data_3ROG # _entry.id 3ROG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3ROG pdb_00003rog 10.2210/pdb3rog/pdb RCSB RCSB065181 ? ? WWPDB D_1000065181 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-07-18 2 'Structure model' 1 1 2012-10-31 3 'Structure model' 1 2 2022-04-13 4 'Structure model' 1 3 2023-09-13 5 'Structure model' 1 4 2023-12-06 6 'Structure model' 1 5 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Structure summary' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Data collection' 8 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 3 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' struct_conn 5 3 'Structure model' struct_ref_seq_dif 6 3 'Structure model' struct_site 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' pdbx_initial_refinement_model 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 6 'Structure model' pdbx_entry_details 13 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.identifier_ORCID' 2 3 'Structure model' '_citation_author.identifier_ORCID' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 3 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 3 'Structure model' '_struct_site.pdbx_auth_seq_id' 10 5 'Structure model' '_chem_comp_atom.atom_id' 11 5 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_database_status.entry_id 3ROG _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-04-25 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2O8N Apo-protein unspecified PDB 2DG2 Apo-protein unspecified PDB 3RNO . unspecified PDB 3RO7 . unspecified PDB 3ROE . unspecified PDB 3ROX . unspecified PDB 3ROZ . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shumilin, I.A.' 1 ? 'Jha, K.N.' 2 ? 'Cymborowski, M.' 3 ? 'Herr, J.C.' 4 ? 'Minor, W.' 5 0000-0001-7075-7090 # _citation.id primary _citation.title 'Identification of unknown protein function using metabolite cocktail screening.' _citation.journal_abbrev Structure _citation.journal_volume 20 _citation.page_first 1715 _citation.page_last 1725 _citation.year 2012 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22940582 _citation.pdbx_database_id_DOI 10.1016/j.str.2012.07.016 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shumilin, I.A.' 1 ? primary 'Cymborowski, M.' 2 ? primary 'Chertihin, O.' 3 ? primary 'Jha, K.N.' 4 ? primary 'Herr, J.C.' 5 ? primary 'Lesley, S.A.' 6 ? primary 'Joachimiak, A.' 7 ? primary 'Minor, W.' 8 0000-0001-7075-7090 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Apolipoprotein A-I-binding protein' 29872.963 1 ? ? ? ? 2 non-polymer syn "THYMIDINE-3'-PHOSPHATE" 322.208 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 59 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name AI-BP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)QQSVCRARPIWWGTQRRGSET(MSE)AGAAVKYLSQEEAQAVDQELFNEYQFSVDQL(MSE)ELAGLSCATAIAK AYPPTS(MSE)SKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQK(MSE)DIPFLGE (MSE)PPEP(MSE)(MSE)VDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPD LLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MQQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPP TVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFG FSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEK KYQLNLPSYPDTECVYRLQHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "THYMIDINE-3'-PHOSPHATE" T3P 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLN n 1 3 GLN n 1 4 SER n 1 5 VAL n 1 6 CYS n 1 7 ARG n 1 8 ALA n 1 9 ARG n 1 10 PRO n 1 11 ILE n 1 12 TRP n 1 13 TRP n 1 14 GLY n 1 15 THR n 1 16 GLN n 1 17 ARG n 1 18 ARG n 1 19 GLY n 1 20 SER n 1 21 GLU n 1 22 THR n 1 23 MSE n 1 24 ALA n 1 25 GLY n 1 26 ALA n 1 27 ALA n 1 28 VAL n 1 29 LYS n 1 30 TYR n 1 31 LEU n 1 32 SER n 1 33 GLN n 1 34 GLU n 1 35 GLU n 1 36 ALA n 1 37 GLN n 1 38 ALA n 1 39 VAL n 1 40 ASP n 1 41 GLN n 1 42 GLU n 1 43 LEU n 1 44 PHE n 1 45 ASN n 1 46 GLU n 1 47 TYR n 1 48 GLN n 1 49 PHE n 1 50 SER n 1 51 VAL n 1 52 ASP n 1 53 GLN n 1 54 LEU n 1 55 MSE n 1 56 GLU n 1 57 LEU n 1 58 ALA n 1 59 GLY n 1 60 LEU n 1 61 SER n 1 62 CYS n 1 63 ALA n 1 64 THR n 1 65 ALA n 1 66 ILE n 1 67 ALA n 1 68 LYS n 1 69 ALA n 1 70 TYR n 1 71 PRO n 1 72 PRO n 1 73 THR n 1 74 SER n 1 75 MSE n 1 76 SER n 1 77 LYS n 1 78 SER n 1 79 PRO n 1 80 PRO n 1 81 THR n 1 82 VAL n 1 83 LEU n 1 84 VAL n 1 85 ILE n 1 86 CYS n 1 87 GLY n 1 88 PRO n 1 89 GLY n 1 90 ASN n 1 91 ASN n 1 92 GLY n 1 93 GLY n 1 94 ASP n 1 95 GLY n 1 96 LEU n 1 97 VAL n 1 98 CYS n 1 99 ALA n 1 100 ARG n 1 101 HIS n 1 102 LEU n 1 103 LYS n 1 104 LEU n 1 105 PHE n 1 106 GLY n 1 107 TYR n 1 108 GLN n 1 109 PRO n 1 110 THR n 1 111 ILE n 1 112 TYR n 1 113 TYR n 1 114 PRO n 1 115 LYS n 1 116 ARG n 1 117 PRO n 1 118 ASN n 1 119 LYS n 1 120 PRO n 1 121 LEU n 1 122 PHE n 1 123 THR n 1 124 GLY n 1 125 LEU n 1 126 VAL n 1 127 THR n 1 128 GLN n 1 129 CYS n 1 130 GLN n 1 131 LYS n 1 132 MSE n 1 133 ASP n 1 134 ILE n 1 135 PRO n 1 136 PHE n 1 137 LEU n 1 138 GLY n 1 139 GLU n 1 140 MSE n 1 141 PRO n 1 142 PRO n 1 143 GLU n 1 144 PRO n 1 145 MSE n 1 146 MSE n 1 147 VAL n 1 148 ASP n 1 149 GLU n 1 150 LEU n 1 151 TYR n 1 152 GLU n 1 153 LEU n 1 154 VAL n 1 155 VAL n 1 156 ASP n 1 157 ALA n 1 158 ILE n 1 159 PHE n 1 160 GLY n 1 161 PHE n 1 162 SER n 1 163 PHE n 1 164 LYS n 1 165 GLY n 1 166 ASP n 1 167 VAL n 1 168 ARG n 1 169 GLU n 1 170 PRO n 1 171 PHE n 1 172 HIS n 1 173 SER n 1 174 ILE n 1 175 LEU n 1 176 SER n 1 177 VAL n 1 178 LEU n 1 179 SER n 1 180 GLY n 1 181 LEU n 1 182 THR n 1 183 VAL n 1 184 PRO n 1 185 ILE n 1 186 ALA n 1 187 SER n 1 188 ILE n 1 189 ASP n 1 190 ILE n 1 191 PRO n 1 192 SER n 1 193 GLY n 1 194 TRP n 1 195 ASP n 1 196 VAL n 1 197 GLU n 1 198 LYS n 1 199 GLY n 1 200 ASN n 1 201 PRO n 1 202 SER n 1 203 GLY n 1 204 ILE n 1 205 GLN n 1 206 PRO n 1 207 ASP n 1 208 LEU n 1 209 LEU n 1 210 ILE n 1 211 SER n 1 212 LEU n 1 213 THR n 1 214 ALA n 1 215 PRO n 1 216 LYS n 1 217 LYS n 1 218 SER n 1 219 ALA n 1 220 THR n 1 221 HIS n 1 222 PHE n 1 223 THR n 1 224 GLY n 1 225 ARG n 1 226 TYR n 1 