data_3R0S # _entry.id 3R0S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.382 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3R0S pdb_00003r0s 10.2210/pdb3r0s/pdb RCSB RCSB064345 ? ? WWPDB D_1000064345 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id IDP90748 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3R0S _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-03-08 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Osipiuk, J.' 1 'Zhou, M.' 2 'Papazisi, L.' 3 'Anderson, W.F.' 4 'Joachimiak, A.' 5 'Center for Structural Genomics of Infectious Diseases (CSGID)' 6 # _citation.id primary _citation.title 'UDP-N-acetylglucosamine acyltransferase from Campylobacter jejuni.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Osipiuk, J.' 1 ? primary 'Zhou, M.' 2 ? primary 'Papazisi, L.' 3 ? primary 'Anderson, W.F.' 4 ? primary 'Joachimiak, A.' 5 ? # _cell.length_a 98.959 _cell.length_b 98.959 _cell.length_c 157.463 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 3R0S _cell.pdbx_unique_axis ? _cell.Z_PDB 18 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'H 3 2' _symmetry.entry_id 3R0S _symmetry.Int_Tables_number 155 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase' 29149.574 1 2.3.1.129 ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UDP-N-acetylglucosamine acyltransferase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)KKIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDIPQDISY KEEQKSGVVIGKNATIREFATINSGTAKGDGFTRIGDNAFI(MSE)AYCHIAHDCLLGNNIILANNATLAGHVELGDFTV VGGLTPIHQFVKVGEGC(MSE)IAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRRFDKDEVDRLSRAFKTLFRQGDLK ENAKNLLENQESENVKK(MSE)CHFILETKRGIPVYRGKNNA ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMKKIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDIPQDISYKEEQ KSGVVIGKNATIREFATINSGTAKGDGFTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIH QFVKVGEGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRRFDKDEVDRLSRAFKTLFRQGDLKENAKNLLENQES ENVKKMCHFILETKRGIPVYRGKNNA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier IDP90748 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 LYS n 1 6 LYS n 1 7 ILE n 1 8 HIS n 1 9 PRO n 1 10 SER n 1 11 ALA n 1 12 VAL n 1 13 ILE n 1 14 GLU n 1 15 GLU n 1 16 GLY n 1 17 ALA n 1 18 GLN n 1 19 LEU n 1 20 GLY n 1 21 ASP n 1 22 ASP n 1 23 VAL n 1 24 VAL n 1 25 ILE n 1 26 GLU n 1 27 ALA n 1 28 TYR n 1 29 ALA n 1 30 TYR n 1 31 VAL n 1 32 SER n 1 33 LYS n 1 34 ASP n 1 35 ALA n 1 36 LYS n 1 37 ILE n 1 38 GLY n 1 39 ASN n 1 40 ASN n 1 41 VAL n 1 42 VAL n 1 43 ILE n 1 44 LYS n 1 45 GLN n 1 46 GLY n 1 47 ALA n 1 48 ARG n 1 49 ILE n 1 50 LEU n 1 51 SER n 1 52 ASP n 1 53 THR n 1 54 THR n 1 55 ILE n 1 56 GLY n 1 57 ASP n 1 58 HIS n 1 59 SER n 1 60 ARG n 1 61 VAL n 1 62 PHE n 1 63 SER n 1 64 TYR n 1 65 ALA n 1 66 ILE n 1 67 VAL n 1 68 GLY n 1 69 ASP n 1 70 ILE n 1 71 PRO n 1 72 GLN n 1 73 ASP n 1 74 ILE n 1 75 SER n 1 76 TYR n 1 77 LYS n 1 78 GLU n 1 79 GLU n 1 80 GLN n 1 81 LYS n 1 82 SER n 1 83 GLY n 1 84 VAL n 1 85 VAL n 1 86 ILE n 1 87 GLY n 1 88 LYS n 1 89 ASN n 1 90 ALA n 1 91 THR n 1 92 ILE n 1 93 ARG n 1 94 GLU n 1 95 PHE n 1 96 ALA n 1 97 THR n 1 98 ILE n 1 99 ASN n 1 100 SER n 1 101 GLY n 1 102 THR n 1 103 ALA n 1 104 LYS n 1 105 GLY n 1 106 ASP n 1 107 GLY n 1 108 PHE n 1 109 THR n 1 110 ARG n 1 111 ILE n 1 112 GLY n 1 113 ASP n 1 114 ASN n 1 115 ALA n 1 116 PHE n 1 117 ILE n 1 118 MSE n 1 119 ALA n 1 120 TYR n 1 121 CYS n 1 122 HIS n 1 123 ILE n 1 124 ALA n 1 125 HIS n 1 126 ASP n 1 127 CYS n 1 128 LEU n 1 129 LEU n 1 130 GLY n 1 131 ASN n 1 132 ASN n 1 133 ILE n 1 134 ILE n 1 135 LEU n 1 136 ALA n 1 137 ASN n 1 138 ASN n 1 139 ALA n 1 140 THR n 1 141 LEU n 1 142 ALA n 1 143 GLY n 1 144 HIS n 1 145 VAL n 1 146 GLU n 1 147 LEU n 1 148 GLY n 1 149 ASP n 1 150 PHE n 1 151 