data_3R2Q # _entry.id 3R2Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3R2Q RCSB RCSB064414 WWPDB D_1000064414 # _pdbx_database_status.entry_id 3R2Q _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-03-14 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ladner, J.E.' 1 'Harp, J.' 2 'Schaab, M.' 3 'Stournan, N.V.' 4 'Armstrong, R.N.' 5 # _citation.id primary _citation.title 'Structural and Functional Genomics of YibF, a Glutathione Transferase Homologue from Escherichia coli' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ladner, J.E.' 1 primary 'Stournan, N.V.' 2 primary 'Branch, M.C.' 3 primary 'Harp, J.' 4 primary 'Schaab, M.' 5 primary 'Brown, D.W.' 6 primary 'Armstrong, R.N.' 7 # _cell.entry_id 3R2Q _cell.length_a 111.340 _cell.length_b 111.340 _cell.length_c 111.340 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3R2Q _symmetry.space_group_name_H-M 'P 43 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 212 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized GST-like protein yibF' 22585.004 1 ? ? ? ? 2 non-polymer syn GLUTATHIONE 307.323 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 5 water nat water 18.015 281 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MKLVGSYTSPFVRKLSILLLEKGITFEFINELPYNADNGVAQFNPLGKVPVLVTEEGECWFDSPIIAEYIELMNVAPAML PRDPLESLRVRKIEALADGIMDAGLVSVREQARPAAQQSEDELLRQREKINRSLDVLEGYLVDGTLKTDTVNLATIAIAC AVGYLNFRRVAPGW(CSX)VDRPHLVKLVENLFSRESFARTEPPKA ; _entity_poly.pdbx_seq_one_letter_code_can ;MKLVGSYTSPFVRKLSILLLEKGITFEFINELPYNADNGVAQFNPLGKVPVLVTEEGECWFDSPIIAEYIELMNVAPAML PRDPLESLRVRKIEALADGIMDAGLVSVREQARPAAQQSEDELLRQREKINRSLDVLEGYLVDGTLKTDTVNLATIAIAC AVGYLNFRRVAPGWCVDRPHLVKLVENLFSRESFARTEPPKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LEU n 1 4 VAL n 1 5 GLY n 1 6 SER n 1 7 TYR n 1 8 THR n 1 9 SER n 1 10 PRO n 1 11 PHE n 1 12 VAL n 1 13 ARG n 1 14 LYS n 1 15 LEU n 1 16 SER n 1 17 ILE n 1 18 LEU n 1 19 LEU n 1 20 LEU n 1 21 GLU n 1 22 LYS n 1 23 GLY n 1 24 ILE n 1 25 THR n 1 26 PHE n 1 27 GLU n 1 28 PHE n 1 29 ILE n 1 30 ASN n 1 31 GLU n 1 32 LEU n 1 33 PRO n 1 34 TYR n 1 35 ASN n 1 36 ALA n 1 37 ASP n 1 38 ASN n 1 39 GLY n 1 40 VAL n 1 41 ALA n 1 42 GLN n 1 43 PHE n 1 44 ASN n 1 45 PRO n 1 46 LEU n 1 47 GLY n 1 48 LYS n 1 49 VAL n 1 50 PRO n 1 51 VAL n 1 52 LEU n 1 53 VAL n 1 54 THR n 1 55 GLU n 1 56 GLU n 1 57 GLY n 1 58 GLU n 1 59 CYS n 1 60 TRP n 1 61 PHE n 1 62 ASP n 1 63 SER n 1 64 PRO n 1 65 ILE n 1 66 ILE n 1 67 ALA n 1 68 GLU n 1 69 TYR n 1 70 ILE n 1 71 GLU n 1 72 LEU n 1 73 MET n 1 74 ASN n 1 75 VAL n 1 76 ALA n 1 77 PRO n 1 78 ALA n 1 79 MET n 1 80 LEU n 1 81 PRO n 1 82 ARG n 1 83 ASP n 1 84 PRO n 1 85 LEU n 1 86 GLU n 1 87 SER n 1 88 LEU n 1 89 ARG n 1 90 VAL n 1 91 ARG n 1 92 LYS n 1 93 ILE n 1 94 GLU n 1 95 ALA n 1 96 LEU n 1 97 ALA n 1 98 ASP n 1 99 GLY n 1 100 ILE n 1 101 MET n 1 102 ASP n 1 103 ALA n 1 104 GLY n 1 105 LEU n 1 106 VAL n 1 107 SER n 1 108 VAL n 1 109 ARG n 1 110 GLU n 1 111 GLN n 1 112 ALA n 1 113 ARG n 1 114 PRO n 1 115 ALA n 1 116 ALA n 1 117 GLN n 1 118 GLN n 1 119 SER n 1 120 GLU n 1 121 ASP n 1 122 GLU n 1 123 LEU n 1 124 LEU n 1 125 ARG n 1 126 GLN n 1 127 ARG n 1 128 GLU n 1 129 LYS n 1 130 ILE n 1 131 ASN n 1 132 ARG n 1 133 SER n 1 134 LEU n 1 135 ASP n 1 