label_seq_id_2 121 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 LEU _struct_mon_prot_cis.pdbx_auth_seq_id_2 120 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -8.54 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 3 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 58 ? MET A 61 ? GLU A 57 MET A 60 A 2 ARG A 34 ? ALA A 40 ? ARG A 33 ALA A 39 A 3 MET A 2 ? THR A 11 ? MET A 1 THR A 10 A 4 LYS A 98 ? MET A 102 ? LYS A 97 MET A 101 A 5 PHE A 133 ? TYR A 140 ? PHE A 132 TYR A 139 A 6 SER A 122 ? PRO A 125 ? SER A 121 PRO A 124 B 1 THR A 106 ? VAL A 108 ? THR A 105 VAL A 107 B 2 VAL A 211 ? HIS A 213 ? VAL A 210 HIS A 212 B 3 LEU A 190 ? SER A 191 ? LEU A 189 SER A 190 C 1 TYR A 225 ? ASP A 226 ? TYR A 224 ASP A 225 C 2 SER A 231 ? VAL A 232 ? SER A 230 VAL A 231 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 60 ? O ILE A 59 N ALA A 40 ? N ALA A 39 A 2 3 O LEU A 39 ? O LEU A 38 N THR A 9 ? N THR A 8 A 3 4 N VAL A 8 ? N VAL A 7 O MET A 102 ? O MET A 101 A 4 5 N PHE A 101 ? N PHE A 100 O PHE A 138 ? O PHE A 137 A 5 6 O VAL A 139 ? O VAL A 138 N SER A 122 ? N SER A 121 B 1 2 N LEU A 107 ? N LEU A 106 O VAL A 212 ? O VAL A 211 B 2 3 O VAL A 211 ? O VAL A 210 N LEU A 190 ? N LEU A 189 C 1 2 N ASP A 226 ? N ASP A 225 O SER A 231 ? O SER A 230 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN A 263' AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UDP A 264' AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO A 265' AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 266' AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A 267' AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO A 268' AC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO A 269' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 103 ? ASP A 102 . ? 1_555 ? 2 AC1 4 ASP A 105 ? ASP A 104 . ? 1_555 ? 3 AC1 4 HIS A 213 ? HIS A 212 . ? 1_555 ? 4 AC1 4 UDP C . ? UDP A 264 . ? 1_555 ? 5 AC2 14 LEU A 10 ? LEU A 9 . ? 1_555 ? 6 AC2 14 THR A 11 ? THR A 10 . ? 1_555 ? 7 AC2 14 THR A 12 ? THR A 11 . ? 1_555 ? 8 AC2 14 TYR A 16 ? TYR A 15 . ? 1_555 ? 9 AC2 14 VAL A 83 ? VAL A 82 . ? 1_555 ? 10 AC2 14 ASP A 103 ? ASP A 102 . ? 1_555 ? 11 AC2 14 ALA A 104 ? ALA A 103 . ? 1_555 ? 12 AC2 14 ASP A 105 ? ASP A 104 . ? 1_555 ? 13 AC2 14 HIS A 213 ? HIS A 212 . ? 1_555 ? 14 AC2 14 LEU A 215 ? LEU A 214 . ? 1_555 ? 15 AC2 14 GLY A 216 ? GLY A 215 . ? 1_555 ? 16 AC2 14 LYS A 219 ? LYS A 218 . ? 1_555 ? 17 AC2 14 MN B . ? MN A 263 . ? 1_555 ? 18 AC2 14 HOH I . ? HOH A 388 . ? 1_555 ? 19 AC3 3 HIS A 30 ? HIS A 29 . ? 1_555 ? 20 AC3 3 ARG A 31 ? ARG A 30 . ? 2_555 ? 21 AC3 3 ASN A 111 ? ASN A 110 . ? 1_555 ? 22 AC4 4 THR A 94 ? THR A 93 . ? 