THR n 1 152 VAL n 1 153 VAL n 1 154 GLY n 1 155 GLY n 1 156 LEU n 1 157 THR n 1 158 PRO n 1 159 ILE n 1 160 HIS n 1 161 GLN n 1 162 PHE n 1 163 VAL n 1 164 LYS n 1 165 VAL n 1 166 GLY n 1 167 GLU n 1 168 GLY n 1 169 CYS n 1 170 MSE n 1 171 ILE n 1 172 ALA n 1 173 GLY n 1 174 ALA n 1 175 SER n 1 176 ALA n 1 177 LEU n 1 178 SER n 1 179 GLN n 1 180 ASP n 1 181 ILE n 1 182 VAL n 1 183 PRO n 1 184 PHE n 1 185 CYS n 1 186 LEU n 1 187 ALA n 1 188 GLU n 1 189 GLY n 1 190 ASN n 1 191 ARG n 1 192 ALA n 1 193 SER n 1 194 ILE n 1 195 ARG n 1 196 SER n 1 197 LEU n 1 198 ASN n 1 199 LEU n 1 200 VAL n 1 201 GLY n 1 202 ILE n 1 203 ARG n 1 204 ARG n 1 205 ARG n 1 206 PHE n 1 207 ASP n 1 208 LYS n 1 209 ASP n 1 210 GLU n 1 211 VAL n 1 212 ASP n 1 213 ARG n 1 214 LEU n 1 215 SER n 1 216 ARG n 1 217 ALA n 1 218 PHE n 1 219 LYS n 1 220 THR n 1 221 LEU n 1 222 PHE n 1 223 ARG n 1 224 GLN n 1 225 GLY n 1 226 ASP n 1 227 LEU n 1 228 LYS n 1 229 GLU n 1 230 ASN n 1 231 ALA n 1 232 LYS n 1 233 ASN n 1 234 LEU n 1 235 LEU n 1 236 GLU n 1 237 ASN n 1 238 GLN n 1 239 GLU n 1 240 SER n 1 241 GLU n 1 242 ASN n 1 243 VAL n 1 244 LYS n 1 245 LYS n 1 246 MSE n 1 247 CYS n 1 248 HIS n 1 249 PHE n 1 250 ILE n 1 251 LEU n 1 252 GLU n 1 253 THR n 1 254 LYS n 1 255 ARG n 1 256 GLY n 1 257 ILE n 1 258 PRO n 1 259 VAL n 1 260 TYR n 1 261 ARG n 1 262 GLY n 1 263 LYS n 1 264 ASN n 1 265 ASN n 1 266 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cj0274, lpxA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'NCTC 11168' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Campylobacter jejuni subsp. jejuni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 192222 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LPXA_CAMJE _struct_ref.pdbx_db_accession Q9PIM1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDIPQDISYKEEQKSG VVIGKNATIREFATINSGTAKGDGFTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFV KVGEGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRRFDKDEVDRLSRAFKTLFRQGDLKENAKNLLENQESENV KKMCHFILETKRGIPVYRGKNNA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3R0S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 266 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9PIM1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 263 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 263 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3R0S SER A 1 ? UNP Q9PIM1 ? ? 'expression tag' -2 1 1 3R0S ASN A 2 ? UNP Q9PIM1 ? ? 'expression tag' -1 2 1 3R0S ALA A 3 ? UNP Q9PIM1 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3R0S _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 51.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.temp 289 _exptl_crystal_grow.pdbx_details '20% PEG MME 5000, 0.1 M Bis-tris buffer, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 289K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2009-12-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'double crystal monochromator' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID # _reflns.entry_id 3R0S _reflns.d_resolution_high 2.220 _reflns.d_resolution_low 41.3 _reflns.number_obs 14945 _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_netI_over_sigmaI 7.400 _reflns.pdbx_chi_squared 2.063 _reflns.pdbx_redundancy 24.000 _reflns.percent_possible_obs 99.300 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.number_all 14945 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate 48.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 2.220 2.260 ? ? ? 0.823 4.41 ? 1.168 19.700 ? 716 98.800 ? 1 2.260 2.300 ? ? ? 0.886 ? ? 1.205 20.600 ? 739 99.300 ? 2 2.300 2.340 ? ? ? 0.668 ? ? 1.263 21.700 ? 730 99.200 ? 3 2.340 2.390 ? ? ? 0.666 ? ? 1.219 22.700 ? 730 98.900 ? 4 2.390 2.440 ? ? ? 0.684 ? ? 1.220 23.600 ? 735 99.300 ? 5 2.440 2.500 ? ? ? 