136 VAL n 1 137 LEU n 1 138 GLU n 1 139 GLY n 1 140 TYR n 1 141 LEU n 1 142 VAL n 1 143 ASP n 1 144 GLY n 1 145 THR n 1 146 LEU n 1 147 LYS n 1 148 THR n 1 149 ASP n 1 150 THR n 1 151 VAL n 1 152 ASN n 1 153 LEU n 1 154 ALA n 1 155 THR n 1 156 ILE n 1 157 ALA n 1 158 ILE n 1 159 ALA n 1 160 CYS n 1 161 ALA n 1 162 VAL n 1 163 GLY n 1 164 TYR n 1 165 LEU n 1 166 ASN n 1 167 PHE n 1 168 ARG n 1 169 ARG n 1 170 VAL n 1 171 ALA n 1 172 PRO n 1 173 GLY n 1 174 TRP n 1 175 CSX n 1 176 VAL n 1 177 ASP n 1 178 ARG n 1 179 PRO n 1 180 HIS n 1 181 LEU n 1 182 VAL n 1 183 LYS n 1 184 LEU n 1 185 VAL n 1 186 GLU n 1 187 ASN n 1 188 LEU n 1 189 PHE n 1 190 SER n 1 191 ARG n 1 192 GLU n 1 193 SER n 1 194 PHE n 1 195 ALA n 1 196 ARG n 1 197 THR n 1 198 GLU n 1 199 PRO n 1 200 PRO n 1 201 LYS n 1 202 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'b3592, JW3565, yibF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET20b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YIBF_ECOLI _struct_ref.pdbx_db_accession P0ACA1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKLVGSYTSPFVRKLSILLLEKGITFEFINELPYNADNGVAQFNPLGKVPVLVTEEGECWFDSPIIAEYIELMNVAPAML PRDPLESLRVRKIEALADGIMDAGLVSVREQARPAAQQSEDELLRQREKINRSLDVLEGYLVDGTLKTDTVNLATIAIAC AVGYLNFRRVAPGWCVDRPHLVKLVENLFSRESFARTEPPKA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3R2Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 202 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0ACA1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 202 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 202 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSX 'L-peptide linking' n 'S-OXY CYSTEINE' ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GSH non-polymer . GLUTATHIONE ? 'C10 H17 N3 O6 S' 307.323 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3R2Q _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_percent_sol 51.82 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;5 microL protein in 50 mM HEPES pH 7.5, 1 mM DTT, 4 microL reservoir (0.1M Na acetate pH 4.6,1M ammonium phosphate monobasic), 1 microL 100mM glutathione pH 7.0, vapor diffusion, temperature 298K ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2007-07-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_wavelength 1.0 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3R2Q _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.050 _reflns.number_obs 107437 _reflns.number_all ? _reflns.percent_possible_obs 98.1 _reflns.pdbx_Rmerge_I_obs 0.069 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16.2 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.05 _reflns_shell.d_res_low 1.09 _reflns_shell.percent_possible_all 99.7 _reflns_shell.Rmerge_I_obs 0.46500 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 5.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3R2Q _refine.ls_number_reflns_obs 107373 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 26.00 _refine.ls_d_res_high 1.05 _refine.ls_percent_reflns_obs 93.3 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all 0.1317 _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free 0.1528 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5 _refine.ls_number_reflns_R_free 5366 _refine.ls_number_parameters 18731 _refine.ls_number_restraints 25172 _refine.occupancy_min 0.110 _refine.occupancy_max 1.