1_555 ? 23 AC4 4 SER A 143 ? SER A 142 . ? 1_555 ? 24 AC4 4 VAL A 144 ? VAL A 143 . ? 1_555 ? 25 AC4 4 GLU A 145 ? GLU A 144 . ? 1_555 ? 26 AC5 5 GLU A 120 ? GLU A 119 . ? 1_555 ? 27 AC5 5 LEU A 121 ? LEU A 120 . ? 1_555 ? 28 AC5 5 SER A 174 ? SER A 173 . ? 1_555 ? 29 AC5 5 LYS A 182 ? LYS A 181 . ? 1_555 ? 30 AC5 5 HOH I . ? HOH A 364 . ? 1_555 ? 31 AC6 3 HIS A 89 ? HIS A 88 . ? 1_555 ? 32 AC6 3 LEU A 93 ? LEU A 92 . ? 1_555 ? 33 AC6 3 HOH I . ? HOH A 308 . ? 1_555 ? 34 AC7 7 SER A 45 ? SER A 44 . ? 1_555 ? 35 AC7 7 ASP A 46 ? ASP A 45 . ? 1_555 ? 36 AC7 7 SER A 47 ? SER A 46 . ? 1_555 ? 37 AC7 7 SER A 159 ? SER A 158 . ? 4_455 ? 38 AC7 7 PHE A 160 ? PHE A 159 . ? 4_455 ? 39 AC7 7 ASP A 161 ? ASP A 160 . ? 4_455 ? 40 AC7 7 GLY A 162 ? GLY A 161 . ? 4_455 ? # _database_PDB_matrix.entry_id 3QVB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3QVB _atom_sites.fract_transf_matrix[1][1] 0.017422 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009904 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020433 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 0 SER SER A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 GLN 5 4 4 GLN GLN A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 PHE 7 6 6 PHE PHE A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 THR 9 8 8 THR THR A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 THR 11 10 10 THR THR A . n A 1 12 THR 12 11 11 THR THR A . n A 1 13 ASN 13 12 12 ASN ASN A . n A 1 14 ASP 14 13 13 ASP ASP A . n A 1 15 ALA 15 14 14 ALA ALA A . n A 1 16 TYR 16 15 15 TYR TYR A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 LYS 18 17 17 LYS LYS A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 LEU 23 22 22 LEU LEU A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 SER 26 25 25 SER SER A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 GLN 29 28 28 GLN GLN A . n A 1 30 HIS 30 29 29 HIS HIS A . n A 1 31 ARG 31 30 30 ARG ARG A . n A 1 32 THR 32 31 31 THR THR A . n A 1 33 THR 33 32 32 THR THR A . n A 1 34 ARG 34 33 33 ARG ARG A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 LEU 39 38 38 LEU LEU A . n A 1 40 ALA 40 39 39 ALA ALA A . n A 1 41 THR 41 40 40 THR THR A . n A 1 42 PRO 42 41 41 PRO PRO A . n A 1 43 GLN 43 42 42 GLN GLN A . n A 1 44 VAL 44 43 43 VAL VAL A . n A 1 45 SER 45 44 44 SER SER A . n A 1 46 ASP 46 45 45 ASP ASP A . n A 1 47 SER 47 46 46 SER SER A . n A 1 48 MET 48 47 47 MET MET A . n A 1 49 ARG 49 48 48 ARG ARG A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 VAL 51 50 50 VAL VAL A . n A 1 52 LEU 52 51 51 LEU LEU A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 THR 54 53 53 THR THR A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 