data_3QZK # _entry.id 3QZK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3QZK RCSB RCSB064301 WWPDB D_1000064301 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2012-02-29 _pdbx_database_PDB_obs_spr.pdb_id 4DQ4 _pdbx_database_PDB_obs_spr.replace_pdb_id 3QZK _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3NPO 'Bovine beta lactoglobulin unliganded form' unspecified PDB 3NQ3 'Bovine beta-lactoglobulin complex with capric acid' unspecified PDB 3NQ9 'Bovine beta-lactoglobulin complex with caprylic acid' unspecified PDB 3QZJ 'Bovine beta-lactoglobulin complex with oleic acid' unspecified # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 3QZK _pdbx_database_status.recvd_initial_deposition_date 2011-03-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Loch, J.' 1 'Ries, D.' 2 'Kurpiewska, K.' 3 'Lewinski, K.' 4 # _citation.id primary _citation.title 'Bovine beta-lactoglobulin complex with linoleic acid' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Loch, J.' 1 primary 'Ries, D.' 2 primary 'Kurpiewska, K.' 3 primary 'Lewinski, K.' 4 # _cell.entry_id 3QZK _cell.length_a 53.330 _cell.length_b 53.330 _cell.length_c 111.530 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3QZK _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Beta-lactoglobulin 18301.174 1 ? ? ? ? 2 non-polymer syn 'LINOLEIC ACID' 280.445 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn ETHANOL 46.068 1 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 water nat water 18.015 97 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-LG # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_seq_one_letter_code_can ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 ILE n 1 3 VAL n 1 4 THR n 1 5 GLN n 1 6 THR n 1 7 MET n 1 8 LYS n 1 9 GLY n 1 10 LEU n 1 11 ASP n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 VAL n 1 16 ALA n 1 17 GLY n 1 18 THR n 1 19 TRP n 1 20 TYR n 1 21 SER n 1 22 LEU n 1 23 ALA n 1 24 MET n 1 25 ALA n 1 26 ALA n 1 27 SER n 1 28 ASP n 1 29 ILE n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 ASP n 1 34 ALA n 1 35 GLN n 1 36 SER n 1 37 ALA n 1 38 PRO n 1 39 LEU n 1 40 ARG n 1 41 VAL n 1 42 TYR n 1 43 VAL n 1 44 GLU n 1 45 GLU n 1 46 LEU n 1 47 LYS n 1 48 PRO n 1 49 THR n 1 50 PRO n 1 51 GLU n 1 52 GLY n 1 53 ASP n 1 54 LEU n 1 55 GLU n 1 56 ILE n 1 57 LEU n 1 58 LEU n 1 59 GLN n 1 60 LYS n 1 61 TRP n 1 62 GLU n 1 63 ASN n 1 64 GLY n 1 65 GLU n 1 66 CYS n 1 67 ALA n 1 68 GLN n 1 69 LYS n 1 70 LYS n 1 71 ILE n 1 72 ILE n 1 73 ALA n 1 74 GLU n 1 75 LYS n 1 76 THR n 1 77 LYS n 1 78 ILE n 1 79 PRO n 1 80 ALA n 1 81 VAL n 1 82 PHE n 1 83 LYS n 1 84 ILE n 1 85 ASP n 1 86 ALA n 1 87 LEU n 1 88 ASN n 1 89 GLU n 1 90 ASN n 1 91 LYS n 1 92 VAL n 1 93 LEU n 1 94 VAL n 1 95 LEU n 1 96 ASP n 1 97 THR n 1 98 ASP n 1 99 TYR n 1 100 LYS n 1 101 LYS n 1 102 TYR n 1 103 LEU n 1 104 LEU n 1 105 PHE n 1 106 CYS n 1 107 MET n 1 108 GLU n 1 109 ASN n 1 110 SER n 1 111 ALA n 1 112 GLU n 1 113 PRO n 1 114 GLU n 1 115 GLN n 1 116 SER n 1 117 LEU n 1 118 ALA n 1 119 CYS n 1 120 GLN n 1 121 CYS n 1 122 LEU n 1 123 VAL n 1 124 ARG n 1 125 THR n 1 126 PRO n 1 127 GLU n 1 128 VAL n 1 129 ASP n 1 130 ASP n 1 131 GLU n 1 132 ALA n 1 133 LEU n 1 134 GLU n 1 135 LYS n 1 136 PHE n 1 137 ASP n 1 138 LYS n 1 139 ALA n 1 140 LEU n 1 141 LYS n 1 142 ALA n 1 143 LEU n 1 144 PRO n 1 145 MET n 1 146 HIS n 1 147 ILE n 1 148 ARG n 1 149 LEU n 1 150 SER n 1 151 PHE n 1 152 ASN n 1 153 PRO n 1 154 THR n 1 155 