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 16.7281 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'MOEWS & KRETSINGER, J.MOL.BIOL.91(1973)201-228' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method 'FREE R' _refine.details 'ANISOTROPIC REFINEMENT, FINAL REFINEMENT WITH RIDING HYDROGENS' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH AND HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs 102007 _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 3R2Q _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 24 _refine_analyze.occupancy_sum_hydrogen 1584.00 _refine_analyze.occupancy_sum_non_hydrogen 1876.55 _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1587 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 281 _refine_hist.number_atoms_total 1901 _refine_hist.d_res_high 1.05 _refine_hist.d_res_low 26.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.016 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.033 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.0268 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.080 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.099 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.213 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.006 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.053 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.099 ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 3R2Q _pdbx_refine.R_factor_all_no_cutoff 0.1317 _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff 0.1528 _pdbx_refine.free_R_error_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 5 _pdbx_refine.free_R_val_test_set_ct_no_cutoff 5366 _pdbx_refine.R_factor_all_4sig_cutoff 0.1211 _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff 0.1416 _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff 4654 _pdbx_refine.number_reflns_obs_4sig_cutoff 92438 # _struct.entry_id 3R2Q _struct.title 'Crystal Structure Analysis of yibF from E. Coli' _struct.pdbx_descriptor 'Uncharacterized GST-like protein yibF' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3R2Q _struct_keywords.text 'transferase, glutathione, GST' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 9 ? LYS A 22 ? SER A 9 LYS A 22 1 ? 14 HELX_P HELX_P2 2 ASP A 62 ? MET A 73 ? ASP A 62 MET A 73 1 ? 12 HELX_P HELX_P3 3 ASP A 83 ? ARG A 113 ? ASP A 83 ARG A 113 1 ? 31 HELX_P HELX_P4 4 PRO A 114 ? GLN A 118 ? PRO A 114 GLN A 118 5 ? 5 HELX_P HELX_P5 5 SER A 119 ? ASP A 143 ? SER A 119 ASP A 143 1 ? 25 HELX_P HELX_P6 6 ASN A 152 ? ARG A 169 ? ASN A 152 ARG A 169 1 ? 18 HELX_P HELX_P7 7 ARG A 178 ? SER A 190 ? ARG A 178 SER A 190 1 ? 13 HELX_P HELX_P8 8 ARG A 191 ? ARG A 196 ? ARG A 191 ARG A 196 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A TRP 174 C ? ? ? 1_555 A CSX 175 N ? ? A TRP 174 A CSX 175 1_555 ? ? ? ? ? ? ? 1.348 ? covale2 covale ? ? A CSX 175 C ? ? ? 1_555 A VAL 176 N ? ? A CSX 175 A VAL 176 1_555 ? ? ? ? ? ? ? 