PHE 56 55 55 PHE PHE A . n A 1 57 ASP 57 56 56 ASP ASP A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 ILE 60 59 59 ILE ILE A . n A 1 61 MET 61 60 60 MET MET A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 ASP 63 62 62 ASP ASP A . n A 1 64 VAL 64 63 63 VAL VAL A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 SER 67 66 66 SER SER A . n A 1 68 GLY 68 67 67 GLY GLY A . n A 1 69 ASP 69 68 68 ASP ASP A . n A 1 70 SER 70 69 69 SER SER A . n A 1 71 ALA 71 70 70 ALA ALA A . n A 1 72 HIS 72 71 71 HIS HIS A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 THR 74 73 73 THR THR A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 MET 76 75 75 MET MET A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 ARG 78 77 77 ARG ARG A . n A 1 79 PRO 79 78 78 PRO PRO A . n A 1 80 GLU 80 79 79 GLU GLU A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 GLY 82 81 81 GLY GLY A . n A 1 83 VAL 83 82 82 VAL VAL A . n A 1 84 THR 84 83 83 THR THR A . n A 1 85 LEU 85 84 84 LEU LEU A . n A 1 86 THR 86 85 85 THR THR A . n A 1 87 LYS 87 86 86 LYS LYS A . n A 1 88 LEU 88 87 87 LEU LEU A . n A 1 89 HIS 89 88 88 HIS HIS A . n A 1 90 CYS 90 89 89 CYS CYS A . n A 1 91 TRP 91 90 90 TRP TRP A . n A 1 92 SER 92 91 91 SER SER A . n A 1 93 LEU 93 92 92 LEU LEU A . n A 1 94 THR 94 93 93 THR THR A . n A 1 95 GLN 95 94 94 GLN GLN A . n A 1 96 TYR 96 95 95 TYR TYR A . n A 1 97 SER 97 96 96 SER SER A . n A 1 98 LYS 98 97 97 LYS LYS A . n A 1 99 CYS 99 98 98 CYS CYS A . n A 1 100 VAL 100 99 99 VAL VAL A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 MET 102 101 101 MET MET A . n A 1 103 ASP 103 102 102 ASP ASP A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 ASP 105 104 104 ASP ASP A . n A 1 106 THR 106 105 105 THR THR A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 VAL 108 107 107 VAL VAL A . n A 1 109 LEU 109 108 108 LEU LEU A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 ASN 111 110 110 ASN ASN A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 ASP 113 112 112 ASP ASP A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 LEU 115 114 114 LEU LEU A . n A 1 116 PHE 116 115 115 PHE PHE A . n A 1 117 ASP 117 116 116 ASP ASP A . n A 1 118 ARG 118 117 117 ARG ARG A . n A 1 119 GLU 119 118 118 GLU GLU A . n A 1 120 GLU 120 119 119 GLU GLU A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 SER 122 121 121 SER SER A . n A 1 123 ALA 123 122 122 ALA ALA A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 PRO 125 124 124 PRO PRO A . n A 1 126 ASP 126 125 125 ASP ASP A . n A 1 127 PRO 127 126 126 PRO PRO A . n A 1 128 GLY 128 127 127 GLY GLY A . n A 1 129 TRP 129 128 128 TRP TRP A . n A 1 130 PRO 