data_3R22 # _entry.id 3R22 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3R22 RCSB RCSB064390 WWPDB D_1000064390 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3R21 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3R22 _pdbx_database_status.recvd_initial_deposition_date 2011-03-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, L.' 1 'Fan, J.' 2 'Chong, J.-H.' 3 'Cesana, A.' 4 'Tam, B.' 5 'Gilson, C.' 6 'Boykin, C.' 7 'Wang, D.' 8 'Marcotte, D.' 9 'Le Brazidec, J.-Y.' 10 'Aivazian, D.' 11 'Piao, J.' 12 'Lundgren, K.' 13 'Hong, K.' 14 'Vu, K.' 15 'Nguyen, K.' 16 # _citation.id primary _citation.title ;Design, synthesis, and biological evaluation of pyrazolopyrimidine-sulfonamides as potent multiple-mitotic kinase (MMK) inhibitors (part I). ; _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_volume 21 _citation.page_first 5633 _citation.page_last 5637 _citation.year 2011 _citation.journal_id_ASTM BMCLE8 _citation.country UK _citation.journal_id_ISSN 0960-894X _citation.journal_id_CSD 1127 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21798738 _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2011.06.129 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhang, L.' 1 primary 'Fan, J.' 2 primary 'Chong, J.H.' 3 primary 'Cesena, A.' 4 primary 'Tam, B.Y.' 5 primary 'Gilson, C.' 6 primary 'Boykin, C.' 7 primary 'Wang, D.' 8 primary 'Aivazian, D.' 9 primary 'Marcotte, D.' 10 primary 'Xiao, G.' 11 primary 'Le Brazidec, J.Y.' 12 primary 'Piao, J.' 13 primary 'Lundgren, K.' 14 primary 'Hong, K.' 15 primary 'Vu, K.' 16 primary 'Nguyen, K.' 17 primary 'Gan, L.S.' 18 primary 'Silvian, L.' 19 primary 'Ling, L.' 20 primary 'Teng, M.' 21 primary 'Reff, M.' 22 primary 'Takeda, N.' 23 primary 'Timple, N.' 24 primary 'Wang, Q.' 25 primary 'Morena, R.' 26 primary 'Khan, S.' 27 primary 'Zhao, S.' 28 primary 'Li, T.' 29 primary 'Lee, W.C.' 30 primary 'Taveras, A.G.' 31 primary 'Chao, J.' 32 # _cell.entry_id 3R22 _cell.length_a 81.384 _cell.length_b 81.384 _cell.length_c 166.393 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3R22 _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase 6' 31346.939 1 2.7.11.1 'T287D, T288D' 'unp residues 126-391' ? 2 non-polymer syn 'N-{5-[(1-cycloheptyl-1H-pyrazolo[3,4-d]pyrimidin-6-yl)amino]pyridin-2-yl}methanesulfonamide' 401.486 1 ? ? ? ? 3 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora kinase A, Aurora/IPL1-related kinase 1, ARK-1, Aurora-related kinase 1, hARK1, Breast tumor-amplified kinase, Serine/threonine-protein kinase 15, Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF HDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH APSSRRDDLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI SRLLKHNPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF HDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH APSSRRDDLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI SRLLKHNPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 ARG n 1 7 GLN n 1 8 TRP n 1 9 ALA n 1 10 LEU n 1 11 GLU n 1 12 ASP n 1 13 PHE n 1 14 GLU n 1 15 ILE n 1 16 GLY n 1 17 ARG n 1 18 PRO n 1 19 LEU n 1 20 GLY n 1 21 LYS n 1 22 GLY n 1 23 LYS n 1 24 PHE n 1 25 GLY n 1 26 ASN n 1 27 VAL n 1 28 TYR n 1 29 LEU n 1 30 ALA n 1 31 ARG n 1 32 GLU n 1 33 LYS n 1 34 GLN n 1 35 SER n 1 36 LYS n 1 37 PHE n 1 38 ILE n 1 39 LEU n 1 40 ALA n 1 41 LEU n 1 42 LYS n 1 43 VAL n 1 44 LEU n 1 45 PHE n 1 46 LYS n 1 47 ALA n 1 48 GLN n 1 49 LEU n 1 50 GLU n 1 51 LYS n 1 52 ALA n 1 53 GLY n 1 54 VAL n 1 55 GLU n 1 56 HIS n 1 57 GLN n 1 58 LEU n 1 59 ARG n 1 60 ARG n 1 61 GLU n 1 62 VAL n 1 63 GLU n 1 64 ILE n 1 65 GLN n 1 66 SER n 1 67 HIS n 1 68 LEU n 1 69 ARG n 1 70 HIS n 1 71 PRO n 1 72 ASN n 1 73 ILE n 1 74 LEU n 1 75 ARG n 1 76 LEU