GLN n 1 156 LEU n 1 157 GLU n 1 158 GLU n 1 159 GLN n 1 160 CYS n 1 161 HIS n 1 162 ILE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name bovine _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue MILK _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LACB_BOVIN _struct_ref.pdbx_db_accession P02754 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _struct_ref.pdbx_align_begin 17 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3QZK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02754 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 178 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EIC non-polymer . 'LINOLEIC ACID' '9,12-LINOLEIC ACID' 'C18 H32 O2' 280.445 EOH non-polymer . ETHANOL ? 'C2 H6 O' 46.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3QZK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_percent_sol 50.83 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details ;0.1M Tris-HCl buffer, 1.34M tri-sodium citrate, 1mM linoleic acid in ethanol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'AGILENT ATLAS CCD' _diffrn_detector.pdbx_collection_date 2009-11-05 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'SEALED TUBE' _diffrn_source.type 'OXFORD DIFFRACTION ENHANCE ULTRA' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.54 # _reflns.entry_id 3QZK _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 15.06 _reflns.d_resolution_high 1.90 _reflns.number_obs 14719 _reflns.number_all ? _reflns.percent_possible_obs 97.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_rejects _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.90 2.00 94.63 0.18 ? 2.15 ? ? 2005 ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 2.00 2.12 96.46 0.12 ? 3.42 ? ? 1965 ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 2.12 2.27 97.16 0.09 ? 4.36 ? ? 1868 ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 2.27 2.45 98.87 0.07 ? 5.27 ? ? 1780 ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 2.45 2.69 99.78 0.06 ? 7.08 ? ? 1673 ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 2.69 3.00 99.96 0.06 ? 9.98 ? ? 1522 ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 3.00 3.47 99.96 0.05 ? 13.33 ? ? 1341 ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 3.47 4.25 100.00 0.04 ? 15.75 ? ? 1165 ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 4.25 6.01 99.75 0.04 ? 17.50 ? ? 926 ? ? ? ? ? ? ? ? ? ? ? ? ? 9 1 6.01 15.06 87.46 0.03 ? 15.66 ? ? 474 ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 # _refine.entry_id 3QZK _refine.ls_number_reflns_obs 13199 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 13.35 _refine.ls_d_res_high 1.90 _refine.ls_percent_reflns_obs 97.80 _refine.ls_R_factor_obs 0.22815 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.22205 _refine.ls_R_factor_R_free 0.28098 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.1 _refine.ls_number_reflns_R_free 1486 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.910 _refine.B_iso_mean 28.415 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 1BSY' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.187 _refine.overall_SU_ML 0.146 _refine.overall_SU_B 5.026 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1280 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 97 _refine_hist.number_atoms_total 1407 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 13.35 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.022 ? 