130 129 129 PRO PRO A . n A 1 131 ASP 131 130 130 ASP ASP A . n A 1 132 CYS 132 131 131 CYS CYS A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ASN 134 133 133 ASN ASN A . n A 1 135 SER 135 134 134 SER SER A . n A 1 136 GLY 136 135 135 GLY GLY A . n A 1 137 VAL 137 136 136 VAL VAL A . n A 1 138 PHE 138 137 137 PHE PHE A . n A 1 139 VAL 139 138 138 VAL VAL A . n A 1 140 TYR 140 139 139 TYR TYR A . n A 1 141 GLN 141 140 140 GLN GLN A . n A 1 142 PRO 142 141 141 PRO PRO A . n A 1 143 SER 143 142 142 SER SER A . n A 1 144 VAL 144 143 143 VAL VAL A . n A 1 145 GLU 145 144 144 GLU GLU A . n A 1 146 THR 146 145 145 THR THR A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 ASN 148 147 147 ASN ASN A . n A 1 149 GLN 149 148 148 GLN GLN A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 LEU 151 150 150 LEU LEU A . n A 1 152 HIS 152 151 151 HIS HIS A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 ALA 154 153 153 ALA ALA A . n A 1 155 SER 155 154 154 SER SER A . n A 1 156 GLU 156 155 155 GLU GLU A . n A 1 157 GLN 157 156 156 GLN GLN A . n A 1 158 GLY 158 157 157 GLY GLY A . n A 1 159 SER 159 158 158 SER SER A . n A 1 160 PHE 160 159 159 PHE PHE A . n A 1 161 ASP 161 160 160 ASP ASP A . n A 1 162 GLY 162 161 161 GLY GLY A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 ASP 164 163 163 ASP ASP A . n A 1 165 GLN 165 164 164 GLN GLN A . n A 1 166 GLY 166 165 165 GLY GLY A . n A 1 167 ILE 167 166 166 ILE ILE A . n A 1 168 LEU 168 167 167 LEU LEU A . n A 1 169 ASN 169 168 168 ASN ASN A . n A 1 170 THR 170 169 169 THR THR A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 PHE 172 171 171 PHE PHE A . n A 1 173 SER 173 172 172 SER SER A . n A 1 174 SER 174 173 173 SER SER A . n A 1 175 TRP 175 174 174 TRP TRP A . n A 1 176 ALA 176 175 175 ALA ALA A . n A 1 177 THR 177 176 176 THR THR A . n A 1 178 THR 178 177 177 THR THR A . n A 1 179 ASP 179 178 178 ASP ASP A . n A 1 180 ILE 180 179 179 ILE ILE A . n A 1 181 ARG 181 180 180 ARG ARG A . n A 1 182 LYS 182 181 181 LYS LYS A . n A 1 183 HIS 183 182 182 HIS HIS A . n A 1 184 LEU 184 183 183 LEU LEU A . n A 1 185 PRO 185 184 184 PRO PRO A . n A 1 186 PHE 186 185 185 PHE PHE A . n A 1 187 ILE 187 186 186 ILE ILE A . n A 1 188 TYR 188 187 187 TYR TYR A . n A 1 189 ASN 189 188 188 ASN ASN A . n A 1 190 LEU 190 189 189 LEU LEU A . n A 1 191 SER 191 190 190 SER SER A . n A 1 192 SER 192 191 191 SER SER A . n A 1 193 ILE 193 192 192 ILE ILE A . n A 1 194 SER 194 193 ? ? ? A . n A 1 195 ILE 195 194 ? ? ? A . n A 1 196 PHE 196 195 ? ? ? A . n A 1 197 SER 197 196 ? ? ? A . n A 1 198 TYR 198 197 ? ? ? A . n A 1 199 LEU 199 198 198 LEU LEU A . n A 1 200 PRO 200 199 199 PRO PRO A . n A 1 201 ALA 201 200 200 ALA ALA A . n A 1 202 PHE 202 201 201 PHE PHE A . n A 1 203 LYS 203 202 202 LYS LYS A . n A 1 204 VAL 204 203 203 VAL VAL A . n A 1 205 PHE 205 204 204 PHE PHE A . n A 1 206 GLY 206 205 205 GLY GLY A . n A 1 207 ALA 207 206 206 ALA ALA A . n A 1 208 SER 208 207 207 SER SER A . n A 1 209 ALA 209 208 208 ALA ALA A . n A 1 210 LYS 210 209 209 LYS LYS A . n A 1 211 VAL 211 210 210 VAL VAL A . n A 1 212 VAL 212 211 211 VAL VAL A . n A 1 213 HIS 213 212 212 HIS HIS A . n A 1 214 PHE 214 213 213 PHE PHE A . n A 1 215 LEU 215 214 214 LEU LEU A . n A 1 216 GLY 216 215 215 GLY GLY A . n A 1 217 ARG 217 216 216 ARG ARG A . n A 1 218 VAL 218 217 217 VAL VAL A . n A 1 219 LYS 219 218 218 LYS LYS A . n A 1 220 PRO 220 219 219 PRO PRO A . n A 1 221 TRP 221 220 220 TRP TRP A . n A 1 222 ASN 222 221 221 ASN ASN A . n A 1 223 TYR 223 222 222 TYR TYR A . n A 1 224 THR 224 223 223 THR THR A . n A 1 225 TYR 225 224 224 TYR TYR A . n A 1 226 ASP 226 225 225 ASP ASP A . n A 1 227 PRO 227 226 226 PRO PRO A . n A 1 228 LYS 228 227 227 LYS LYS A . n A 1 229 THR 229 228 228 THR THR A . n A 1 230 LYS 230 229 229 LYS LYS A . n A 1 231 SER 231 230 230 SER SER A . n A 1 232 VAL 232 231 231 VAL VAL A . n A 1 233 LYS 233 232 232 LYS LYS A . n A 1 234 SER 234 233 233 SER SER A . n A 1 235 GLU 235 234 ? ? ? A . n A 1 236 ALA 236 235 ? ? ? A . n A 1 237 HIS 237 236 ? ? ? A . n A 1 238 ASP 238 237 ? ? ? A . n A 1 239 PRO 239 238 ? ? ? A . n A 1 240 ASN 240 239 ? ? ? A . n A 1 241 MET 241 240 ? ? ? A . n A 1 242 THR 242 241 241 THR THR A . n A 1 243 HIS 243 242 242 HIS HIS A . n A 1 244 PRO 244 243 243 PRO PRO A . n A 1 245 GLU 245 244 244 GLU GLU A . n A 1 246 PHE 246 245 245 PHE PHE A . n A 1 247 LEU 247 246 246 LEU LEU A . n A 1 248 ILE 248 247 247 ILE ILE A . n A 1 249 LEU 249 248 248 LEU LEU A . n A 1 250 TRP 250 249 249 TRP TRP A . n A 1 251 TRP 251 250 250 TRP TRP A . n A 1 252 ASN 252 251 251 ASN ASN A . n A 1 253 ILE 253 252 252 ILE ILE A . n A 1 254 PHE 254 253 253 PHE PHE A . n A 1 255 THR 255 254 254 THR THR A . n A 1 256 THR 256 255 255 THR THR A . n A 1 257 ASN 257 256 256 ASN ASN A . n A 1 258 VAL 258 257 257 VAL VAL A . n A 1 259 LEU 259 258 258 LEU LEU A . n A 1 260 PRO 260 259 259 PRO PRO A . n A 1 261 LEU 261 260 260 LEU LEU A . n A 1 262 LEU 262 261 261 LEU LEU A . n A 1 263 GLN 263 262 262 GLN GLN A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5030 ? 1 MORE -37 ? 1 'SSA (A^2)' 21850 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 57.4000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 405 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id I _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O2B ? C UDP . ? A UDP 264 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 OD2 ? A ASP 103 ? A ASP 102 ? 