1.278 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 49 A . ? VAL 49 A PRO 50 A ? PRO 50 A 1 6.88 2 PHE 61 A . ? PHE 61 A ASP 62 A ? ASP 62 A 1 -14.49 3 ALA 76 A . ? ALA 76 A PRO 77 A ? PRO 77 A 1 -3.14 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 27 ? ASN A 30 ? GLU A 27 ASN A 30 A 2 LYS A 2 ? GLY A 5 ? LYS A 2 GLY A 5 A 3 VAL A 51 ? VAL A 53 ? VAL A 51 VAL A 53 A 4 CYS A 59 ? TRP A 60 ? CYS A 59 TRP A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 29 ? O ILE A 29 N LEU A 3 ? N LEU A 3 A 2 3 N VAL A 4 ? N VAL A 4 O VAL A 51 ? O VAL A 51 A 3 4 N LEU A 52 ? N LEU A 52 O TRP A 60 ? O TRP A 60 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE GSH A 301' AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE PO4 A 305' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 309' AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A 310' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 22 SER A 9 ? SER A 9 . ? 1_555 ? 2 AC1 22 PHE A 11 ? PHE A 11 . ? 1_555 ? 3 AC1 22 PRO A 33 ? PRO A 33 . ? 1_555 ? 4 AC1 22 TYR A 34 ? TYR A 34 . ? 1_555 ? 5 AC1 22 LYS A 48 ? LYS A 48 . ? 1_555 ? 6 AC1 22 VAL A 49 ? VAL A 49 . ? 1_555 ? 7 AC1 22 PRO A 50 ? PRO A 50 . ? 1_555 ? 8 AC1 22 ASP A 62 ? ASP A 62 . ? 1_555 ? 9 AC1 22 SER A 63 ? SER A 63 . ? 1_555 ? 10 AC1 22 PRO A 64 ? PRO A 64 . ? 1_555 ? 11 AC1 22 LEU A 105 ? LEU A 105 . ? 1_555 ? 12 AC1 22 ARG A 125 ? ARG A 125 . ? 19_455 ? 13 AC1 22 LYS A 129 ? LYS A 129 . ? 19_455 ? 14 AC1 22 HOH F . ? HOH A 1009 . ? 1_555 ? 15 AC1 22 HOH F . ? HOH A 1010 . ? 1_555 ? 16 AC1 22 HOH F . ? HOH A 1028 . ? 1_555 ? 17 AC1 22 HOH F . ? HOH A 1030 . ? 1_555 ? 18 AC1 22 HOH F . ? HOH A 1051 . ? 1_555 ? 19 AC1 22 HOH F . ? HOH A 1096 . ? 1_555 ? 20 AC1 22 HOH F . ? HOH A 1099 . ? 1_555 ? 21 AC1 22 HOH F . ? HOH A 1116 . ? 1_555 ? 22 AC1 22 HOH F . ? HOH A 1234 . ? 19_455 ? 23 AC2 8 ARG A 127 ? ARG A 127 . ? 1_555 ? 24 AC2 8 ASN A 131 ? ASN A 131 . ? 1_555 ? 25 AC2 8 ALA A 171 ? ALA A 171 . ? 1_555 ? 26 AC2 8 PRO A 172 ? PRO A 172 . ? 1_555 ? 27 AC2 8 GLY A 173 ? GLY A 173 . ? 1_555 ? 28 AC2 8 HOH F . ? HOH A 1136 . ? 1_555 ? 29 AC2 8 HOH F . ? HOH A 1147 . ? 1_555 ? 30 AC2 8 HOH F . ? HOH A 1253 . ? 1_555 ? 31 AC3 6 ARG A 13 ? ARG A 13 . ? 1_555 ? 32 AC3 6 PHE A 189 ? PHE A 189 . ? 1_555 ? 33 AC3 6 GLU A 198 ? GLU A 198 . ? 1_555 ? 34 AC3 6 HOH F . ? HOH A 1069 . ? 1_555 ? 35 AC3 6 HOH F . ? HOH A 1077 . ? 1_555 ? 36 AC3 6 HOH F . ? HOH A 1130 . ? 1_555 ? 37 AC4 5 PHE A 167 ? PHE A 167 . ? 1_555 ? 38 AC4 5 ARG A 168 ? ARG A 168 . ? 1_555 ? 39 AC4 5 ARG A 169 ? ARG A 169 . ? 1_555 ? 40 AC4 5 HOH F . ? HOH A 1057 . ? 1_555 ? 41 AC4 5 HOH F . ? HOH A 1082 . ? 1_555 ? # _database_PDB_matrix.entry_id 3R2Q _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 3R2Q _atom_sites.fract_transf_matrix[1][1] 0.008981 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008981 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008981 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 TRP 174 174 174 TRP TRP A . n A 1 175 CSX 175 175 175 CSX CSX A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 HIS 180 180 180 HIS HIS A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 ALA 202 202 202 ALA ALA A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSX _pdbx_struct_mod_residue.label_seq_id 175 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSX _pdbx_struct_mod_residue.auth_seq_id 175 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'S-OXY CYSTEINE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6110 ? 