0.531 ? ? 1.267 24.300 ? 749 99.300 ? 6 2.500 2.560 ? ? ? 0.474 ? ? 1.202 24.800 ? 728 99.300 ? 7 2.560 2.630 ? ? ? 0.415 ? ? 1.228 25.000 ? 745 99.200 ? 8 2.630 2.710 ? ? ? 0.346 ? ? 1.311 25.400 ? 745 99.700 ? 9 2.710 2.800 ? ? ? 0.301 ? ? 1.319 25.500 ? 748 99.500 ? 10 2.800 2.900 ? ? ? 0.235 ? ? 1.495 25.600 ? 734 99.500 ? 11 2.900 3.010 ? ? ? 0.192 ? ? 1.611 25.500 ? 760 99.600 ? 12 3.010 3.150 ? ? ? 0.169 ? ? 1.696 25.500 ? 735 99.600 ? 13 3.150 3.320 ? ? ? 0.128 ? ? 2.009 25.300 ? 754 99.600 ? 14 3.320 3.520 ? ? ? 0.113 ? ? 2.330 25.100 ? 757 99.600 ? 15 3.520 3.800 ? ? ? 0.096 ? ? 2.755 24.800 ? 742 99.600 ? 16 3.800 4.180 ? ? ? 0.083 ? ? 3.142 24.400 ? 753 99.900 ? 17 4.180 4.780 ? ? ? 0.077 ? ? 3.544 24.000 ? 763 98.300 ? 18 4.780 6.020 ? ? ? 0.079 ? ? 3.728 23.800 ? 773 99.400 ? 19 6.020 50.000 ? ? ? 0.072 ? ? 6.027 22.700 ? 809 99.100 ? 20 # _refine.entry_id 3R0S _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 41.4000 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.3600 _refine.ls_number_reflns_obs 13358 _refine.ls_number_reflns_all 13358 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES: WITH TLS ADDED' _refine.ls_R_factor_all 0.1978 _refine.ls_R_factor_obs 0.1978 _refine.ls_R_factor_R_work 0.1957 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2395 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_number_reflns_R_free 654 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 52.2621 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -1.3000 _refine.aniso_B[2][2] -1.3000 _refine.aniso_B[3][3] 1.9500 _refine.aniso_B[1][2] -0.6500 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9560 _refine.correlation_coeff_Fo_to_Fc_free 0.9310 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R_Free 0.2240 _refine.overall_SU_ML 0.1610 _refine.overall_SU_B 14.4570 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 1J2Z _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 97.070 _refine.B_iso_min 25.850 _refine.occupancy_max 1.000 _refine.occupancy_min 0.400 _refine.pdbx_ls_sigma_I 0 _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1925 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 1960 _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 41.4000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 2035 0.019 0.022 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 1406 0.001 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2756 1.585 1.952 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 3431 0.923 3.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 271 6.732 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 98 36.878 23.878 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 370 17.021 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 18 22.550 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 313 0.089 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 2313 0.007 0.020 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 421 0.001 0.020 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 1272 0.828 1.500 ? ? 'X-RAY DIFFRACTION' r_mcbond_other 533 0.217 1.500 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 2052 1.455 2.000 ? ? 'X-RAY DIFFRACTION' r_scbond_it 763 2.223 3.000 ? ? 'X-RAY DIFFRACTION' r_scangle_it 693 3.491 4.500 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.3000 _refine_ls_shell.d_res_low 2.3600 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 98.9800 _refine_ls_shell.number_reflns_R_work 920 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2170 _refine_ls_shell.R_factor_R_free 0.3120 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 48 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 968 _refine_ls_shell.number_reflns_obs 968 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3R0S _struct.title 'UDP-N-acetylglucosamine acyltransferase from Campylobacter jejuni' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3R0S _struct_keywords.text 'structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, lipid A biosynthesis, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 198 ? PHE A 206 ? ASN A 195 PHE A 203 1 ? 