1_555 108.1 ? 2 O2B ? C UDP . ? A UDP 264 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 OD1 ? A ASP 105 ? A ASP 104 ? 1_555 144.2 ? 3 OD2 ? A ASP 103 ? A ASP 102 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 OD1 ? A ASP 105 ? A ASP 104 ? 1_555 105.7 ? 4 O2B ? C UDP . ? A UDP 264 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 NE2 ? A HIS 213 ? A HIS 212 ? 1_555 96.3 ? 5 OD2 ? A ASP 103 ? A ASP 102 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 NE2 ? A HIS 213 ? A HIS 212 ? 1_555 102.2 ? 6 OD1 ? A ASP 105 ? A ASP 104 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 NE2 ? A HIS 213 ? A HIS 212 ? 1_555 87.6 ? 7 O2B ? C UDP . ? A UDP 264 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 O1A ? C UDP . ? A UDP 264 ? 1_555 81.4 ? 8 OD2 ? A ASP 103 ? A ASP 102 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 O1A ? C UDP . ? A UDP 264 ? 1_555 93.1 ? 9 OD1 ? A ASP 105 ? A ASP 104 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 O1A ? C UDP . ? A UDP 264 ? 1_555 85.5 ? 10 NE2 ? A HIS 213 ? A HIS 212 ? 1_555 MN ? B MN . ? A MN 263 ? 1_555 O1A ? C UDP . ? A UDP 264 ? 1_555 164.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-03-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2011-12-28 4 'Structure model' 1 3 2012-01-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 17.7050 15.3700 11.6080 0.0492 0.0282 0.0782 0.0179 0.0274 -0.0323 1.4858 1.6531 0.8631 -0.0181 0.4937 -0.2820 -0.0098 -0.1035 -0.0492 0.0109 0.0409 0.0279 -0.0024 -0.0457 -0.0310 'X-RAY DIFFRACTION' 2 ? refined 3.9900 8.5990 -1.1910 0.2481 0.1295 0.0607 -0.1204 -0.0756 -0.0180 10.1656 12.2057 11.6414 -4.8141 2.1290 3.5360 0.0029 -0.0664 -0.7227 -1.5372 0.2017 0.5087 0.2854 -0.9196 -0.2046 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 0 ? ? A 231 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 232 ? ? A 262 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CrystalClear 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.5.0110 ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 104 ? ? CG A ASP 104 ? ? OD1 A ASP 104 ? ? 126.60 118.30 8.30 0.90 N 2 1 CB A ASP 104 ? ? CG A ASP 104 ? ? OD2 A ASP 104 ? ? 112.42 118.30 -5.88 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 171 ? ? -97.01 55.51 2 1 ASP A 178 ? ? 