227 HIS n 1 228 TYR n 1 229 LEU n 1 230 GLY n 1 231 GLY n 1 232 ARG n 1 233 PHE n 1 234 VAL n 1 235 PRO n 1 236 PRO n 1 237 ALA n 1 238 LEU n 1 239 GLU n 1 240 LYS n 1 241 LYS n 1 242 TYR n 1 243 GLN n 1 244 LEU n 1 245 ASN n 1 246 LEU n 1 247 PRO n 1 248 SER n 1 249 TYR n 1 250 PRO n 1 251 ASP n 1 252 THR n 1 253 GLU n 1 254 CYS n 1 255 VAL n 1 256 TYR n 1 257 ARG n 1 258 LEU n 1 259 GLN n 1 260 HIS n 1 261 HIS n 1 262 HIS n 1 263 HIS n 1 264 HIS n 1 265 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Aibp, Apoa1bp' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET21A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 T3P 'DNA linking' n "THYMIDINE-3'-PHOSPHATE" ;ALPHA-ANOMERIC THYMIDINE-3'-PHOSPHATE ; 'C10 H15 N2 O8 P' 322.208 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 0 ? ? ? A . n A 1 2 GLN 2 1 ? ? ? A . n A 1 3 GLN 3 2 ? ? ? A . n A 1 4 SER 4 3 ? ? ? A . n A 1 5 VAL 5 4 ? ? ? A . n A 1 6 CYS 6 5 ? ? ? A . n A 1 7 ARG 7 6 ? ? ? A . n A 1 8 ALA 8 7 ? ? ? A . n A 1 9 ARG 9 8 ? ? ? A . n A 1 10 PRO 10 9 ? ? ? A . n A 1 11 ILE 11 10 ? ? ? A . n A 1 12 TRP 12 11 ? ? ? A . n A 1 13 TRP 13 12 ? ? ? A . n A 1 14 GLY 14 13 ? ? ? A . n A 1 15 THR 15 14 ? ? ? A . n A 1 16 GLN 16 15 ? ? ? A . n A 1 17 ARG 17 16 ? ? ? A . n A 1 18 ARG 18 17 ? ? ? A . n A 1 19 GLY 19 18 ? ? ? A . n A 1 20 SER 20 19 ? ? ? A . n A 1 21 GLU 21 20 ? ? ? A . n A 1 22 THR 22 21 ? ? ? A . n A 1 23 MSE 23 22 ? ? ? A . n A 1 24 ALA 24 23 ? ? ? A . n A 1 25 GLY 25 24 ? ? ? A . n A 1 26 ALA 26 25 ? ? ? A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 VAL 28 27 27 VAL VAL A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 TYR 30 29 29 TYR TYR A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 GLN 33 32 32 GLN GLN A . n A 1 34 GLU 34 33 33 GLU GLU A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 ALA 36 35 35 ALA ALA A . n A 1 37 GLN 37 36 36 GLN GLN A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 VAL 39 38 38 VAL VAL A . n A 1 40 ASP 40 39 39 ASP ASP A . n A 1 41 GLN 41 40 40 GLN GLN A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 ASN 45 44 44 ASN ASN A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 TYR 47 46 46 TYR TYR A . n A 1 48 GLN 48 47 47 GLN GLN A . n A 1 49 PHE 49 48 48 PHE PHE A . n A 1 50 SER 50 49 49 SER SER A . n A 1 51 VAL 51 50 50 VAL VAL A . n A 1 52 ASP 52 51 51 ASP ASP A . n A 1 53 GLN 53 52 52 GLN GLN A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 MSE 55 54 54 MSE MSE A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 ALA 58 57 57 ALA ALA A . n A 1 59 GLY 59 58 58 GLY GLY A . n A 1 60 LEU 60 59 59 LEU LEU A . n A 1 61 SER 61 60 60 SER SER A . n A 1 62 CYS 62 61 61 CYS CYS A . n A 1 63 ALA 63 62 62 ALA ALA A . n A 1 64 THR 64 63 63 THR THR A . n A 1 65 ALA 65 64 64 ALA ALA A . n A 1 66 ILE 66 65 65 ILE ILE A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 TYR 70 69 69 TYR TYR A . n A 1 71 PRO 71 70 70 PRO PRO A . n A 1 72 PRO 72 71 71 PRO PRO A . n A 1 73 THR 73 72 72 THR