9 HELX_P HELX_P2 2 ASP A 207 ? ARG A 223 ? ASP A 204 ARG A 220 1 ? 17 HELX_P HELX_P3 3 ASP A 226 ? GLU A 236 ? ASP A 223 GLU A 233 1 ? 11 HELX_P HELX_P4 4 SER A 240 ? THR A 253 ? SER A 237 THR A 250 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ILE 117 C ? ? ? 1_555 A MSE 118 N ? ? A ILE 114 A MSE 115 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale2 covale both ? A MSE 118 C ? ? ? 1_555 A ALA 119 N ? ? A MSE 115 A ALA 116 1_555 ? ? ? ? ? ? ? 1.313 ? ? covale3 covale both ? A CYS 169 C ? ? ? 1_555 A MSE 170 N ? ? A CYS 166 A MSE 167 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale4 covale both ? A MSE 170 C ? ? ? 1_555 A ILE 171 N ? ? A MSE 167 A ILE 168 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale5 covale both ? A LYS 245 C ? ? ? 1_555 A MSE 246 N ? ? A LYS 242 A MSE 243 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale6 covale both ? A MSE 246 C ? ? ? 1_555 A CYS 247 N ? ? A MSE 243 A CYS 244 1_555 ? ? ? ? ? ? ? 1.337 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 190 A . ? ASN 187 A ARG 191 A ? ARG 188 A 1 -2.11 2 ASN 190 A . ? ASN 187 A ARG 191 A ? ARG 188 A 1 -3.61 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 8 ? C ? 10 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel A 7 8 ? parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? parallel B 6 7 ? parallel B 7 8 ? parallel C 1 2 ? parallel C 2 3 ? parallel C 3 4 ? parallel C 4 5 ? parallel C 5 6 ? parallel C 6 7 ? parallel C 7 8 ? parallel C 8 9 ? parallel C 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 12 ? ILE A 13 ? VAL A 9 ILE A 10 A 2 TYR A 30 ? VAL A 31 ? TYR A 27 VAL A 28 A 3 ARG A 48 ? ILE A 49 ? ARG A 45 ILE A 46 A 4 ILE A 66 ? ASP A 69 ? ILE A 63 ASP A 66 A 5 THR A 97 ? ASN A 99 ? THR A 94 ASN A 96 A 6 HIS A 122 ? ILE A 123 ? HIS A 119 ILE A 120 A 7 THR A 140 ? LEU A 141 ? THR A 137 LEU A 138 A 8 PRO A 158 ? ILE A 159 ? PRO A 155 ILE A 156 B 1 GLN A 18 ? LEU A 19 ? GLN A 15 LEU A 16 B 2 LYS A 36 ? ILE A 37 ? LYS A 33 ILE A 34 B 3 THR A 54 ? ILE A 55 ? THR A 51 ILE A 52 B 4 GLY A 83 ? ILE A 86 ? GLY A 80 ILE A 83 B 5 PHE A 108 ? ILE A 111 ? PHE A 105 ILE A 108 B 6 LEU A 128 ? LEU A 129 ? LEU A 125 LEU A 126 B 7 GLU A 146 ? LEU A 147 ? GLU A 143 LEU A 144 B 8 LYS A 164 ? VAL A 165 ? LYS A 161 VAL A 162 C 1 VAL A 24 ? ILE A 25 ? VAL A 21 ILE A 22 C 2 VAL A 42 ? ILE A 43 ? VAL A 39 ILE A 40 C 3 ARG A 60 ? VAL A 61 ? ARG A 57 VAL A 58 C 4 THR A 91 ? ILE A 92 ? THR A 88 ILE A 89 C 5 PHE A 116 ? ILE A 117 ? PHE A 113 ILE A 114 C 6 ILE A 134 ? LEU A 135 ? ILE A 131 LEU A 132 C 7 VAL A 152 ? VAL A 153 ? VAL A 149 VAL A 150 C 8 MSE A 170 ? ILE A 171 ? MSE A 167 ILE A 168 C 9 CYS A 185 ? GLU A 188 ? CYS A 182 GLU A 185 C 10 SER A 193 ? LEU A 197 ? SER A 190 LEU A 194 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 12 ? N VAL A 9 O VAL A 31 ? O VAL A 28 A 2 3 N TYR A 30 ? N TYR A 27 O ILE A 49 ? O ILE A 46 A 3 4 N ARG A 48 ? N ARG A 45 O VAL A 67 ? O VAL A 64 A 4 5 N GLY A 68 ? N GLY A 65 O ILE A 98 ? O ILE A 95 A 5 6 N THR A 97 ? N THR A 94 O ILE A 123 ? O ILE A 120 A 6 7 N HIS A 122 ? N HIS A 119 O LEU A 141 ? O LEU A 138 A 7 8 N THR A 140 ? N THR A 137 O ILE A 159 ? O ILE A 156 B 1 2 N GLN A 18 ? N GLN A 15 O ILE A 37 ? O ILE A 34 B 2 3 N LYS A 36 ? N LYS A 33 O ILE A 55 ? O ILE A 52 B 3 4 N THR A 54 ? N THR A 51 O ILE A 86 ? O ILE A 83 B 4 5 N VAL A 85 ? N VAL A 82 O ILE A 111 ? O ILE A 108 B 5 6 N ARG A 110 ? N ARG A 107 O LEU A 129 ? O LEU A 126 B 6 