1 MORE -28 ? 1 'SSA (A^2)' 17680 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 19_455 -x-3/4,-z+1/4,-y+1/4 -1.0000000000 0.0000000000 0.0000000000 -83.5050000000 0.0000000000 0.0000000000 -1.0000000000 27.8350000000 0.0000000000 -1.0000000000 0.0000000000 27.8350000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 1089 ? F HOH . 2 1 A HOH 1186 ? F HOH . 3 1 A HOH 1243 ? F HOH . 4 1 A HOH 1248 ? F HOH . 5 1 A HOH 1251 ? F HOH . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-03-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_phasing_MR.entry_id 3R2Q _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.000 _pdbx_phasing_MR.d_res_low_rotation 9.960 _pdbx_phasing_MR.d_res_high_translation 3.000 _pdbx_phasing_MR.d_res_low_translation 9.960 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALEPACK . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 PHASER 1.3.3 'Tue Nov 14 15:28:12 2006' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 3 SHELX . ? package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de refinement http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 4 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 6 ARP/wARP . ? ? ? ? 'model building' ? ? ? 7 SHELXL-97 . ? ? ? ? refinement ? ? ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ALA 36 ? B N A ASP 37 ? B CA A ASP 37 ? B 140.35 121.70 18.65 2.50 Y 2 1 CB A ASP 37 ? B CG A ASP 37 ? B OD2 A ASP 37 ? B 112.90 118.30 -5.40 0.90 N 3 1 CA A MET 73 ? B CB A MET 73 ? B CG A MET 73 ? B 96.00 113.30 -17.30 1.70 N 4 1 CA A MET 73 ? A C A MET 73 ? A O A MET 73 ? A 106.26 120.10 -13.84 2.10 N 5 1 CA A MET 73 ? A C A MET 73 ? A N A ASN 74 ? ? 135.09 117.20 17.89 2.20 Y 6 1 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH2 A ARG 89 ? ? 123.84 120.30 3.54 0.50 N 7 1 NE A ARG 91 ? A CZ A ARG 91 ? A NH1 A ARG 91 ? A 123.82 120.30 3.52 0.50 N 8 1 NE A ARG 91 ? B CZ A ARG 91 ? B NH1 A ARG 91 ? B 125.36 120.30 5.06 0.50 N 9 1 NE A ARG 91 ? B CZ A ARG 91 ? B NH2 A ARG 91 ? B 115.71 120.30 -4.59 0.50 N 10 1 NE A ARG 109 ? ? CZ A ARG 109 ? ? NH2 A ARG 109 ? ? 114.95 120.30 -5.35 0.50 N 11 1 NE A ARG 113 ? A CZ A ARG 113 ? A NH1 A ARG 113 ? A 126.15 120.30 5.85 0.50 N 12 1 NE A ARG 113 ? B CZ A ARG 113 ? B NH1 A ARG 113 ? B 127.72 120.30 7.42 0.50 N 13 1 NE A ARG 113 ? A CZ A ARG 113 ? A NH2 A ARG 113 ? A 117.27 120.30 -3.03 0.50 N 14 1 NE A ARG 125 ? A CZ A ARG 125 ? A NH2 A ARG 125 ? A 123.59 120.30 3.29 0.50 N 15 1 NE A ARG 132 ? ? CZ A ARG 132 ? ? NH1 A ARG 132 ? ? 124.86 120.30 4.56 0.50 N 16 1 NE A ARG 132 ? ? CZ A ARG 132 ? ? NH2 A ARG 132 ? ? 116.64 120.30 -3.66 0.50 N 17 1 CB A LYS 201 ? ? CA A LYS 201 ? ? C A LYS 201 ? ? 