THR A . n A 1 74 SER 74 73 73 SER SER A . n A 1 75 MSE 75 74 74 MSE MSE A . n A 1 76 SER 76 75 75 SER SER A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 SER 78 77 77 SER SER A . n A 1 79 PRO 79 78 78 PRO PRO A . n A 1 80 PRO 80 79 79 PRO PRO A . n A 1 81 THR 81 80 80 THR THR A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 VAL 84 83 83 VAL VAL A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 CYS 86 85 85 CYS CYS A . n A 1 87 GLY 87 86 86 GLY GLY A . n A 1 88 PRO 88 87 87 PRO PRO A . n A 1 89 GLY 89 88 88 GLY GLY A . n A 1 90 ASN 90 89 89 ASN ASN A . n A 1 91 ASN 91 90 90 ASN ASN A . n A 1 92 GLY 92 91 91 GLY GLY A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 ASP 94 93 93 ASP ASP A . n A 1 95 GLY 95 94 94 GLY GLY A . n A 1 96 LEU 96 95 95 LEU LEU A . n A 1 97 VAL 97 96 96 VAL VAL A . n A 1 98 CYS 98 97 97 CYS CYS A . n A 1 99 ALA 99 98 98 ALA ALA A . n A 1 100 ARG 100 99 99 ARG ARG A . n A 1 101 HIS 101 100 100 HIS HIS A . n A 1 102 LEU 102 101 101 LEU LEU A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 LEU 104 103 103 LEU LEU A . n A 1 105 PHE 105 104 104 PHE PHE A . n A 1 106 GLY 106 105 105 GLY GLY A . n A 1 107 TYR 107 106 106 TYR TYR A . n A 1 108 GLN 108 107 107 GLN GLN A . n A 1 109 PRO 109 108 108 PRO PRO A . n A 1 110 THR 110 109 109 THR THR A . n A 1 111 ILE 111 110 110 ILE ILE A . n A 1 112 TYR 112 111 111 TYR TYR A . n A 1 113 TYR 113 112 112 TYR TYR A . n A 1 114 PRO 114 113 113 PRO PRO A . n A 1 115 LYS 115 114 114 LYS LYS A . n A 1 116 ARG 116 115 115 ARG ARG A . n A 1 117 PRO 117 116 116 PRO PRO A . n A 1 118 ASN 118 117 117 ASN ASN A . n A 1 119 LYS 119 118 118 LYS LYS A . n A 1 120 PRO 120 119 119 PRO PRO A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 PHE 122 121 121 PHE PHE A . n A 1 123 THR 123 122 122 THR THR A . n A 1 124 GLY 124 123 123 GLY GLY A . n A 1 125 LEU 125 124 124 LEU LEU A . n A 1 126 VAL 126 125 125 VAL VAL A . n A 1 127 THR 127 126 126 THR THR A . n A 1 128 GLN 128 127 127 GLN GLN A . n A 1 129 CYS 129 128 128 CYS CYS A . n A 1 130 GLN 130 129 129 GLN GLN A . n A 1 131 LYS 131 130 130 LYS LYS A . n A 1 132 MSE 132 131 131 MSE MSE A . n A 1 133 ASP 133 132 132 ASP ASP A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 PRO 135 134 134 PRO PRO A . n A 1 136 PHE 136 135 135 PHE PHE A . n A 1 137 LEU 137 136 136 LEU LEU A . n A 1 138 GLY 138 137 137 GLY GLY A . n A 1 139 GLU 139 138 138 GLU GLU A . n A 1 140 MSE 140 139 139 MSE MSE A . n A 1 141 PRO 141 140 140 PRO PRO A . n A 1 142 PRO 142 141 141 PRO PRO A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 PRO 144 143 143 PRO PRO A . n A 1 145 MSE 145 144 144 MSE MSE A . n A 1 146 MSE 146 145 145 MSE MSE A . n A 1 147 VAL 147 146 146 VAL VAL A . n A 1 148 ASP 148 147 147 ASP ASP A . n A 1 149 GLU 149 148 148 GLU GLU A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 TYR 151 150 150 TYR TYR A . n A 1 152 GLU 152 151 151 GLU GLU A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 VAL 154 153 153 