n 1 77 TYR n 1 78 GLY n 1 79 TYR n 1 80 PHE n 1 81 HIS n 1 82 ASP n 1 83 ALA n 1 84 THR n 1 85 ARG n 1 86 VAL n 1 87 TYR n 1 88 LEU n 1 89 ILE n 1 90 LEU n 1 91 GLU n 1 92 TYR n 1 93 ALA n 1 94 PRO n 1 95 LEU n 1 96 GLY n 1 97 THR n 1 98 VAL n 1 99 TYR n 1 100 ARG n 1 101 GLU n 1 102 LEU n 1 103 GLN n 1 104 LYS n 1 105 LEU n 1 106 SER n 1 107 LYS n 1 108 PHE n 1 109 ASP n 1 110 GLU n 1 111 GLN n 1 112 ARG n 1 113 THR n 1 114 ALA n 1 115 THR n 1 116 TYR n 1 117 ILE n 1 118 THR n 1 119 GLU n 1 120 LEU n 1 121 ALA n 1 122 ASN n 1 123 ALA n 1 124 LEU n 1 125 SER n 1 126 TYR n 1 127 CYS n 1 128 HIS n 1 129 SER n 1 130 LYS n 1 131 ARG n 1 132 VAL n 1 133 ILE n 1 134 HIS n 1 135 ARG n 1 136 ASP n 1 137 ILE n 1 138 LYS n 1 139 PRO n 1 140 GLU n 1 141 ASN n 1 142 LEU n 1 143 LEU n 1 144 LEU n 1 145 GLY n 1 146 SER n 1 147 ALA n 1 148 GLY n 1 149 GLU n 1 150 LEU n 1 151 LYS n 1 152 ILE n 1 153 ALA n 1 154 ASP n 1 155 PHE n 1 156 GLY n 1 157 TRP n 1 158 SER n 1 159 VAL n 1 160 HIS n 1 161 ALA n 1 162 PRO n 1 163 SER n 1 164 SER n 1 165 ARG n 1 166 ARG n 1 167 ASP n 1 168 ASP n 1 169 LEU n 1 170 CYS n 1 171 GLY n 1 172 THR n 1 173 LEU n 1 174 ASP n 1 175 TYR n 1 176 LEU n 1 177 PRO n 1 178 PRO n 1 179 GLU n 1 180 MET n 1 181 ILE n 1 182 GLU n 1 183 GLY n 1 184 ARG n 1 185 MET n 1 186 HIS n 1 187 ASP n 1 188 GLU n 1 189 LYS n 1 190 VAL n 1 191 ASP n 1 192 LEU n 1 193 TRP n 1 194 SER n 1 195 LEU n 1 196 GLY n 1 197 VAL n 1 198 LEU n 1 199 CYS n 1 200 TYR n 1 201 GLU n 1 202 PHE n 1 203 LEU n 1 204 VAL n 1 205 GLY n 1 206 LYS n 1 207 PRO n 1 208 PRO n 1 209 PHE n 1 210 GLU n 1 211 ALA n 1 212 ASN n 1 213 THR n 1 214 TYR n 1 215 GLN n 1 216 GLU n 1 217 THR n 1 218 TYR n 1 219 LYS n 1 220 ARG n 1 221 ILE n 1 222 SER n 1 223 ARG n 1 224 VAL n 1 225 GLU n 1 226 PHE n 1 227 THR n 1 228 PHE n 1 229 PRO n 1 230 ASP n 1 231 PHE n 1 232 VAL n 1 233 THR n 1 234 GLU n 1 235 GLY n 1 236 ALA n 1 237 ARG n 1 238 ASP n 1 239 LEU n 1 240 ILE n 1 241 SER n 1 242 ARG n 1 243 LEU n 1 244 LEU n 1 245 LYS n 1 246 HIS n 1 247 ASN n 1 248 PRO n 1 249 SER n 1 250 GLN n 1 251 ARG n 1 252 PRO n 1 253 MET n 1 254 LEU n 1 255 ARG n 1 256 GLU n 1 257 VAL n 1 258 LEU n 1 259 GLU n 1 260 HIS n 1 261 PRO n 1 262 TRP n 1 263 ILE n 1 264 THR n 1 265 ALA n 1 266 ASN n 1 267 SER n 1 268 SER n 1 269 LYS n 1 270 PRO n 1 271 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pDEST20 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STK6_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATR VYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSR RTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLK HNPSQRPMLREVLEHPWITANSSKPS ; _struct_ref.pdbx_align_begin 126 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3R22 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 271 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 126 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 391 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 126 _struct_ref_seq.pdbx_auth_seq_align_end 391 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3R22 GLY A 1 ? UNP O14965 ? ? 'EXPRESSION TAG' 121 1 1 3R22 PRO A 2 ? UNP O14965 ? ? 'EXPRESSION TAG' 122 2 1 3R22 LEU A 3 ? UNP O14965 ? ? 'EXPRESSION TAG' 123 3 1 3R22 GLY A 4 ? UNP O14965 ? ? 'EXPRESSION TAG' 124 4 1 3R22 SER A 5 ? UNP O14965 ? ? 'EXPRESSION TAG' 125 5 1 3R22 ASP A 167 ? UNP O14965 THR 287 'ENGINEERED MUTATION' 287 6 1 3R22 ASP A 168 ? UNP O14965 THR 288 'ENGINEERED MUTATION' 288 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 D37 non-polymer . 'N-{5-[(1-cycloheptyl-1H-pyrazolo[3,4-d]pyrimidin-6-yl)amino]pyridin-2-yl}methanesulfonamide' ? 'C18 H23 N7 O2 S' 401.486 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3R22 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_percent_sol 51.