1412 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.898 2.013 ? 1918 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.797 5.000 ? 182 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 43.077 26.949 ? 59 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.831 15.000 ? 276 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 16.825 15.000 ? 3 'X-RAY DIFFRACTION' ? r_chiral_restr 0.120 0.200 ? 220 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1039 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.245 0.200 ? 699 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.304 0.200 ? 966 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.192 0.200 ? 124 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.209 0.200 ? 49 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.251 0.200 ? 19 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.225 1.500 ? 888 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.054 2.000 ? 1411 'X-RAY DIFFRACTION' ? r_scbond_it 2.385 3.000 ? 583 'X-RAY DIFFRACTION' ? r_scangle_it 3.620 4.500 ? 501 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.900 _refine_ls_shell.d_res_low 1.949 _refine_ls_shell.number_reflns_R_work 868 _refine_ls_shell.R_factor_R_work 0.291 _refine_ls_shell.percent_reflns_obs 94.21 _refine_ls_shell.R_factor_R_free 0.349 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 108 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 3QZK _struct.title 'Bovine beta-lactoglobulin complex with linoleic acid' _struct.pdbx_descriptor Beta-lactoglobulin _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3QZK _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'lactoglobulin, linoleic acid, unsaturated fatty acids, lipocalin, transport protein, milk protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? ALA A 16 ? ASP A 11 ALA A 16 5 ? 6 HELX_P HELX_P2 2 ASP A 28 ? LEU A 32 ? ASP A 28 LEU A 32 5 ? 5 HELX_P HELX_P3 3 ASP A 129 ? ALA A 142 ? ASP A 129 ALA A 142 1 ? 14 HELX_P HELX_P4 4 PRO A 153 ? LEU A 156 ? PRO A 153 LEU A 156 1 ? 4 HELX_P HELX_P5 5 GLN A 159 ? HIS A 161 ? GLN A 159 HIS A 161 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 160 SG ? ? A CYS 66 A CYS 160 1_555 ? ? ? ? ? ? ? 2.021 ? disulf2 disulf ? ? A CYS 106 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 106 A CYS 119 1_555 ? ? ? ? ? ? ? 2.007 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 85 A . ? ASP 85 A ALA 86 A ? ALA 86 A 1 -23.38 2 ALA 111 A . ? ALA 111 A GLU 112 A ? GLU 112 A 1 -7.70 3 GLU 112 A . ? GLU 112 A PRO 113 A ? PRO 113 A 1 -25.91 4 PRO 113 A . ? PRO 113 A GLU 114 A ? GLU 114 A 1 12.53 5 GLU 114 A . ? GLU 114 A GLN 115 A ? GLN 115 A 1 22.30 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 17 ? THR A 18 ? GLY A 17 THR A 18 A 2 TYR A 42 ? PRO A 48 ? TYR A 42 PRO A 48 A 3 LEU A 54 ? GLU A 62 ? LEU A 54 GLU A 62 A 4 GLU A 65 ? LYS A 75 ? GLU A 65 LYS A 75 A 5 VAL A 81 ? ILE A 84 ? VAL A 81 ILE A 84 A 6 ASN A 90 ? THR A 97 ? ASN A 90 THR A 97 A 7 TYR A 102 ? ASN A 109 ? TYR A 102 ASN A 109 A 8 LEU A 117 ? VAL A 123 ? LEU A 117 VAL A 123 A 9 TYR A 20 ? ALA A 26 ? TYR A 20 ALA A 26 A 10 ILE A 147 ? SER A 150 ? ILE A 147 SER A 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 17 ? N GLY A 17 O LEU A 46 ? O LEU A 46 A 2 3 N LYS A 47 ? N LYS A 47 O GLU A 55 ? O GLU A 55 A 3 4 N ILE A 56 ? N ILE A 56 O ILE A 71 ? O ILE A 71 A 4 5 N GLU A 74 ? N GLU A 74 O LYS A 83 ? O LYS A 83 A 5 6 N ILE A 84 ? N ILE A 84 O ASN A 90 ? O ASN A 90 A 6 7 