7 N LEU A 128 ? N LEU A 125 O LEU A 147 ? O LEU A 144 B 7 8 N GLU A 146 ? N GLU A 143 O VAL A 165 ? O VAL A 162 C 1 2 N VAL A 24 ? N VAL A 21 O ILE A 43 ? O ILE A 40 C 2 3 N VAL A 42 ? N VAL A 39 O VAL A 61 ? O VAL A 58 C 3 4 N ARG A 60 ? N ARG A 57 O ILE A 92 ? O ILE A 89 C 4 5 N THR A 91 ? N THR A 88 O ILE A 117 ? O ILE A 114 C 5 6 N PHE A 116 ? N PHE A 113 O LEU A 135 ? O LEU A 132 C 6 7 N ILE A 134 ? N ILE A 131 O VAL A 153 ? O VAL A 150 C 7 8 N VAL A 152 ? N VAL A 149 O ILE A 171 ? O ILE A 168 C 8 9 N MSE A 170 ? N MSE A 167 O ALA A 187 ? O ALA A 184 C 9 10 N LEU A 186 ? N LEU A 183 O SER A 196 ? O SER A 193 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CL _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE CL A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 LYS A 44 ? LYS A 41 . ? 3_555 ? 2 AC1 4 PHE A 62 ? PHE A 59 . ? 3_555 ? 3 AC1 4 ASP A 69 ? ASP A 66 . ? 1_555 ? 4 AC1 4 ILE A 70 ? ILE A 67 . ? 1_555 ? # _atom_sites.entry_id 3R0S _atom_sites.fract_transf_matrix[1][1] 0.010105 _atom_sites.fract_transf_matrix[1][2] 0.005834 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011668 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006351 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MSE 4 1 ? ? ? A . n A 1 5 LYS 5 2 ? ? ? A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 ILE 7 4 4 ILE ILE A . n A 1 8 HIS 8 5 5 HIS HIS A . n A 1 9 PRO 9 6 6 PRO PRO A . n A 1 10 SER 10 7 7 SER SER A . n A 1 11 ALA 11 8 8 ALA ALA A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 ILE 13 10 10 ILE ILE A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 ALA 17 14 14 ALA ALA A . n A 1 18 GLN 18 15 15 GLN GLN A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 GLY 20 17 17 GLY GLY A . n A 1 21 ASP 21 18 18 ASP ASP A . n A 1 22 ASP 22 19 19 ASP ASP A . n A 1 23 VAL 23 20 20 VAL VAL A . n A 1 24 VAL 24 21 21 VAL VAL A . n A 1 25 ILE 25 22 22 ILE ILE A . n A 1 26 GLU 26 23 23 GLU GLU A . n A 1 27 ALA 27 24 24 ALA ALA A . n A 1 28 TYR 28 25 25 TYR TYR A . n A 1 29 ALA 29 26 26 ALA ALA A . n A 1 30 TYR 30 27 27 TYR TYR A . n A 1 31 VAL 31 28 28 VAL VAL A . n A 1 32 SER 32 29 29 SER SER A . n A 1 33 LYS 33 30 30 LYS LYS A . n A 1 34 ASP 34 31 31 ASP ASP A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 ILE 37 34 34 ILE ILE A . n A 1 38 GLY 38 35 35 GLY GLY A . n A 1 39 ASN 39 36 36 ASN ASN A . n A 1 40 ASN 40 37 37 ASN ASN A . n A 1 41 VAL 41 38 38 VAL VAL A . n A 1 42 VAL 42 39 39 VAL VAL A . n A 1 43 ILE 43 40 40 ILE ILE A . n A 1 44 LYS 44 41 41 LYS LYS A . n A 1 45 GLN 45 42 42 GLN GLN A . n A 1 46 GLY 46 43 43 GLY GLY A . n A 1 47 ALA 47 44 44 ALA ALA A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 LEU 50 47 47 LEU LEU A . n A 1 51 SER 51 48 48 SER SER A . n A 1 52 ASP 52 49 49 ASP ASP A . n A 1 53 THR 53 50 50 THR THR A . n A 1 54 THR 54 51 51 THR THR A . n A 1 55 ILE 55 52 52 ILE ILE A . n A 1 56 GLY 56 53 53 GLY GLY A . n A 1 57 ASP 57 54 54 ASP ASP A . n A 1 58 HIS 58 55 55 HIS HIS A . n A 1 59 SER 59 56 56 SER SER A . n A 1 60 ARG 60 57 57 ARG ARG A . n A 1 61 VAL 61 58 58 VAL VAL A . n A 1 62 PHE 62 59 59 PHE PHE A . n A 1 63 SER 63 60 60 SER SER A . n A 1 64 TYR 64 61 61 TYR TYR A . n A 1 65 ALA 65 62 62 ALA ALA A . n A 1 66 ILE 66 63 63 ILE ILE A . n A 1 67 VAL 67 64 64 VAL VAL A . n A 1 68 GLY 68 65 65 GLY GLY A . n A 1 69 ASP 69 66 66 ASP ASP A . n A 1 70 ILE 70 67 67 ILE ILE A . n A 1 71 PRO 71 68 68 PRO PRO A . n A 1 72 GLN 72 69 69 GLN GLN A . n A 1 73 ASP 73 70 70 ASP ASP A . n A 1 74 ILE 74 71 71 ILE ILE A . n A 1 75 SER 75 72 72 SER SER A . n A 1 76 TYR 76 73 73 TYR TYR A . n A 1 77 LYS 77 74 ? ? ? A . n A 1 78 GLU 78 75 ? ? ? A . n A 1 79 GLU 79 76 ? ? ? A . n A 1 80 GLN 80 77 ? ? ? A . n A 1 81 LYS 81 78 78 LYS LYS A . n A 1 82 SER 82 79 79 SER SER A . n A 1 83 GLY 83 