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9 _exptl_crystal_grow.pdbx_details '10% Peg550 MME, 0.1M Tris pH 9, 10% ethylene glycol, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 193 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RAYONIX MX-225' _diffrn_detector.pdbx_collection_date 2008-06-11 _diffrn_detector.details 'Diamond (111)monochromator' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Diamond (111) Monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 31-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 31-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9793 # _reflns.entry_id 3R22 _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.9 _reflns.number_obs 7345 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.051 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 50.15 _reflns.B_iso_Wilson_estimate 106 _reflns.pdbx_redundancy 9.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.0 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.567 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.1 _reflns_shell.pdbx_redundancy 10.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 746 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3R22 _refine.ls_number_reflns_obs 7345 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.70 _refine.ls_d_res_high 2.90 _refine.ls_percent_reflns_obs 99.02 _refine.ls_R_factor_obs 0.27087 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.26882 _refine.ls_R_factor_R_free 0.31298 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 352 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.913 _refine.correlation_coeff_Fo_to_Fc_free 0.893 _refine.B_iso_mean 77.931 _refine.aniso_B[1][1] -0.50 _refine.aniso_B[2][2] -0.50 _refine.aniso_B[3][3] 1.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'pdb entry 3FDN' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model Isotropic _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.104 _refine.overall_SU_ML 0.366 _refine.overall_SU_B 21.536 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3R22 _refine_analyze.Luzzati_coordinate_error_obs 0.514 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2022 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 2061 _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 40.70 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.013 0.022 ? 2104 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.739 1.978 ? 2859 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 8.229 5.000 ? 253 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 39.621 23.021 ? 96 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 23.156 15.000 ? 335 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 23.880 15.000 ? 15 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.116 0.200 ? 312 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.007 0.021 ? 1604 ? 'X-RAY DIFFRACTION' r_mcbond_it 0.656 1.500 ? 1270 ? 'X-RAY DIFFRACTION' r_mcangle_it 1.236 2.000 ? 2028 ? 'X-RAY DIFFRACTION' r_scbond_it 1.377 3.000 ? 834 ? 'X-RAY DIFFRACTION' r_scangle_it 2.382 4.500 ? 831 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.898 _refine_ls_shell.d_res_low 2.973 _refine_ls_shell.number_reflns_R_work 503 _refine_ls_shell.R_factor_R_work 0.364 _refine_ls_shell.percent_reflns_obs 97.21 _refine_ls_shell.R_factor_R_free 0.529 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 20 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 503 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3R22 _struct.title ;Design, synthesis, and biological evaluation of pyrazolopyridine-sulfonamides as potent multiple-mitotic kinase (MMK) inhibitors (Part I) ; _struct.pdbx_descriptor 'Serine/threonine-protein kinase 6 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3R22 _struct_keywords.pdbx_keywords 'transferase/transferase inhibitor' _struct_keywords.text 'Kinase domain, transferase-transferase inhibitor complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 9 ? GLU A 11 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 2 LYS A 46 ? LEU A 49 ? LYS A 166 LEU A 169 5 ? 