97.87 110.40 -12.53 2.00 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 36 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id B _pdbx_validate_torsion.phi -39.34 _pdbx_validate_torsion.psi -36.34 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id CSX _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 175 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -11.20 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLUTATHIONE GSH 3 'PHOSPHATE ION' PO4 4 1,2-ETHANEDIOL EDO 5 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GSH 1 301 301 GSH GSH A . C 3 PO4 1 305 305 PO4 PO4 A . D 4 EDO 1 309 309 EDO EDO A . E 4 EDO 1 310 310 EDO EDO A . F 5 HOH 1 1001 1001 HOH HOH A . F 5 HOH 2 1002 1002 HOH HOH A . F 5 HOH 3 1003 1003 HOH HOH A . F 5 HOH 4 1004 1004 HOH HOH A . F 5 HOH 5 1005 1005 HOH HOH A . F 5 HOH 6 1006 1006 HOH HOH A . F 5 HOH 7 1007 1007 HOH HOH A . F 5 HOH 8 1008 1008 HOH HOH A . F 5 HOH 9 1009 1009 HOH HOH A . F 5 HOH 10 1010 1010 HOH HOH A . F 5 HOH 11 1011 1011 HOH HOH A . F 5 HOH 12 1012 1012 HOH HOH A . F 5 HOH 13 1013 1013 HOH HOH A . F 5 HOH 14 1014 1014 HOH HOH A . F 5 HOH 15 1015 1015 HOH HOH A . F 5 HOH 16 1016 1016 HOH HOH A . F 5 HOH 17 1017 1017 HOH HOH A . F 5 HOH 18 1018 1018 HOH HOH A . F 5 HOH 19 1019 1019 HOH HOH A . F 5 HOH 20 1020 1020 HOH HOH A . F 5 HOH 21 1021 1021 HOH HOH A . F 5 HOH 22 1022 1022 HOH HOH A . F 5 HOH 23 1023 1023 HOH HOH A . F 5 HOH 24 1024 1024 HOH HOH A . F 5 HOH 25 1025 1025 HOH HOH A . F 5 HOH 26 1026 1026 HOH HOH A . F 5 HOH 27 1027 1027 HOH HOH A . F 5 HOH 28 1028 1028 HOH HOH A . F 5 HOH 29 1029 1029 HOH HOH A . F 5 HOH 30 1030 1030 HOH HOH A . F 5 HOH 31 1031 1031 HOH HOH A . F 5 HOH 32 1032 1032 HOH HOH A . F 5 HOH 33 1033 1033 HOH HOH A . F 5 HOH 34 1034 1034 HOH HOH A . F 5 HOH 35 1035 1035 HOH HOH A . F 5 HOH 36 1036 1036 HOH HOH A . F 5 HOH 37 1037 1037 HOH HOH A . F 5 HOH 38 1038 1038 HOH HOH A . F 5 HOH 39 1039 1039 HOH HOH A . F 5 HOH 40 1040 1040 HOH HOH A . F 5 HOH 41 1041 1041 HOH HOH A . F 5 HOH 42 1042 1042 HOH HOH A . F 5 HOH 43 1043 1043 HOH HOH A . F 5 HOH 44 1044 1044 HOH HOH A . F 5 HOH 45 1045 1045 HOH HOH A . F 5 HOH 46 1046 1046 HOH HOH A . F 5 HOH 47 1047 1047 HOH HOH A . F 5 HOH 48 1048 1048 HOH HOH A . F 5 HOH 49 1049 1049 HOH HOH A . F 5 HOH 50 1050 1050 HOH HOH A . F 5 HOH 51 1051 1051 HOH HOH A . F 5 HOH 52 1052 1052 HOH HOH A . F 5 HOH 53 1053 1053 HOH HOH A . F 5 HOH 54 1054 1054 HOH HOH A . F 5 HOH 55 1055 1055 HOH HOH A . F 5 HOH 56 1056 1056 HOH HOH A . F 5 HOH 57 1057 1057 HOH HOH A . F 5 HOH 58 1058 1058 HOH HOH A . F 5 HOH 59 1059 1059 HOH HOH A . F 5 HOH 60 1060 1060 HOH HOH A . F 5 HOH 61 1061 1061 HOH HOH A . F 5 HOH 62 1062 1062 HOH HOH A . F 5 HOH 63 1063 1063 HOH HOH A . F 5 HOH 64 1064 1064 HOH HOH A . F 5 HOH 65 1065 1065 HOH HOH A . F 5 HOH 66 1066 1066 HOH HOH A . F 5 HOH 67 1067 1067 HOH HOH A . F 5 HOH 68 1068 1068 HOH HOH A . F 5 HOH 69 1069 1069 HOH HOH A . F 5 HOH 70 1070 1070 HOH HOH A . F 5 HOH 71 1071 1071 HOH HOH A . F 5 HOH 72 1072 1072 HOH HOH A . F 5 HOH 73 1073 1073 HOH HOH A . F 5 HOH 74 1074 1074 HOH HOH A . F 5 HOH 75 1075 1075 HOH HOH A . F 5 HOH 76 1076 1076 HOH HOH A . F 5 HOH 77 1077 1077 HOH HOH A . F 5 HOH 78 1078 1078 HOH HOH A . F 5 HOH 79 1079 1079 HOH HOH A . F 5 HOH 80 1080 1080 HOH HOH A . F 5 HOH 81 1081 1081 HOH HOH A . F 5 HOH 82 1082 1082 HOH HOH A . F 5 HOH 83 1083 1083 HOH HOH A . F 5 HOH 84 1084 1084 HOH HOH A . F 5 HOH 85 1085 1085 HOH HOH A . F 5 HOH 86 1086 1086 HOH HOH A . F 5 HOH 87 1087 1087 HOH HOH A . F 5 HOH 88 1088 1088 HOH HOH A . F 5 HOH 89 1089 1089 HOH HOH A . F 5 HOH 90 1090 1090 HOH HOH A . F 5 HOH 91 1091 1091 HOH