80 80 GLY GLY A . n A 1 84 VAL 84 81 81 VAL VAL A . n A 1 85 VAL 85 82 82 VAL VAL A . n A 1 86 ILE 86 83 83 ILE ILE A . n A 1 87 GLY 87 84 84 GLY GLY A . n A 1 88 LYS 88 85 85 LYS LYS A . n A 1 89 ASN 89 86 86 ASN ASN A . n A 1 90 ALA 90 87 87 ALA ALA A . n A 1 91 THR 91 88 88 THR THR A . n A 1 92 ILE 92 89 89 ILE ILE A . n A 1 93 ARG 93 90 90 ARG ARG A . n A 1 94 GLU 94 91 91 GLU GLU A . n A 1 95 PHE 95 92 92 PHE PHE A . n A 1 96 ALA 96 93 93 ALA ALA A . n A 1 97 THR 97 94 94 THR THR A . n A 1 98 ILE 98 95 95 ILE ILE A . n A 1 99 ASN 99 96 96 ASN ASN A . n A 1 100 SER 100 97 97 SER SER A . n A 1 101 GLY 101 98 98 GLY GLY A . n A 1 102 THR 102 99 99 THR THR A . n A 1 103 ALA 103 100 100 ALA ALA A . n A 1 104 LYS 104 101 101 LYS LYS A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 ASP 106 103 103 ASP ASP A . n A 1 107 GLY 107 104 104 GLY GLY A . n A 1 108 PHE 108 105 105 PHE PHE A . n A 1 109 THR 109 106 106 THR THR A . n A 1 110 ARG 110 107 107 ARG ARG A . n A 1 111 ILE 111 108 108 ILE ILE A . n A 1 112 GLY 112 109 109 GLY GLY A . n A 1 113 ASP 113 110 110 ASP ASP A . n A 1 114 ASN 114 111 111 ASN ASN A . n A 1 115 ALA 115 112 112 ALA ALA A . n A 1 116 PHE 116 113 113 PHE PHE A . n A 1 117 ILE 117 114 114 ILE ILE A . n A 1 118 MSE 118 115 115 MSE MSE A . n A 1 119 ALA 119 116 116 ALA ALA A . n A 1 120 TYR 120 117 117 TYR TYR A . n A 1 121 CYS 121 118 118 CYS CYS A . n A 1 122 HIS 122 119 119 HIS HIS A . n A 1 123 ILE 123 120 120 ILE ILE A . n A 1 124 ALA 124 121 121 ALA ALA A . n A 1 125 HIS 125 122 122 HIS HIS A . n A 1 126 ASP 126 123 123 ASP ASP A . n A 1 127 CYS 127 124 124 CYS CYS A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 GLY 130 127 127 GLY GLY A . n A 1 131 ASN 131 128 128 ASN ASN A . n A 1 132 ASN 132 129 129 ASN ASN A . n A 1 133 ILE 133 130 130 ILE ILE A . n A 1 134 ILE 134 131 131 ILE ILE A . n A 1 135 LEU 135 132 132 LEU LEU A . n A 1 136 ALA 136 133 133 ALA ALA A . n A 1 137 ASN 137 134 134 ASN ASN A . n A 1 138 ASN 138 135 135 ASN ASN A . n A 1 139 ALA 139 136 136 ALA ALA A . n A 1 140 THR 140 137 137 THR THR A . n A 1 141 LEU 141 138 138 LEU LEU A . n A 1 142 ALA 142 139 139 ALA ALA A . n A 1 143 GLY 143 140 140 GLY GLY A . n A 1 144 HIS 144 141 141 HIS HIS A . n A 1 145 VAL 145 142 142 VAL VAL A . n A 1 146 GLU 146 143 143 GLU GLU A . n A 1 147 LEU 147 144 144 LEU LEU A . n A 1 148 GLY 148 145 145 GLY GLY A . n A 1 149 ASP 149 146 146 ASP ASP A . n A 1 150 PHE 150 147 147 PHE PHE A . n A 1 151 THR 151 148 148 THR THR A . n A 1 152 VAL 152 149 149 VAL VAL A . n A 1 153 VAL 153 150 150 VAL VAL A . n A 1 154 GLY 154 151 151 GLY GLY A . n A 1 155 GLY 155 152 152 GLY GLY A . n A 1 156 LEU 156 153 153 LEU LEU A . n A 1 157 THR 157 154 154 THR THR A . n A 1 158 PRO 158 155 155 PRO PRO A . n A 1 159 ILE 159 156 156 ILE ILE A . n A 1 160 HIS 160 157 157 HIS HIS A . n A 1 161 GLN 161 158 158 GLN GLN A . n A 1 162 PHE 162 159 159 PHE PHE A . n A 1 163 VAL 163 160 160 VAL VAL A . n A 1 164 LYS 164 161 161 LYS LYS A . n A 1 165 VAL 165 162 162 VAL VAL A . n A 1 166 GLY 166 163 163 GLY GLY A . n A 1 167 GLU 167 164 164 GLU GLU A . n A 1 168 GLY 168 165 165 GLY GLY A . n A 1 169 CYS 169 166 166 CYS CYS A . n A 1 170 MSE 170 167 167 MSE MSE A . n A 1 171 ILE 171 168 168 ILE ILE A . n A 1 172 ALA 172 169 169 ALA ALA A . n A 1 173 GLY 173 170 170 GLY GLY A . n A 1 174 ALA 174 171 171 ALA ALA A . n A 1 175 SER 175 172 172 SER SER A . n A 1 176 ALA 176 173 173 ALA ALA A . n A 1 177 LEU 177 174 174 LEU LEU A . n A 1 178 SER 178 175 175 SER SER A . n A 1 179 GLN 179 176 176 GLN GLN A . n A 1 180 ASP 180 177 177 ASP ASP A . n A 1 181 ILE 181 178 178 ILE ILE A . n A 1 182 VAL 182 179 179 VAL VAL A . n A 1 183 PRO 183 180 180 PRO PRO A . n A 1 184 PHE 184 181 181 PHE PHE A . n A 1 185 CYS 185 182 182 CYS CYS A . n