N ASP A 96 ? N ASP A 96 O LEU A 104 ? O LEU A 104 A 7 8 N MET A 107 ? N MET A 107 O ALA A 118 ? O ALA A 118 A 8 9 O CYS A 119 ? O CYS A 119 N ALA A 25 ? N ALA A 25 A 9 10 N MET A 24 ? N MET A 24 O LEU A 149 ? O LEU A 149 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE EIC A 999' AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 3968' AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EOH A 3371' AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL A 163' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 VAL A 41 ? VAL A 41 . ? 1_555 ? 2 AC1 9 ILE A 56 ? ILE A 56 . ? 1_555 ? 3 AC1 9 LYS A 60 ? LYS A 60 . ? 1_555 ? 4 AC1 9 GLU A 62 ? GLU A 62 . ? 1_555 ? 5 AC1 9 ILE A 71 ? ILE A 71 . ? 1_555 ? 6 AC1 9 VAL A 92 ? VAL A 92 . ? 1_555 ? 7 AC1 9 VAL A 94 ? VAL A 94 . ? 1_555 ? 8 AC1 9 PHE A 105 ? PHE A 105 . ? 1_555 ? 9 AC1 9 MET A 107 ? MET A 107 . ? 1_555 ? 10 AC2 8 GLN A 5 ? GLN A 5 . ? 1_555 ? 11 AC2 8 THR A 6 ? THR A 6 . ? 1_555 ? 12 AC2 8 LEU A 95 ? LEU A 95 . ? 1_555 ? 13 AC2 8 ASP A 96 ? ASP A 96 . ? 1_555 ? 14 AC2 8 ALA A 139 ? ALA A 139 . ? 1_555 ? 15 AC2 8 HOH F . ? HOH A 164 . ? 1_555 ? 16 AC2 8 HOH F . ? HOH A 237 . ? 1_555 ? 17 AC2 8 HOH F . ? HOH A 257 . ? 1_555 ? 18 AC3 4 THR A 76 ? THR A 76 . ? 1_555 ? 19 AC3 4 LYS A 77 ? LYS A 77 . ? 1_555 ? 20 AC3 4 LYS A 83 ? LYS A 83 . ? 1_555 ? 21 AC3 4 HOH F . ? HOH A 198 . ? 1_555 ? 22 AC4 6 LYS A 75 ? LYS A 75 . ? 1_555 ? 23 AC4 6 THR A 76 ? THR A 76 . ? 1_555 ? 24 AC4 6 ILE A 78 ? ILE A 78 . ? 1_555 ? 25 AC4 6 PRO A 79 ? PRO A 79 . ? 1_555 ? 26 AC4 6 VAL A 81 ? VAL A 81 . ? 1_555 ? 27 AC4 6 PHE A 82 ? PHE A 82 . ? 1_555 ? # _database_PDB_matrix.entry_id 3QZK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3QZK _atom_sites.fract_transf_matrix[1][1] 0.018751 _atom_sites.fract_transf_matrix[1][2] 0.010826 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021652 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008966 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 ILE 162 162 162 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EIC 1 999 999 EIC EIC A . C 3 GOL 1 3968 3968 GOL GOL A . D 4 EOH 1 3371 3371 EOH EOH A . E 5 CL 1 163 163 CL CL A . F 6 HOH 1 164 164 HOH HOH A . F 6 HOH 2 165 165 HOH HOH A . F 6 HOH 3 166 166 HOH HOH A . F 6 HOH 4 167 167 HOH HOH A . F 6 HOH 5 168 168 HOH HOH A . F 6 HOH 6 169 169 HOH HOH A . F 6 HOH 7 170 170 HOH HOH A . F 6 HOH 8 171 171 HOH HOH A . F 6 HOH 9 172 172 HOH HOH A . F 6 HOH 10 173 173 HOH HOH A . F 6 HOH 11 174 174 HOH HOH A . F 6 HOH 12 175 175 HOH HOH A . F 6 HOH 13 176 176 HOH HOH A . F 6 HOH 14 177 177 HOH HOH A . F 6 HOH 15 178 178 HOH HOH A . F 6 HOH 16 179 179 HOH HOH A . F 6 HOH 17 180 180 HOH HOH A . F 6 HOH 18 181 181 HOH HOH A . F 6 HOH 19 182 182 HOH HOH A . F 6 HOH 20 183 183 HOH HOH A . F 6 HOH 21 184 184 HOH HOH A . F 6 HOH 22 185 185 HOH HOH A . F 6 HOH 23 186 186 HOH HOH A . F 6 HOH 24 187 187 HOH HOH A . F 6 HOH 25 188 188 HOH HOH A . F 6 HOH 26 189 189 HOH HOH A . F 6 HOH 27 190 190 HOH HOH A . F 6 HOH 28 191 191 HOH HOH A . F 6 HOH 29 192 192 HOH HOH A . F 6 HOH 30 193 193 HOH HOH A . F 6 HOH 31 194 194 HOH HOH A . F 6 HOH 32 195 195 HOH HOH A . F 6 HOH 33 196 196 HOH HOH A . F 6 HOH 34 197 197 HOH HOH A . F 6 HOH 35 198 198 HOH HOH A . F 6 HOH 36 199 199 HOH HOH A . F 6 HOH 37 200 200 HOH HOH A . F 6 HOH 38 201 201 HOH HOH A . F 6 HOH 39 202 202 HOH HOH A . F 6 HOH 40 203 203 HOH HOH A . F 6 HOH 41 204 204 HOH HOH A . F 6 HOH 42 205 205 HOH HOH