HOH A . F 5 HOH 92 1092 1092 HOH HOH A . F 5 HOH 93 1093 1093 HOH HOH A . F 5 HOH 94 1094 1094 HOH HOH A . F 5 HOH 95 1095 1095 HOH HOH A . F 5 HOH 96 1096 1096 HOH HOH A . F 5 HOH 97 1097 1097 HOH HOH A . F 5 HOH 98 1098 1098 HOH HOH A . F 5 HOH 99 1099 1099 HOH HOH A . F 5 HOH 100 1100 1100 HOH HOH A . F 5 HOH 101 1101 1101 HOH HOH A . F 5 HOH 102 1102 1102 HOH HOH A . F 5 HOH 103 1103 1103 HOH HOH A . F 5 HOH 104 1104 1104 HOH HOH A . F 5 HOH 105 1105 1105 HOH HOH A . F 5 HOH 106 1106 1106 HOH HOH A . F 5 HOH 107 1107 1107 HOH HOH A . F 5 HOH 108 1108 1108 HOH HOH A . F 5 HOH 109 1109 1109 HOH HOH A . F 5 HOH 110 1110 1110 HOH HOH A . F 5 HOH 111 1111 1111 HOH HOH A . F 5 HOH 112 1112 1112 HOH HOH A . F 5 HOH 113 1113 1113 HOH HOH A . F 5 HOH 114 1114 1114 HOH HOH A . F 5 HOH 115 1115 1115 HOH HOH A . F 5 HOH 116 1116 1116 HOH HOH A . F 5 HOH 117 1117 1117 HOH HOH A . F 5 HOH 118 1118 1118 HOH HOH A . F 5 HOH 119 1119 1119 HOH HOH A . F 5 HOH 120 1120 1120 HOH HOH A . F 5 HOH 121 1121 1121 HOH HOH A . F 5 HOH 122 1122 1122 HOH HOH A . F 5 HOH 123 1123 1123 HOH HOH A . F 5 HOH 124 1124 1124 HOH HOH A . F 5 HOH 125 1125 1125 HOH HOH A . F 5 HOH 126 1126 1126 HOH HOH A . F 5 HOH 127 1127 1127 HOH HOH A . F 5 HOH 128 1128 1128 HOH HOH A . F 5 HOH 129 1129 1129 HOH HOH A . F 5 HOH 130 1130 1130 HOH HOH A . F 5 HOH 131 1131 1131 HOH HOH A . F 5 HOH 132 1132 1132 HOH HOH A . F 5 HOH 133 1133 1133 HOH HOH A . F 5 HOH 134 1134 1134 HOH HOH A . F 5 HOH 135 1135 1135 HOH HOH A . F 5 HOH 136 1136 1136 HOH HOH A . F 5 HOH 137 1137 1137 HOH HOH A . F 5 HOH 138 1138 1138 HOH HOH A . F 5 HOH 139 1139 1139 HOH HOH A . F 5 HOH 140 1140 1140 HOH HOH A . F 5 HOH 141 1141 1141 HOH HOH A . F 5 HOH 142 1142 1142 HOH HOH A . F 5 HOH 143 1143 1143 HOH HOH A . F 5 HOH 144 1144 1144 HOH HOH A . F 5 HOH 145 1145 1145 HOH HOH A . F 5 HOH 146 1146 1146 HOH HOH A . F 5 HOH 147 1147 1147 HOH HOH A . F 5 HOH 148 1148 1148 HOH HOH A . F 5 HOH 149 1149 1149 HOH HOH A . F 5 HOH 150 1150 1150 HOH HOH A . F 5 HOH 151 1151 1151 HOH HOH A . F 5 HOH 152 1152 1152 HOH HOH A . F 5 HOH 153 1153 1153 HOH HOH A . F 5 HOH 154 1154 1154 HOH HOH A . F 5 HOH 155 1155 1155 HOH HOH A . F 5 HOH 156 1156 1156 HOH HOH A . F 5 HOH 157 1157 1157 HOH HOH A . F 5 HOH 158 1158 1158 HOH HOH A . F 5 HOH 159 1159 1159 HOH HOH A . F 5 HOH 160 1160 1160 HOH HOH A . F 5 HOH 161 1161 1161 HOH HOH A . F 5 HOH 162 1162 1162 HOH HOH A . F 5 HOH 163 1163 1163 HOH HOH A . F 5 HOH 164 1164 1164 HOH HOH A . F 5 HOH 165 1165 1165 HOH HOH A . F 5 HOH 166 1166 1166 HOH HOH A . F 5 HOH 167 1167 1167 HOH HOH A . F 5 HOH 168 1168 1168 HOH HOH A . F 5 HOH 169 1169 1169 HOH HOH A . F 5 HOH 170 1170 1170 HOH HOH A . F 5 HOH 171 1171 1171 HOH HOH A . F 5 HOH 172 1172 1172 HOH HOH A . F 5 HOH 173 1173 1173 HOH HOH A . F 5 HOH 174 1174 1174 HOH HOH A . F 5 HOH 175 1175 1175 HOH HOH A . F 5 HOH 176 1176 1176 HOH HOH A . F 5 HOH 177 1177 1177 HOH HOH A . F 5 HOH 178 1178 1178 HOH HOH A . F 5 HOH 179 1179 1179 HOH HOH A . F 5 HOH 180 1180 1180 HOH HOH A . F 5 HOH 181 1181 1181 HOH HOH A . F 5 HOH 182 1182 1182 HOH HOH A . F 5 HOH 183 1183 1183 HOH HOH A . F 5 HOH 184 1184 1184 HOH HOH A . F 5 HOH 185 1185 1185 HOH HOH A . F 5 HOH 186 1186 1186 HOH HOH A . F 5 HOH 187 1187 1187 HOH HOH A . F 5 HOH 188 1188 1188 HOH HOH A . F 5 HOH 189 1189 1189 HOH HOH A . F 5 HOH 190 1190 1190 HOH HOH A . F 5 HOH 191 1191 1191 HOH HOH A . F 5 HOH 192 1192 1192 HOH HOH A . F 5 HOH 193 1193 1193 HOH HOH A . F 5 HOH 194 1194 1194 HOH HOH A . F 5 HOH 195 1195 1195 HOH HOH A . F 5 HOH 196 1196 1196 HOH HOH A . F 5 HOH 197 1197 1197 HOH HOH A . F 5 HOH 198 1198 1198 HOH HOH A . F 5 HOH 199 1199 1199 HOH HOH A . F 5 HOH 200 1200 1200 HOH HOH A . F 5 HOH 201 1201 1201 HOH HOH A . F 5 HOH 202 1202 1202 HOH HOH A . F 5 HOH 203 1203 1203 HOH HOH A . F 5 HOH 204 1204 1204 HOH HOH A . F 5 HOH 205 1205 1205 HOH HOH A . F 5 HOH 206 1206 1206 HOH HOH A . F 5 HOH 207 1207 1207 HOH HOH A . F 5 HOH 208 1208 1208 HOH HOH A . F 5 HOH 209 1209 1209 HOH HOH A . F 5 HOH 210 1210 1210 HOH HOH A . F 5 HOH 211 1211 1211 HOH HOH A . F 5 HOH 212 1212 1212 HOH HOH A . F 5 HOH 213 1213 1213 HOH HOH A . F 5 HOH 214 1214 1214 HOH HOH A . F 5 HOH 215 1215 1215 HOH HOH A . F 5 HOH 216 1216 1216 HOH HOH A . F 5 HOH 217 1217 1217 HOH HOH A . F 5 HOH 218 1218 1218 HOH HOH A . F 5 HOH 219 1219 1219 HOH HOH A . F 5 HOH 220 1220 1220 HOH HOH A . F 5 HOH 221 1221 1221 HOH HOH A . F 5 HOH 222 1222 1222 HOH HOH A . F 5 HOH 223 1223 1223 HOH HOH A . F 5 HOH 224 1224 1224 HOH HOH A . F 5 HOH 225 1225 1225 HOH HOH A . F 5 HOH 226 1226 1226 HOH HOH A . F 5 HOH 227 1227 1227 HOH HOH A . F 5 HOH 228 1228 1228 HOH HOH A . F 5 HOH 229 1229 1229 HOH HOH A . F 5 HOH 230 1230 1230 HOH HOH A . F 5 HOH 231 1231 1231 HOH HOH A . F 5 HOH 232 1232 1232 HOH HOH A . F 5 HOH 233 1233 1233 HOH HOH A . F 5 HOH 234 1234 1234 HOH HOH A . F 5 HOH 235 1235 1235 HOH HOH A . F 5 HOH 236 1236 1236 HOH HOH A . F 5 HOH 237 1237 1237 HOH HOH A . F 5 HOH 238 1238 1238 HOH HOH A . F 5 HOH 239 1239 1239 HOH HOH A . F 5 HOH 240 1240 1240 HOH HOH A . F 5 HOH 241 1241 1241 HOH HOH A . F 5 HOH 242 1242 1242 HOH HOH A . F 5 HOH 243 1243 1243 HOH HOH A . F 5 HOH 244 1244 1244 HOH HOH A . F 5 HOH 245 1245 1245 HOH HOH A . F 5 HOH 246 1246 1246 HOH HOH A . F 5 HOH 247 1247 1247 HOH HOH A . F 5 HOH 248 1248 1248 HOH HOH A . F 5 HOH 249 1249 1249 HOH HOH A . F 5 HOH 250 1250 1250 HOH HOH A . F 5 HOH 251 1251 1251 HOH HOH A . F 5 HOH 252 1252 1252 HOH HOH A . F 5 HOH 253 1253 1253 HOH HOH A . F 5 HOH 254 1254 1254 HOH HOH A . F 5 HOH 255 1255 1255 HOH HOH A . F 5 HOH 256 1256 1256 HOH HOH A . F 5 HOH 257 1257 1257 HOH HOH A . F 5 HOH 258 1258 1258 HOH HOH A . F 5 HOH 259 1259 1259 HOH HOH A . F 5 HOH 260 1260 1260 HOH HOH A . F 5 HOH 261 1261 1261 HOH HOH A . F 5 HOH 262 1262 1262 HOH HOH A . F 5 HOH 263 1263 1263 HOH HOH A . F 5 HOH 264 1264 1264 HOH HOH A . F 5 HOH 265 1265 1265 HOH HOH A . F 5 HOH 266 1266 1266 HOH HOH A . F 5 HOH 267 1267 1267 HOH HOH A . F 5 HOH 268 1268 1268 HOH HOH A . F 5 HOH 269 1269 1269 HOH HOH A . F 5 HOH 270 1270 1270 HOH HOH A . F 5 HOH 271 1271 1271 HOH HOH A . F 5 HOH 272 1272 1272 HOH HOH A . F 5 HOH 273 1273 1273 HOH HOH A . F 5 HOH 274 1275 1275 HOH HOH A . F 5 HOH 275 1276 1276 HOH HOH A . F 5 HOH 276 1277 1277 HOH HOH A . F 5 HOH 277 1278 1278 HOH HOH A . F 5 HOH 278 1279 1279 HOH HOH A . F 5 HOH 279 1280 1280 HOH HOH A . F 5 HOH 280 1281 1281 HOH HOH A . F 5 HOH 281 1282 1282 HOH HOH A . #