VAL VAL A . n A 1 155 VAL 155 154 154 VAL VAL A . n A 1 156 ASP 156 155 155 ASP ASP A . n A 1 157 ALA 157 156 156 ALA ALA A . n A 1 158 ILE 158 157 157 ILE ILE A . n A 1 159 PHE 159 158 158 PHE PHE A . n A 1 160 GLY 160 159 159 GLY GLY A . n A 1 161 PHE 161 160 160 PHE PHE A . n A 1 162 SER 162 161 161 SER SER A . n A 1 163 PHE 163 162 162 PHE PHE A . n A 1 164 LYS 164 163 163 LYS LYS A . n A 1 165 GLY 165 164 164 GLY GLY A . n A 1 166 ASP 166 165 165 ASP ASP A . n A 1 167 VAL 167 166 166 VAL VAL A . n A 1 168 ARG 168 167 167 ARG ARG A . n A 1 169 GLU 169 168 168 GLU GLU A . n A 1 170 PRO 170 169 169 PRO PRO A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 HIS 172 171 171 HIS HIS A . n A 1 173 SER 173 172 172 SER SER A . n A 1 174 ILE 174 173 173 ILE ILE A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 SER 176 175 175 SER SER A . n A 1 177 VAL 177 176 176 VAL VAL A . n A 1 178 LEU 178 177 177 LEU LEU A . n A 1 179 SER 179 178 178 SER SER A . n A 1 180 GLY 180 179 179 GLY GLY A . n A 1 181 LEU 181 180 180 LEU LEU A . n A 1 182 THR 182 181 181 THR THR A . n A 1 183 VAL 183 182 182 VAL VAL A . n A 1 184 PRO 184 183 183 PRO PRO A . n A 1 185 ILE 185 184 184 ILE ILE A . n A 1 186 ALA 186 185 185 ALA ALA A . n A 1 187 SER 187 186 186 SER SER A . n A 1 188 ILE 188 187 187 ILE ILE A . n A 1 189 ASP 189 188 188 ASP ASP A . n A 1 190 ILE 190 189 189 ILE ILE A . n A 1 191 PRO 191 190 190 PRO PRO A . n A 1 192 SER 192 191 191 SER SER A . n A 1 193 GLY 193 192 192 GLY GLY A . n A 1 194 TRP 194 193 193 TRP TRP A . n A 1 195 ASP 195 194 194 ASP ASP A . n A 1 196 VAL 196 195 195 VAL VAL A . n A 1 197 GLU 197 196 196 GLU GLU A . n A 1 198 LYS 198 197 197 LYS LYS A . n A 1 199 GLY 199 198 198 GLY GLY A . n A 1 200 ASN 200 199 199 ASN ASN A . n A 1 201 PRO 201 200 200 PRO PRO A . n A 1 202 SER 202 201 201 SER SER A . n A 1 203 GLY 203 202 202 GLY GLY A . n A 1 204 ILE 204 203 203 ILE ILE A . n A 1 205 GLN 205 204 204 GLN GLN A . n A 1 206 PRO 206 205 205 PRO PRO A . n A 1 207 ASP 207 206 206 ASP ASP A . n A 1 208 LEU 208 207 207 LEU LEU A . n A 1 209 LEU 209 208 208 LEU LEU A . n A 1 210 ILE 210 209 209 ILE ILE A . n A 1 211 SER 211 210 210 SER SER A . n A 1 212 LEU 212 211 211 LEU LEU A . n A 1 213 THR 213 212 212 THR THR A . n A 1 214 ALA 214 213 213 ALA ALA A . n A 1 215 PRO 215 214 214 PRO PRO A . n A 1 216 LYS 216 215 215 LYS LYS A . n A 1 217 LYS 217 216 216 LYS LYS A . n A 1 218 SER 218 217 217 SER SER A . n A 1 219 ALA 219 218 218 ALA ALA A . n A 1 220 THR 220 219 219 THR THR A . n A 1 221 HIS 221 220 220 HIS HIS A . n A 1 222 PHE 222 221 221 PHE PHE A . n A 1 223 THR 223 222 222 THR THR A . n A 1 224 GLY 224 223 223 GLY GLY A . n A 1 225 ARG 225 224 224 ARG ARG A . n A 1 226 TYR 226 225 225 TYR TYR A . n A 1 227 HIS 227 226 226 HIS HIS A . n A 1 228 TYR 228 227 227 TYR TYR A . n A 1 229 LEU 229 228 228 LEU LEU A . n A 1 230 GLY 230 229 229 GLY GLY A . n A 1 231 GLY 231 230 230 GLY GLY A . n A 1 232 ARG 232 231 231 ARG ARG A . n