A . F 6 HOH 43 206 206 HOH HOH A . F 6 HOH 44 207 207 HOH HOH A . F 6 HOH 45 208 208 HOH HOH A . F 6 HOH 46 209 209 HOH HOH A . F 6 HOH 47 210 210 HOH HOH A . F 6 HOH 48 211 211 HOH HOH A . F 6 HOH 49 212 212 HOH HOH A . F 6 HOH 50 213 213 HOH HOH A . F 6 HOH 51 214 214 HOH HOH A . F 6 HOH 52 215 215 HOH HOH A . F 6 HOH 53 216 216 HOH HOH A . F 6 HOH 54 217 217 HOH HOH A . F 6 HOH 55 218 218 HOH HOH A . F 6 HOH 56 219 219 HOH HOH A . F 6 HOH 57 220 220 HOH HOH A . F 6 HOH 58 221 221 HOH HOH A . F 6 HOH 59 222 222 HOH HOH A . F 6 HOH 60 223 223 HOH HOH A . F 6 HOH 61 224 224 HOH HOH A . F 6 HOH 62 225 225 HOH HOH A . F 6 HOH 63 226 226 HOH HOH A . F 6 HOH 64 227 227 HOH HOH A . F 6 HOH 65 228 228 HOH HOH A . F 6 HOH 66 229 229 HOH HOH A . F 6 HOH 67 230 230 HOH HOH A . F 6 HOH 68 231 231 HOH HOH A . F 6 HOH 69 232 232 HOH HOH A . F 6 HOH 70 233 233 HOH HOH A . F 6 HOH 71 234 234 HOH HOH A . F 6 HOH 72 235 235 HOH HOH A . F 6 HOH 73 236 236 HOH HOH A . F 6 HOH 74 237 237 HOH HOH A . F 6 HOH 75 238 238 HOH HOH A . F 6 HOH 76 239 239 HOH HOH A . F 6 HOH 77 240 240 HOH HOH A . F 6 HOH 78 241 241 HOH HOH A . F 6 HOH 79 242 242 HOH HOH A . F 6 HOH 80 243 243 HOH HOH A . F 6 HOH 81 244 244 HOH HOH A . F 6 HOH 82 245 245 HOH HOH A . F 6 HOH 83 246 246 HOH HOH A . F 6 HOH 84 247 247 HOH HOH A . F 6 HOH 85 248 248 HOH HOH A . F 6 HOH 86 249 249 HOH HOH A . F 6 HOH 87 250 250 HOH HOH A . F 6 HOH 88 251 251 HOH HOH A . F 6 HOH 89 252 252 HOH HOH A . F 6 HOH 90 253 253 HOH HOH A . F 6 HOH 91 254 254 HOH HOH A . F 6 HOH 92 255 255 HOH HOH A . F 6 HOH 93 256 256 HOH HOH A . F 6 HOH 94 257 257 HOH HOH A . F 6 HOH 95 258 258 HOH HOH A . F 6 HOH 96 259 259 HOH HOH A . F 6 HOH 97 260 260 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+2/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 74.3533333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-03-30 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-02-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 3 'Structure model' repository Obsolete ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CrysalisPro 'data collection' . ? 1 MOLREP 'model building' . ? 2 REFMAC refinement 5.2.0005 ? 3 CrysalisPro 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 MOLREP phasing . ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O1 A GOL 3968 ? ? O A HOH 164 ? ? 2.01 2 1 OE1 A GLU 62 ? ? O A HOH 165 ? ? 2.15 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 87 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 87 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 87 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.51 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 14.21 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 33 ? B -55.94 -70.89 2 1 ASP A 85 ? ? 8.30 -75.35 3 1 ALA A 86 ? ? -143.54 -24.40 4 1 LEU A 87 ? ? -179.45 -70.35 5 1 ASN A 88 ? ? 77.08 81.56 6 1 TYR A 99 ? ? 65.70 -38.61 7 1 LYS A 101 ? ? -126.66 -56.76 8 1 ALA A 111 ? ? 61.96 -174.38 9 1 GLU A 114 ? ? 67.18 145.91 10 1 CYS A 160 ? ? 59.78 15.82 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LEU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 87 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASN _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 88 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 31.24 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'LINOLEIC ACID' EIC 3 GLYCEROL GOL 4 ETHANOL EOH 5 'CHLORIDE ION' CL 6 water HOH #