4 HELX_P HELX_P3 3 GLU A 55 ? LEU A 68 ? GLU A 175 LEU A 188 1 ? 14 HELX_P HELX_P4 4 THR A 97 ? SER A 106 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 5 ASP A 109 ? LYS A 130 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P6 6 LYS A 138 ? GLU A 140 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 7 PRO A 177 ? GLY A 183 ? PRO A 297 GLY A 303 1 ? 7 HELX_P HELX_P8 8 LYS A 189 ? GLY A 205 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P9 9 THR A 213 ? ARG A 223 ? THR A 333 ARG A 343 1 ? 11 HELX_P HELX_P10 10 THR A 233 ? LEU A 244 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P11 11 ASN A 247 ? ARG A 251 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P12 12 MET A 253 ? HIS A 260 ? MET A 373 HIS A 380 1 ? 8 HELX_P HELX_P13 13 HIS A 260 ? ASN A 266 ? HIS A 380 ASN A 386 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 20 A . ? GLY 140 A LYS 21 A ? LYS 141 A 1 -20.71 2 HIS 160 A . ? HIS 280 A ALA 161 A ? ALA 281 A 1 -5.72 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 13 ? GLY A 20 ? PHE A 133 GLY A 140 A 2 GLY A 25 ? GLU A 32 ? GLY A 145 GLU A 152 A 3 PHE A 37 ? LEU A 44 ? PHE A 157 LEU A 164 A 4 VAL A 86 ? LEU A 90 ? VAL A 206 LEU A 210 A 5 LEU A 76 ? HIS A 81 ? LEU A 196 HIS A 201 B 1 LEU A 142 ? LEU A 144 ? LEU A 262 LEU A 264 B 2 LEU A 150 ? ILE A 152 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 19 ? N LEU A 139 O VAL A 27 ? O VAL A 147 A 2 3 N ASN A 26 ? N ASN A 146 O VAL A 43 ? O VAL A 163 A 3 4 N ALA A 40 ? N ALA A 160 O LEU A 90 ? O LEU A 210 A 4 5 O TYR A 87 ? O TYR A 207 N PHE A 80 ? N PHE A 200 B 1 2 N LEU A 143 ? N LEU A 263 O LYS A 151 ? O LYS A 271 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'BINDING SITE FOR RESIDUE D37 A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 HOH C . ? HOH A 88 . ? 1_555 ? 2 AC1 15 ARG A 17 ? ARG A 137 . ? 1_555 ? 3 AC1 15 LEU A 19 ? LEU A 139 . ? 1_555 ? 4 AC1 15 GLY A 20 ? GLY A 140 . ? 1_555 ? 5 AC1 15 LYS A 21 ? LYS A 141 . ? 1_555 ? 6 AC1 15 VAL A 27 ? VAL A 147 . ? 1_555 ? 7 AC1 15 ALA A 40 ? ALA A 160 . ? 1_555 ? 8 AC1 15 LEU A 74 ? LEU A 194 . ? 1_555 ? 9 AC1 15 GLU A 91 ? GLU A 211 . ? 1_555 ? 10 AC1 15 TYR A 92 ? TYR A 212 . ? 1_555 ? 11 AC1 15 ALA A 93 ? ALA A 213 . ? 1_555 ? 12 AC1 15 GLY A 96 ? GLY A 216 . ? 1_555 ? 13 AC1 15 THR A 97 ? THR A 217 . ? 1_555 ? 14 AC1 15 ARG A 100 ? ARG A 220 . ? 1_555 ? 15 AC1 15 LEU A 143 ? LEU A 263 . ? 1_555 ? # _database_PDB_matrix.entry_id 3R22 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3R22 _atom_sites.fract_transf_matrix[1][1] 0.012287 _atom_sites.fract_transf_matrix[1][2] 0.007094 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014188 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006010 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 121 ? ? ? A . n A 1 2 PRO 2 122 ? ? ? A . n A 1 3 LEU 3 123 ? ? ? A . n A 1 4 GLY 4 124 ? ? ? A . n A 1 5 SER 5 125 ? ? ? A . n A 1 6 ARG 6 126 126 ARG ARG A . n A 1 7 GLN 7 127 127 GLN GLN A . n A 1 8 TRP 8 128 128 TRP TRP A . n A 1 9 ALA 9 129 129 ALA ALA A . n A 1 10 LEU 10 130 130 LEU LEU A . n A 1 11 GLU 11 131 131 GLU GLU A . n A 1 12 ASP 12 132 132 ASP ASP A . n A 1 13 PHE 13 133 133 PHE PHE A . n A 1 14 GLU 14 134 134 GLU GLU A . n A 1 15 ILE 15 135 135 ILE ILE A . n A 1 16 GLY 16 136 136 GLY GLY A . n A 1 17 ARG 17 137 137 ARG ARG A . n A 1 18 PRO 18 138 138 PRO PRO A . n A 1 19 LEU 19 139 139 LEU LEU A . n A 1 20 GLY 20 140 140 GLY GLY A . n A 1 21 LYS 21 141 141 LYS LYS A . n A 1 22 GLY 22 142 142 GLY GLY A . n A 1 23 LYS 23 143 143 LYS LYS A . n A 1 24 PHE 24 144 144 PHE PHE A . n A 1 25 GLY 25 145 145 GLY GLY A . n A 1 26 ASN 26 146 146 ASN ASN A . n A 1 27 VAL 27 147 147 VAL VAL A . n A 1 28 TYR 28 148 148 TYR TYR A . n A 1 29 LEU 29 149 149 LEU LEU A . n A 1 30 ALA 30 150 150 ALA ALA A . n A 1 31 ARG 31 151 151 ARG ARG A . n A 1 32 GLU 32 152 152 GLU GLU A . n A 1 33 LYS 33 153 153 LYS LYS A . n A 1 34 GLN 34 154 154 GLN GLN A . n A 1 35 SER 35 155 155 SER SER A . n A 1 36 LYS 36 156 156 LYS LYS A . n A 1 37 PHE 37 157 157 PHE PHE A . n A 1 38 ILE 38 158 158 ILE ILE A . n A 1 39 LEU 39 159 159 LEU LEU A . n A 1 40 ALA 40 160 160 ALA ALA A . n A 1 41 LEU 41 161 161 LEU LEU A . n A 1 42 LYS 42 162 162 LYS LYS A . n A 1 43 VAL 43 163 163 VAL VAL A . n A 1 44 LEU 44 164 164 LEU LEU A . n A 1 45 PHE 45 165 165 PHE PHE A . n A 1 46 LYS 46 166 166 LYS LYS A . n A 1 47 ALA 47 167 167 ALA ALA A . n A 1 48 GLN 48 168 168 GLN GLN A . n A 1 49 LEU 49 169 169 LEU LEU A . n A 1 50 GLU 50 170 170 GLU GLU A . n A 1 51 LYS 51 171 171 LYS LYS A . n A 1 52 ALA 52 172 172 ALA ALA A . n A 1 53 GLY 53 173 173 GLY GLY A . n A 1 54 VAL 54 174 174 VAL VAL A . n A 1 55 GLU 55 175 175 GLU GLU A . n A 1 56 HIS 56 176 176 HIS HIS A . n A 1 57 GLN 57 177 177 GLN GLN A . n A 1 58 LEU 58 178 178 LEU LEU A . n A 1 59 ARG 59 179 179 ARG ARG A . n A 1 60 ARG 60 180 180 ARG ARG A . n A 1 61 GLU 61 181 181 GLU GLU A . n A 1 62 VAL 62 182 182 VAL VAL A . n A 1 63 GLU 63 183 183 GLU GLU A . n A 1 64 ILE 64 184 184 ILE ILE A . n A 1 65 GLN 65 185 185 GLN GLN A . n A 1 66 SER 66 186 186 SER SER A . n A 1 67 HIS 67 187 187 HIS HIS A . n A 1 68 LEU 68 188 188 LEU LEU A . n A 1 69 ARG 69 189 189 ARG ARG A . n A 1 70 HIS 70 190 190 HIS HIS A . n A 1 71 PRO 71 191 191 PRO PRO A . n A 1 72 ASN 72 192 192 ASN ASN A . n A 1 73 ILE 73 193 193 ILE ILE A . n A 1 74 LEU 74 194 194 LEU LEU A . n A 1 75 ARG 75 195 195 ARG ARG A . n A 1 76 LEU 76 196 196 LEU LEU A . n A 1 77 TYR 77 197 197 TYR TYR A . n A 1 78 GLY 78 198 198 GLY GLY A . n A 1 79 TYR 79 199 199 TYR TYR A . n A 1 80 PHE 80 200 200 PHE PHE A . n A 1 81 HIS 81 201 201 HIS HIS A . n A 1 82 ASP 82 202 202 ASP ASP A . n A 1 83 ALA 83 203 203 ALA ALA A . n A 1 84 THR 84 204 204 THR THR A . n A 1 85 ARG 85 205 205 ARG ARG A . n A 1 86 VAL 86 206 206 VAL VAL A . n A 1 87 TYR 87 207 207 TYR TYR A . n A 1 88 LEU 88 208 208 LEU LEU A . n A 1 89 ILE 89 209 209 ILE ILE A . n A 1 90 LEU 90 210 210 LEU LEU A . n A 1 91 GLU 91 211 211 GLU GLU A . n A 1 92 TYR 92 212 212 TYR TYR A . n A 1 93 ALA 93 213 213 ALA ALA A . n A 1 94 PRO 94 214 214 PRO PRO A . n A 1 95 LEU 95 215 215 LEU LEU A . n A 1 96 GLY 96 216 216 GLY GLY A . n A 1 97 THR 97 217 217 THR THR A . n A 1 98 VAL 98 218 218 VAL VAL A . n A 1 99 TYR 99 219 219 TYR TYR A . n A 1 100 ARG 100 220 220 ARG ARG A . n A 1 101 GLU 101 221 221 GLU GLU A . n A 1 102 LEU 102 222 222 LEU LEU A . n A 1 103 GLN 103 223 223 GLN GLN A . n A 1 104 LYS 104 224 224 LYS LYS A . n A 1 105 LEU 105 225 225 LEU LEU A . n A 1 106 SER 106 226 226 SER SER A . n A 1 107 LYS 107 227 227 LYS LYS A . n A 1 108 PHE 108 228 228 PHE PHE A . n A 1 109 ASP 109 229 229 ASP ASP A . n A 1 110 GLU 110 230 230 GLU GLU A . n A 1 111 GLN 111 231 231 GLN GLN A . n A 1 112 ARG 112 232 232 ARG ARG A . n A 1 113 THR 113 233 233 THR THR A . n A 1 114 ALA 114 234 234 ALA ALA A . n A 1 115 THR 115 235 235 THR THR A . n A 1 116 TYR 116 236 236 TYR TYR A . n A 1 117 ILE 117 237 237 ILE ILE A . n A 1 118 THR 118 238 238 THR THR A . n A 1 119 GLU 119 239 239 GLU GLU A . n A 1 120 LEU 120 240 