A 1 186 LEU 186 183 183 LEU LEU A . n A 1 187 ALA 187 184 184 ALA ALA A . n A 1 188 GLU 188 185 185 GLU GLU A . n A 1 189 GLY 189 186 186 GLY GLY A . n A 1 190 ASN 190 187 187 ASN ASN A . n A 1 191 ARG 191 188 188 ARG ARG A . n A 1 192 ALA 192 189 189 ALA ALA A . n A 1 193 SER 193 190 190 SER SER A . n A 1 194 ILE 194 191 191 ILE ILE A . n A 1 195 ARG 195 192 192 ARG ARG A . n A 1 196 SER 196 193 193 SER SER A . n A 1 197 LEU 197 194 194 LEU LEU A . n A 1 198 ASN 198 195 195 ASN ASN A . n A 1 199 LEU 199 196 196 LEU LEU A . n A 1 200 VAL 200 197 197 VAL VAL A . n A 1 201 GLY 201 198 198 GLY GLY A . n A 1 202 ILE 202 199 199 ILE ILE A . n A 1 203 ARG 203 200 200 ARG ARG A . n A 1 204 ARG 204 201 201 ARG ARG A . n A 1 205 ARG 205 202 202 ARG ARG A . n A 1 206 PHE 206 203 203 PHE PHE A . n A 1 207 ASP 207 204 204 ASP ASP A . n A 1 208 LYS 208 205 205 LYS LYS A . n A 1 209 ASP 209 206 206 ASP ASP A . n A 1 210 GLU 210 207 207 GLU GLU A . n A 1 211 VAL 211 208 208 VAL VAL A . n A 1 212 ASP 212 209 209 ASP ASP A . n A 1 213 ARG 213 210 210 ARG ARG A . n A 1 214 LEU 214 211 211 LEU LEU A . n A 1 215 SER 215 212 212 SER SER A . n A 1 216 ARG 216 213 213 ARG ARG A . n A 1 217 ALA 217 214 214 ALA ALA A . n A 1 218 PHE 218 215 215 PHE PHE A . n A 1 219 LYS 219 216 216 LYS LYS A . n A 1 220 THR 220 217 217 THR THR A . n A 1 221 LEU 221 218 218 LEU LEU A . n A 1 222 PHE 222 219 219 PHE PHE A . n A 1 223 ARG 223 220 220 ARG ARG A . n A 1 224 GLN 224 221 221 GLN GLN A . n A 1 225 GLY 225 222 222 GLY GLY A . n A 1 226 ASP 226 223 223 ASP ASP A . n A 1 227 LEU 227 224 224 LEU LEU A . n A 1 228 LYS 228 225 225 LYS LYS A . n A 1 229 GLU 229 226 226 GLU GLU A . n A 1 230 ASN 230 227 227 ASN ASN A . n A 1 231 ALA 231 228 228 ALA ALA A . n A 1 232 LYS 232 229 229 LYS LYS A . n A 1 233 ASN 233 230 230 ASN ASN A . n A 1 234 LEU 234 231 231 LEU LEU A . n A 1 235 LEU 235 232 232 LEU LEU A . n A 1 236 GLU 236 233 233 GLU GLU A . n A 1 237 ASN 237 234 234 ASN ASN A . n A 1 238 GLN 238 235 235 GLN GLN A . n A 1 239 GLU 239 236 236 GLU GLU A . n A 1 240 SER 240 237 237 SER SER A . n A 1 241 GLU 241 238 238 GLU GLU A . n A 1 242 ASN 242 239 239 ASN ASN A . n A 1 243 VAL 243 240 240 VAL VAL A . n A 1 244 LYS 244 241 241 LYS LYS A . n A 1 245 LYS 245 242 242 LYS LYS A . n A 1 246 MSE 246 243 243 MSE MSE A . n A 1 247 CYS 247 244 244 CYS CYS A . n A 1 248 HIS 248 245 245 HIS HIS A . n A 1 249 PHE 249 246 246 PHE PHE A . n A 1 250 ILE 250 247 247 ILE ILE A . n A 1 251 LEU 251 248 248 LEU LEU A . n A 1 252 GLU 252 249 249 GLU GLU A . n A 1 253 THR 253 250 250 THR THR A . n A 1 254 LYS 254 251 251 LYS LYS A . n A 1 255 ARG 255 252 252 ARG ARG A . n A 1 256 GLY 256 253 253 GLY GLY A . n A 1 257 ILE 257 254 254 ILE ILE A . n A 1 258 PRO 258 255 255 PRO PRO A . n A 1 259 VAL 259 256 256 VAL VAL A . n A 1 260 TYR 260 257 257 TYR TYR A . n A 1 261 ARG 261 258 258 ARG ARG A . n A 1 262 GLY 262 259 ? ? ? A . n A 1 263 LYS 263 260 ? ? ? A . n A 1 264 ASN 264 261 ? ? ? A . n A 1 265 ASN 265 262 ? ? ? A . n A 1 266 ALA 266 263 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.initial_of_center CSGID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 301 301 CL CL A . C 3 HOH 1 264 1 HOH HOH A . C 3 HOH 2 265 2 HOH HOH A . C 3 HOH 3 266 3 HOH HOH A . C 3 HOH 4 267 4 HOH HOH A . C 3 HOH 5 268 5 HOH HOH A . C 3 HOH 6 269 6 HOH HOH A . C 3 HOH 7 270 7 HOH HOH A . C 3 HOH 8 271 8 HOH HOH A . C 3 HOH 9 272 9 HOH HOH A . C 3 HOH 10 273 10 HOH HOH A . C 3 HOH 11 274 11 HOH HOH A . C 3 HOH 12 275 12 HOH HOH A . C 3 HOH 13 276 13 HOH HOH A . C 3 HOH 14 277 14 HOH HOH A . C 3 HOH 15 278 15 HOH HOH A . C 3 HOH 16 279 16 HOH HOH A . C 3 HOH 17 280 17 HOH HOH A . C 3 HOH 18 281 18 HOH HOH A . C 3 HOH 19 282 19 HOH HOH A . C 3 HOH 20 283 20 HOH HOH A . C 3 HOH 21 284 21 HOH HOH A . C 3 HOH 22 285 22 HOH HOH A . C 3 HOH 23 286 23 HOH HOH A . C 3 HOH 24 287 24 HOH HOH A . C 3 HOH 25 288 25 HOH HOH A . C 3 HOH 26 289 26 HOH HOH A . C 3 HOH 27 290 27 HOH HOH A . C 3 HOH 28 291 28 HOH HOH A . C 3 HOH 29 292 29 HOH HOH A . C 3 HOH 30 293 30 HOH HOH A . C 3 HOH 31 294 31 HOH HOH A . C 3 HOH 32 295 32 HOH HOH A . C 3 HOH 33 296 33 HOH HOH A . C 3 HOH 34 297 34 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 118 A MSE 115 ? MET SELENOMETHIONINE 2 A MSE 170 A MSE 167 ? MET SELENOMETHIONINE 3 A MSE 246 A MSE 243 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6120 ? 1 MORE -55 ? 1 'SSA (A^2)' 29940 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-03-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-08 4 'Structure model' 1 3 2023-09-13 5 'Structure model' 1 4 2023-12-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 8 5 'Structure model' '_chem_comp_atom.atom_id' 9 5 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 7.9921 _pdbx_refine_tls.origin_y 16.2569 _pdbx_refine_tls.origin_z 32.9904 _pdbx_refine_tls.T[1][1] 0.0738 _pdbx_refine_tls.T[2][2] 0.1115 _pdbx_refine_tls.T[3][3] 0.2384 _pdbx_refine_tls.T[1][2] 0.0011 _pdbx_refine_tls.T[1][3] -0.0118 _pdbx_refine_tls.T[2][3] 0.0185 _pdbx_refine_tls.L[1][1] 1.7652 _pdbx_refine_tls.L[2][2] 1.8634 _pdbx_refine_tls.L[3][3] 4.3444 _pdbx_refine_tls.L[1][2] 0.4085 _pdbx_refine_tls.L[1][3] 0.1173 _pdbx_refine_tls.L[2][3] -2.0540 _pdbx_refine_tls.S[1][1] -0.0271 _pdbx_refine_tls.S[2][2] 0.0053 _pdbx_refine_tls.S[3][3] 0.0218 _pdbx_refine_tls.S[1][2] 0.4085 _pdbx_refine_tls.S[1][3] 0.2548 _pdbx_refine_tls.S[2][3] -0.0857 _pdbx_refine_tls.S[2][1] -0.1553 _pdbx_refine_tls.S[3][1] 0.1061 _pdbx_refine_tls.S[3][2] 0.1778 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 3 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 258 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 REFMAC 5.5.0109 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 SBC-Collect . ? ? ? ? 'data collection' ? ? ? 6 HKL-3000 . ? ? ? ? 'data reduction' ? ? ? 7 HKL-3000 . ? ? ? ? 'data scaling' ? ? ? 8 MOLREP . ? ? ? ? phasing ? ? ? 9 HKL-3000 . ? ? ? ? phasing ? ? ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SER _pdbx_validate_symm_contact.auth_seq_id_1 7 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OH _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 TYR _pdbx_validate_symm_contact.auth_seq_id_2 25 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_555 _pdbx_validate_symm_contact.dist 2.06 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 90 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 90 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 90 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.92 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.62 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 48 ? ? 64.28 -153.96 2 1 SER A 193 ? ? -178.35 -178.40 3 1 ASN A 234 ? ? 57.70 16.77 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MSE 1 ? A MSE 4 5 1 Y 1 A LYS 2 ? A LYS 5 6 1 Y 1 A LYS 74 ? A LYS 77 7 1 Y 1 A GLU 75 ? A GLU 78 8 1 Y 1 A GLU 76 ? A GLU 79 9 1 Y 1 A GLN 77 ? A GLN 80 10 1 Y 1 A GLY 259 ? A GLY 262 11 1 Y 1 A LYS 260 ? A LYS 263 12 1 Y 1 A ASN 261 ? A ASN 264 13 1 Y 1 A ASN 262 ? A ASN 265 14 1 Y 1 A ALA 263 ? A ALA 266 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MSE N N N N 231 MSE CA C N S 232 MSE C C N N 233 MSE O O N N 234 MSE OXT O N N 235 MSE CB C N N 236 MSE CG C N N 237 MSE SE SE N N 238 MSE CE C N N 239 MSE H H N N 240 MSE H2 H N N 241 MSE HA H N N 242 MSE HXT H N N 243 MSE HB2 H N N 244 MSE HB3 H N N 245 MSE HG2 H N N 246 MSE HG3 H N N 247 MSE HE1 H N N 248 MSE HE2 H N N 249 MSE HE3 H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1J2Z _pdbx_initial_refinement_model.details ? #