54.56 93.68 3 1 ASN A 188 ? ? -166.44 67.66 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 192 ? CG1 ? A ILE 193 CG1 2 1 Y 1 A ILE 192 ? CG2 ? A ILE 193 CG2 3 1 Y 1 A ILE 192 ? CD1 ? A ILE 193 CD1 4 1 Y 1 A ARG 216 ? CG ? A ARG 217 CG 5 1 Y 1 A ARG 216 ? CD ? A ARG 217 CD 6 1 Y 1 A ARG 216 ? NE ? A ARG 217 NE 7 1 Y 1 A ARG 216 ? CZ ? A ARG 217 CZ 8 1 Y 1 A ARG 216 ? NH1 ? A ARG 217 NH1 9 1 Y 1 A ARG 216 ? NH2 ? A ARG 217 NH2 10 1 Y 1 A THR 241 ? OG1 ? A THR 242 OG1 11 1 Y 1 A THR 241 ? CG2 ? A THR 242 CG2 12 1 Y 1 A HIS 242 ? CG ? A HIS 243 CG 13 1 Y 1 A HIS 242 ? ND1 ? A HIS 243 ND1 14 1 Y 1 A HIS 242 ? CD2 ? A HIS 243 CD2 15 1 Y 1 A HIS 242 ? CE1 ? A HIS 243 CE1 16 1 Y 1 A HIS 242 ? NE2 ? A HIS 243 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 193 ? A SER 194 2 1 Y 1 A ILE 194 ? A ILE 195 3 1 Y 1 A PHE 195 ? A PHE 196 4 1 Y 1 A SER 196 ? A SER 197 5 1 Y 1 A TYR 197 ? A TYR 198 6 1 Y 1 A GLU 234 ? A GLU 235 7 1 Y 1 A ALA 235 ? A ALA 236 8 1 Y 1 A HIS 236 ? A HIS 237 9 1 Y 1 A ASP 237 ? A ASP 238 10 1 Y 1 A PRO 238 ? A PRO 239 11 1 Y 1 A ASN 239 ? A ASN 240 12 1 Y 1 A MET 240 ? A MET 241 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 "URIDINE-5'-DIPHOSPHATE" UDP 4 1,2-ETHANEDIOL EDO 5 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 263 1 MN MN A . C 3 UDP 1 264 1 UDP UDP A . D 4 EDO 1 265 1 EDO EDO A . E 4 EDO 1 266 2 EDO EDO A . F 4 EDO 1 267 3 EDO EDO A . G 4 EDO 1 268 4 EDO EDO A . H 4 EDO 1 269 5 EDO EDO A . I 5 HOH 1 270 2 HOH HOH A . I 5 HOH 2 271 3 HOH HOH A . I 5 HOH 3 272 5 HOH HOH A . I 5 HOH 4 273 7 HOH HOH A . I 5 HOH 5 274 8 HOH HOH A . I 5 HOH 6 275 9 HOH HOH A . I 5 HOH 7 276 11 HOH HOH A . I 5 HOH 8 277 12 HOH HOH A . I 5 HOH 9 278 13 HOH HOH A . I 5 HOH 10 279 15 HOH HOH A . I 5 HOH 11 280 16 HOH HOH A . I 5 HOH 12 281 17 HOH HOH A . I 5 HOH 13 282 18 HOH HOH A . I 5 HOH 14 283 19 HOH HOH A . I 5 HOH 15 284 21 HOH HOH A . I 5 HOH 16 285 23 HOH HOH A . I 5 HOH 17 286 24 HOH HOH A . I 5 HOH 18 287 25 HOH HOH A . I 5 HOH 19 288 27 HOH HOH A . I 5 HOH 20 289 28 HOH HOH A . I 5 HOH 21 290 29 HOH HOH A . I 5 HOH 22 291 30 HOH HOH A . I 5 HOH 23 292 31 HOH HOH A . I 5 HOH 24 293 32 HOH HOH A . I 5 HOH 25 294 33 HOH HOH A . I 5 HOH 26 295 34 HOH HOH A . I 5 HOH 27 296 35 HOH HOH A . I 5 HOH 28 297 36 HOH HOH A . I 5 HOH 29 298 38 HOH HOH A . I 5 HOH 30 299 39 HOH HOH A . I 5 HOH 31 300 41 HOH HOH A . I 5 HOH 32 301 42 HOH HOH A . I 5 HOH 33 302 43 HOH HOH A . I 5 HOH 34 303 44 HOH HOH A . I 5 HOH 35 304 45 HOH HOH A . I 5 HOH 36 305 46 HOH HOH A . I 5 HOH 37 306 48 HOH HOH A . I 5 HOH 38 307 49 HOH HOH A . I 5 HOH 39 308 50 HOH HOH A . I 5 HOH 40 309 51 HOH HOH A . I 5 HOH 41 310 54 HOH HOH A . I 5 HOH 42 311 55 HOH HOH A . I 5 HOH 43 312 56 HOH HOH A . I 5 HOH 44 313 57 HOH HOH A . I 5 HOH 45 314 58 HOH HOH A . I 5 HOH 46 315 59 HOH HOH A . I 5 HOH 47 316 60 HOH HOH A . I 5 HOH 48 317 61 HOH HOH A . I 5 HOH 49 318 63 HOH HOH A . I 5 HOH 50 319 64 HOH HOH A . I 