240 LEU LEU A . n A 1 121 ALA 121 241 241 ALA ALA A . n A 1 122 ASN 122 242 242 ASN ASN A . n A 1 123 ALA 123 243 243 ALA ALA A . n A 1 124 LEU 124 244 244 LEU LEU A . n A 1 125 SER 125 245 245 SER SER A . n A 1 126 TYR 126 246 246 TYR TYR A . n A 1 127 CYS 127 247 247 CYS CYS A . n A 1 128 HIS 128 248 248 HIS HIS A . n A 1 129 SER 129 249 249 SER SER A . n A 1 130 LYS 130 250 250 LYS LYS A . n A 1 131 ARG 131 251 251 ARG ARG A . n A 1 132 VAL 132 252 252 VAL VAL A . n A 1 133 ILE 133 253 253 ILE ILE A . n A 1 134 HIS 134 254 254 HIS HIS A . n A 1 135 ARG 135 255 255 ARG ARG A . n A 1 136 ASP 136 256 256 ASP ASP A . n A 1 137 ILE 137 257 257 ILE ILE A . n A 1 138 LYS 138 258 258 LYS LYS A . n A 1 139 PRO 139 259 259 PRO PRO A . n A 1 140 GLU 140 260 260 GLU GLU A . n A 1 141 ASN 141 261 261 ASN ASN A . n A 1 142 LEU 142 262 262 LEU LEU A . n A 1 143 LEU 143 263 263 LEU LEU A . n A 1 144 LEU 144 264 264 LEU LEU A . n A 1 145 GLY 145 265 265 GLY GLY A . n A 1 146 SER 146 266 266 SER SER A . n A 1 147 ALA 147 267 267 ALA ALA A . n A 1 148 GLY 148 268 268 GLY GLY A . n A 1 149 GLU 149 269 269 GLU GLU A . n A 1 150 LEU 150 270 270 LEU LEU A . n A 1 151 LYS 151 271 271 LYS LYS A . n A 1 152 ILE 152 272 272 ILE ILE A . n A 1 153 ALA 153 273 273 ALA ALA A . n A 1 154 ASP 154 274 274 ASP ASP A . n A 1 155 PHE 155 275 275 PHE PHE A . n A 1 156 GLY 156 276 276 GLY GLY A . n A 1 157 TRP 157 277 277 TRP TRP A . n A 1 158 SER 158 278 278 SER SER A . n A 1 159 VAL 159 279 279 VAL VAL A . n A 1 160 HIS 160 280 280 HIS HIS A . n A 1 161 ALA 161 281 281 ALA ALA A . n A 1 162 PRO 162 282 ? ? ? A . n A 1 163 SER 163 283 ? ? ? A . n A 1 164 SER 164 284 ? ? ? A . n A 1 165 ARG 165 285 ? ? ? A . n A 1 166 ARG 166 286 ? ? ? A . n A 1 167 ASP 167 287 ? ? ? A . n A 1 168 ASP 168 288 ? ? ? A . n A 1 169 LEU 169 289 ? ? ? A . n A 1 170 CYS 170 290 ? ? ? A . n A 1 171 GLY 171 291 291 GLY GLY A . n A 1 172 THR 172 292 292 THR THR A . n A 1 173 LEU 173 293 293 LEU LEU A . n A 1 174 ASP 174 294 294 ASP ASP A . n A 1 175 TYR 175 295 295 TYR TYR A . n A 1 176 LEU 176 296 296 LEU LEU A . n A 1 177 PRO 177 297 297 PRO PRO A . n A 1 178 PRO 178 298 298 PRO PRO A . n A 1 179 GLU 179 299 299 GLU GLU A . n A 1 180 MET 180 300 300 MET MET A . n A 1 181 ILE 181 301 301 ILE ILE A . n A 1 182 GLU 182 302 302 GLU GLU A . n A 1 183 GLY 183 303 303 GLY GLY A . n A 1 184 ARG 184 304 304 ARG ARG A . n A 1 185 MET 185 305 305 MET MET A . n A 1 186 HIS 186 306 306 HIS HIS A . n A 1 187 ASP 187 307 307 ASP ASP A . n A 1 188 GLU 188 308 308 GLU GLU A . n A 1 189 LYS 189 309 309 LYS LYS A . n A 1 190 VAL 190 310 310 VAL VAL A . n A 1 191 ASP 191 311 311 ASP ASP A . n A 1 192 LEU 192 312 312 LEU LEU A . n A 1 193 TRP 193 313 313 TRP TRP A . n A 1 194 SER 194 314 314 SER SER A . n A 1 195 LEU 195 315 315 LEU LEU A . n A 1 196 GLY 196 316 316 GLY GLY A . n A 1 197 VAL 197 317 317 VAL VAL A . n A 1 198 LEU 198 318 318 LEU LEU A . n A 1 199 CYS 199 319 319 CYS CYS A . n A 1 200 TYR 200 320 320 TYR TYR A . n A 1 201 GLU 201 321 321 GLU GLU A . n A 1 202 PHE 202 322 322 PHE PHE A . n A 1 203 LEU 203 323 323 LEU LEU A . n A 1 204 VAL 204 324 324 VAL VAL A . n A 1 205 GLY 205 325 325 GLY GLY A . n A 1 206 LYS 206 326 326 LYS LYS A . n A 1 207 PRO 207 327 327 PRO PRO A . n A 1 208 PRO 208 328 328 PRO PRO A . n A 1 209 PHE 209 329 329 PHE PHE A . n A 1 210 GLU 210 330 330 GLU GLU A . n A 1 211 ALA 211 331 331 ALA ALA A . n A 1 212 ASN 212 332 332 ASN ASN A . n A 1 213 THR 213 333 333 THR THR A . n A 1 214 TYR 214 334 334 TYR TYR A . n A 1 215 GLN 215 335 335 GLN GLN A . n A 1 216 GLU 216 336 336 GLU GLU A . n A 1 217 THR 217 337 337 THR THR A . n A 1 218 TYR 218 338 338 TYR TYR A . n A 1 219 LYS 219 339 339 LYS LYS A . n A 1 220 ARG 220 340 340 ARG ARG A . n A 1 221 ILE 221 341 341 ILE ILE A . n A 1 222 SER 222 342 342 SER SER A . n A 1 223 ARG 223 343 343 ARG ARG A . n A 1 224 VAL 224 344 344 VAL VAL A . n A 1 225 GLU 225 345 345 GLU GLU A . n A 1 226 PHE 226 346 346 PHE PHE A . n A 1 227 THR 227 347 347 THR THR A . n A 1 228 PHE 228 348 348 PHE PHE A . n A 1 229 PRO 229 349 349 PRO PRO A . n A 1 230 ASP 230 350 350 ASP ASP A . n A 1 231 PHE 231 351 351 PHE PHE A . n A 1 232 VAL 232 352 352 VAL VAL A . n A 1 233 THR 233 353 353 THR THR A . n A 1 234 GLU 234 354 354 GLU GLU A . n A 1 235 GLY 235 355 355 GLY GLY A . n A 1 236 ALA 236 356 356 ALA ALA A . n A 1 237 ARG 237 357 357 ARG ARG A . n A 1 238 ASP 238 358 358 ASP ASP A . n A 1 239 LEU 239 359 359 LEU LEU A . n A 1 240 ILE 240 360 360 ILE ILE A . n A 1 241 SER 241 361 361 SER SER A . n A 1 242 ARG 242 362 362 ARG ARG A . n A 1 243 LEU 243 363 363 LEU LEU A . n A 1 244 LEU 244 364 364 LEU LEU A . n A 1 245 LYS 245 365 365 LYS LYS A . n A 1 246 HIS 246 366 366 HIS HIS A . n A 1 247 ASN 247 367 367 ASN ASN A . n A 1 248 PRO 248 368 368 PRO PRO A . n A 1 249 SER 249 369 369 SER SER A . n A 1 250 GLN 250 370 370 GLN GLN A . n A 1 251 ARG 251 371 371 ARG ARG A . n A 1 252 PRO 252 372 372 PRO PRO A . n A 1 253 MET 253 373 373 MET MET A . n A 1 254 LEU 254 374 374 LEU LEU A . n A 1 255 ARG 255 375 375 ARG ARG A . n A 1 256 GLU 256 376 376 GLU GLU A . n A 1 257 VAL 257 377 377 VAL VAL A . n A 1 258 LEU 258 378 378 LEU LEU A . n A 1 259 GLU 259 379 379 GLU GLU A . n A 1 260 HIS 260 380 380 HIS HIS A . n A 1 261 PRO 261 381 381 PRO PRO A . n A 1 262 TRP 262 382 382 TRP TRP A . n A 1 263 ILE 263 383 383 ILE ILE A . n A 1 264 THR 264 384 384 THR THR A . n A 1 265 ALA 265 385 385 ALA ALA A . n A 1 266 ASN 266 386 386 ASN ASN A . n A 1 267 SER 267 387 387 SER SER A . n A 1 268 SER 268 388 388 SER SER A . n A 1 269 LYS 269 389 389 LYS LYS A . n A 1 270 PRO 270 390 ? ? ? A . n A 1 271 SER 271 391 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-08-10 2 'Structure model' 1 1 2012-02-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 MOLREP phasing . ? 2 REFMAC refinement 5.5.0109 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 131 ? ? -65.67 0.74 2 1 LYS A 141 ? ? -120.90 -122.07 3 1 LYS A 143 ? ? -17.76 -67.59 4 1 LEU A 169 ? ? -89.03 -73.12 5 1 LYS A 171 ? ? -67.66 9.60 6 1 ALA A 172 ? ? -147.14 -10.76 7 1 ARG A 180 ? ? -76.33 42.55 8 1 GLU A 181 ? ? -140.17 -20.12 9 1 ARG A 189 ? ? -167.55 72.38 10 1 PHE A 200 ? ? 170.30 174.78 11 1 ASP A 202 ? ? -149.87 -136.35 12 1 ARG A 205 ? ? 42.41 131.15 13 1 SER A 226 ? ? 48.95 -28.45 14 1 LYS A 250 ? ? -73.71 26.57 15 1 ARG A 251 ? ? 54.50 6.53 16 1 ARG A 255 ? ? -101.45 -61.81 17 1 ILE A 257 ? ? -99.80 46.02 18 1 ALA A 267 ? ? -69.69 8.28 19 1 ALA A 273 ? ? -142.77 -34.51 20 1 ASP A 274 ? ? -91.78 -141.21 21 1 PHE A 275 ? ? -154.74 60.20 22 1 VAL A 279 ? ? -79.98 -82.12 23 1 HIS A 280 ? ? 126.07 107.68 24 1 MET A 305 ? ? -52.58 95.08 25 1 ASP A 307 ? ? -141.70 -151.48 26 1 VAL A 344 ? ? 39.50 68.80 27 1 LEU A 364 ? ? -92.42 36.25 28 1 HIS A 380 ? ? -36.79 127.21 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ASP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 274 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PHE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 275 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -147.06 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 126 ? CG ? A ARG 6 CG 2 1 Y 1 A ARG 126 ? CD ? A ARG 6 CD 3 1 Y 1 A ARG 126 ? NE ? A ARG 6 NE 4 1 Y 1 A ARG 126 ? CZ ? A ARG 6 CZ 5 1 Y 1 A ARG 126 ? NH1 ? A ARG 6 NH1 6 1 Y 1 A ARG 126 ? NH2 ? A ARG 6 NH2 7 1 Y 1 A LYS 143 ? CG ? A LYS 23 CG 8 1 Y 1 A LYS 143 ? CD ? A LYS 23 CD 9 1 Y 1 A LYS 143 ? CE ? A LYS 23 CE 10 1 Y 1 A LYS 143 ? NZ ? A LYS 23 NZ 11 1 Y 1 A LYS 166 ? CG ? A LYS 46 CG 12 1 Y 1 A LYS 166 ? CD ? A LYS 46 CD 13 1 Y 1 A LYS 166 ? CE ? A LYS 46 CE 14 1 Y 1 A LYS 166 ? NZ ? A LYS 46 NZ 15 1 Y 1 A LYS 171 ? CG ? A LYS 51 CG 16 1 Y 1 A LYS 171 ? CD ? A LYS 51 CD 17 1 Y 1 A LYS 171 ? CE ? A LYS 51 CE 18 1 Y 1 A LYS 171 ? NZ ? A LYS 51 NZ 19 1 Y 1 A VAL 174 ? CG1 ? A VAL 54 CG1 20 1 Y 1 A VAL 174 ? CG2 ? A VAL 54 CG2 21 1 Y 1 A GLN 177 ? CG ? A GLN 57 CG 22 1 Y 1 A GLN 177 ? CD ? A GLN 57 CD 23 1 Y 1 A GLN 177 ? OE1 ? A GLN 57 OE1 24 1 Y 1 A GLN 177 ? NE2 ? A GLN 57 NE2 25 1 Y 1 A ARG 179 ? CG ? A ARG 59 CG 26 1 Y 1 A ARG 179 ? CD ? A ARG 59 CD 27 1 Y 1 A ARG 179 ? NE ? A ARG 59 NE 28 1 Y 1 A ARG 179 ? CZ ? A ARG 59 CZ 29 1 Y 1 A ARG 179 ? NH1 ? A ARG 59 NH1 30 1 Y 1 A ARG 179 ? NH2 ? A ARG 59 NH2 31 1 Y 1 A ARG 180 ? CG ? A ARG 60 CG 32 1 Y 1 A ARG 180 ? CD ? A ARG 60 CD 33 1 Y 1 A ARG 180 ? NE ? A ARG 60 NE 34 1 Y 1 A ARG 180 ? CZ ? A ARG 60 CZ 35 1 Y 1 A ARG 180 ? NH1 ? A ARG 60 NH1 36 1 Y 1 A ARG 180 ? NH2 ? A ARG 60 NH2 37 1 Y 1 A HIS 190 ? CG ? A HIS 70 CG 38 1 Y 1 A HIS 190 ? ND1 ? A HIS 70 ND1 39 1 Y 1 A HIS 190 ? CD2 ? A HIS 70 CD2 40 1 Y 1 A HIS 190 ? CE1 ? A HIS 70 CE1 41 1 Y 1 A HIS 190 ? NE2 ? A HIS 70 NE2 42 1 Y 1 A GLN 231 ? CG ? A GLN 111 CG 43 1 Y 1 A GLN 231 ? CD ? A GLN 111 CD 44 1 Y 1 A GLN 231 ? OE1 ? A GLN 111 OE1 45 1 Y 1 A GLN 231 ? NE2 ? A GLN 111 NE2 46 1 Y 1 A LYS 250 ? CG ? A LYS 130 CG 47 1 Y 1 A LYS 250 ? CD ? A LYS 130 CD 48 1 Y 1 A LYS 250 ? CE ? A LYS 130 CE 49 1 Y 1 A LYS 250 ? NZ ? A LYS 130 NZ 50 1 Y 1 A MET 305 ? CG ? A MET 185 CG 51 1 Y 1 A MET 305 ? SD ? A MET 185 SD 52 1 Y 1 A MET 305 ? CE ? A MET 185 CE 53 1 Y 1 A LYS 326 ? CG ? A LYS 206 CG 54 1 Y 1 A LYS 326 ? CD ? A LYS 206 CD 55 1 Y 1 A LYS 326 ? CE ? A LYS 206 CE 56 1 Y 1 A LYS 326 ? NZ ? A LYS 206 NZ 57 1 Y 1 A GLU 354 ? CG ? A GLU 234 CG 58 1 Y 1 A GLU 354 ? CD ? A GLU 234 CD 59 1 Y 1 A GLU 354 ? OE1 ? A GLU 234 OE1 60 1 Y 1 A GLU 354 ? OE2 ? A GLU 234 OE2 61 1 Y 1 A MET 373 ? CG ? A MET 253 CG 62 1 Y 1 A MET 373 ? SD ? A MET 253 SD 63 1 Y 1 A MET 373 ? CE ? A MET 253 CE 64 1 Y 1 A ARG 375 ? CG ? A ARG 255 CG 65 1 Y 1 A ARG 375 ? CD ? A ARG 255 CD 66 1 Y 1 A ARG 375 ? NE ? A ARG 255 NE 67 1 Y 1 A ARG 375 ? CZ ? A ARG 255 CZ 68 1 Y 1 A ARG 375 ? NH1 ? A ARG 255 NH1 69 1 Y 1 A ARG 375 ? NH2 ? A ARG 255 NH2 70 1 Y 1 A GLU 376 ? CG ? A GLU 256 CG 71 1 Y 1 A GLU 376 ? CD ? A GLU 256 CD 72 1 Y 1 A GLU 376 ? OE1 ? A GLU 256 OE1 73 1 Y 1 A GLU 376 ? OE2 ? A GLU 256 OE2 74 1 Y 1 A GLU 379 ? CG ? A GLU 259 CG 75 1 Y 1 A GLU 379 ? CD ? A GLU 259 CD 76 1 Y 1 A GLU 379 ? OE1 ? A GLU 259 OE1 77 1 Y 1 A GLU 379 ? OE2 ? A GLU 259 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 121 ? A GLY 1 2 1 Y 1 A PRO 122 ? A PRO 2 3 1 Y 1 A LEU 123 ? A LEU 3 4 1 Y 1 A GLY 124 ? A GLY 4 5 1 Y 1 A SER 125 ? A SER 5 6 1 Y 1 A PRO 282 ? A PRO 162 7 1 Y 1 A SER 283 ? A SER 163 8 1 Y 1 A SER 284 ? A SER 164 9 1 Y 1 A ARG 285 ? A ARG 165 10 1 Y 1 A ARG 286 ? A ARG 166 11 1 Y 1 A ASP 287 ? A ASP 167 12 1 Y 1 A ASP 288 ? A ASP 168 13 1 Y 1 A LEU 289 ? A LEU 169 14 1 Y 1 A CYS 290 ? A CYS 170 15 1 Y 1 A PRO 390 ? A PRO 270 16 1 Y 1 A SER 391 ? A SER 271 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-{5-[(1-cycloheptyl-1H-pyrazolo[3,4-d]pyrimidin-6-yl)amino]pyridin-2-yl}methanesulfonamide' D37 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 D37 1 1 1 D37 D37 A . C 3 HOH 1 10 10 HOH HOH A . C 3 HOH 2 16 16 HOH HOH A . C 3 HOH 3 17 17 HOH HOH A . C 3 HOH 4 23 23 HOH HOH A . C 3 HOH 5 29 29 HOH HOH A . C 3 HOH 6 40 40 HOH HOH A . C 3 HOH 7 50 50 HOH HOH A . C 3 HOH 8 54 54 HOH HOH A . C 3 HOH 9 87 87 HOH HOH A . C 3 HOH 10 88 88 HOH HOH A . C 3 HOH 11 449 449 HOH HOH A . #