5 HOH 51 320 66 HOH HOH A . I 5 HOH 52 321 67 HOH HOH A . I 5 HOH 53 322 68 HOH HOH A . I 5 HOH 54 323 69 HOH HOH A . I 5 HOH 55 324 71 HOH HOH A . I 5 HOH 56 325 72 HOH HOH A . I 5 HOH 57 326 73 HOH HOH A . I 5 HOH 58 327 74 HOH HOH A . I 5 HOH 59 328 75 HOH HOH A . I 5 HOH 60 329 76 HOH HOH A . I 5 HOH 61 330 77 HOH HOH A . I 5 HOH 62 331 78 HOH HOH A . I 5 HOH 63 332 79 HOH HOH A . I 5 HOH 64 333 80 HOH HOH A . I 5 HOH 65 334 81 HOH HOH A . I 5 HOH 66 335 82 HOH HOH A . I 5 HOH 67 336 83 HOH HOH A . I 5 HOH 68 337 84 HOH HOH A . I 5 HOH 69 338 85 HOH HOH A . I 5 HOH 70 339 86 HOH HOH A . I 5 HOH 71 340 87 HOH HOH A . I 5 HOH 72 341 88 HOH HOH A . I 5 HOH 73 342 89 HOH HOH A . I 5 HOH 74 343 90 HOH HOH A . I 5 HOH 75 344 91 HOH HOH A . I 5 HOH 76 345 92 HOH HOH A . I 5 HOH 77 346 93 HOH HOH A . I 5 HOH 78 347 94 HOH HOH A . I 5 HOH 79 348 95 HOH HOH A . I 5 HOH 80 349 96 HOH HOH A . I 5 HOH 81 350 97 HOH HOH A . I 5 HOH 82 351 98 HOH HOH A . I 5 HOH 83 352 102 HOH HOH A . I 5 HOH 84 353 103 HOH HOH A . I 5 HOH 85 354 105 HOH HOH A . I 5 HOH 86 355 106 HOH HOH A . I 5 HOH 87 356 107 HOH HOH A . I 5 HOH 88 357 108 HOH HOH A . I 5 HOH 89 358 110 HOH HOH A . I 5 HOH 90 359 111 HOH HOH A . I 5 HOH 91 360 113 HOH HOH A . I 5 HOH 92 361 114 HOH HOH A . I 5 HOH 93 362 115 HOH HOH A . I 5 HOH 94 363 116 HOH HOH A . I 5 HOH 95 364 117 HOH HOH A . I 5 HOH 96 365 118 HOH HOH A . I 5 HOH 97 366 119 HOH HOH A . I 5 HOH 98 367 120 HOH HOH A . I 5 HOH 99 368 121 HOH HOH A . I 5 HOH 100 369 122 HOH HOH A . I 5 HOH 101 370 123 HOH HOH A . I 5 HOH 102 371 124 HOH HOH A . I 5 HOH 103 372 125 HOH HOH A . I 5 HOH 104 373 127 HOH HOH A . I 5 HOH 105 374 128 HOH HOH A . I 5 HOH 106 375 129 HOH HOH A . I 5 HOH 107 376 130 HOH HOH A . I 5 HOH 108 377 131 HOH HOH A . I 5 HOH 109 378 132 HOH HOH A . I 5 HOH 110 379 133 HOH HOH A . I 5 HOH 111 380 134 HOH HOH A . I 5 HOH 112 381 135 HOH HOH A . I 5 HOH 113 382 138 HOH HOH A . I 5 HOH 114 383 139 HOH HOH A . I 5 HOH 115 384 140 HOH HOH A . I 5 HOH 116 385 141 HOH HOH A . I 5 HOH 117 386 142 HOH HOH A . I 5 HOH 118 387 144 HOH HOH A . I 5 HOH 119 388 145 HOH HOH A . I 5 HOH 120 389 146 HOH HOH A . I 5 HOH 121 390 147 HOH HOH A . I 5 HOH 122 391 148 HOH HOH A . I 5 HOH 123 392 149 HOH HOH A . I 5 HOH 124 393 150 HOH HOH A . I 5 HOH 125 394 151 HOH HOH A . I 5 HOH 126 395 152 HOH HOH A . I 5 HOH 127 396 153 HOH HOH A . I 5 HOH 128 397 154 HOH HOH A . I 5 HOH 129 398 155 HOH HOH A . I 5 HOH 130 399 156 HOH HOH A . I 5 HOH 131 400 157 HOH HOH A . I 5 HOH 132 401 158 HOH HOH A . I 5 HOH 133 402 159 HOH HOH A . I 5 HOH 134 403 160 HOH HOH A . I 5 HOH 135 404 161 HOH HOH A . I 5 HOH 136 405 162 HOH HOH A . #