A 1 233 PHE 233 232 232 PHE PHE A . n A 1 234 VAL 234 233 233 VAL VAL A . n A 1 235 PRO 235 234 234 PRO PRO A . n A 1 236 PRO 236 235 235 PRO PRO A . n A 1 237 ALA 237 236 236 ALA ALA A . n A 1 238 LEU 238 237 237 LEU LEU A . n A 1 239 GLU 239 238 238 GLU GLU A . n A 1 240 LYS 240 239 239 LYS LYS A . n A 1 241 LYS 241 240 240 LYS LYS A . n A 1 242 TYR 242 241 241 TYR TYR A . n A 1 243 GLN 243 242 242 GLN GLN A . n A 1 244 LEU 244 243 243 LEU LEU A . n A 1 245 ASN 245 244 244 ASN ASN A . n A 1 246 LEU 246 245 245 LEU LEU A . n A 1 247 PRO 247 246 246 PRO PRO A . n A 1 248 SER 248 247 247 SER SER A . n A 1 249 TYR 249 248 248 TYR TYR A . n A 1 250 PRO 250 249 249 PRO PRO A . n A 1 251 ASP 251 250 250 ASP ASP A . n A 1 252 THR 252 251 251 THR THR A . n A 1 253 GLU 253 252 252 GLU GLU A . n A 1 254 CYS 254 253 253 CYS CYS A . n A 1 255 VAL 255 254 254 VAL VAL A . n A 1 256 TYR 256 255 255 TYR TYR A . n A 1 257 ARG 257 256 256 ARG ARG A . n A 1 258 LEU 258 257 257 LEU LEU A . n A 1 259 GLN 259 258 258 GLN GLN A . n A 1 260 HIS 260 259 ? ? ? A . n A 1 261 HIS 261 260 ? ? ? A . n A 1 262 HIS 262 261 ? ? ? A . n A 1 263 HIS 263 262 ? ? ? A . n A 1 264 HIS 264 263 ? ? ? A . n A 1 265 HIS 265 264 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 T3P 1 265 1 T3P T3P A . C 3 SO4 1 266 2 SO4 SO4 A . D 4 HOH 1 267 1 HOH HOH A . D 4 HOH 2 268 2 HOH HOH A . D 4 HOH 3 269 3 HOH HOH A . D 4 HOH 4 270 4 HOH HOH A . D 4 HOH 5 271 5 HOH HOH A . D 4 HOH 6 272 6 HOH HOH A . D 4 HOH 7 273 7 HOH HOH A . D 4 HOH 8 274 8 HOH HOH A . D 4 HOH 9 275 9 HOH HOH A . D 4 HOH 10 276 10 HOH HOH A . D 4 HOH 11 277 11 HOH HOH A . D 4 HOH 12 278 12 HOH HOH A . D 4 HOH 13 279 13 HOH HOH A . D 4 HOH 14 280 14 HOH HOH A . D 4 HOH 15 281 15 HOH HOH A . D 4 HOH 16 282 16 HOH HOH A . D 4 HOH 17 283 17 HOH HOH A . D 4 HOH 18 284 18 HOH HOH A . D 4 HOH 19 285 19 HOH HOH A . D 4 HOH 20 286 20 HOH HOH A . D 4 HOH 21 287 21 HOH HOH A . D 4 HOH 22 288 22 HOH HOH A . D 4 HOH 23 289 23 HOH HOH A . D 4 HOH 24 290 24 HOH HOH A . D 4 HOH 25 291 25 HOH HOH A . D 4 HOH 26 292 26 HOH HOH A . D 4 HOH 27 293 27 HOH HOH A . D 4 HOH 28 294 28 HOH HOH A . D 4 HOH 29 295 29 HOH HOH A . D 4 HOH 30 296 30 HOH HOH A . D 4 HOH 31 297 31 HOH HOH A . D 4 HOH 32 298 32 HOH HOH A . D 4 HOH 33 299 33 HOH HOH A . D 4 HOH 34 300 34 HOH HOH A . D 4 HOH 35 301 35 HOH HOH A . D 4 HOH 36 302 36 HOH HOH A . D 4 HOH 37 303 37 HOH HOH A . D 4 HOH 38 304 38 HOH HOH A . D 4 HOH 39 305 39 HOH HOH A . D 4 HOH 40 306 40 HOH HOH A . D 4 HOH 41 307 41 HOH HOH A . D 4 HOH 42 308 42 HOH HOH A . D 4 HOH 43 309 43 HOH HOH A . D 4 HOH 44 310 44 HOH HOH A . D 4 HOH 45 311 45 HOH HOH A . D 4 HOH 46 312 46 HOH HOH A . D 4 HOH 47 313 47 HOH HOH A . D 4 HOH 48 314 48 HOH HOH A . D 4 HOH 49 315 49 HOH HOH A . D 4 HOH 50 316 50 HOH HOH A . D 4 HOH 51 317 51 HOH HOH A . D 4 HOH 52 318 52 HOH HOH A . D 4 HOH 53 319 53 HOH HOH A . D 4 HOH 54 320 54 HOH HOH A . D 4 HOH 55 321 55 HOH HOH A . D 4 HOH 56 322 56 HOH HOH A . D 4 HOH 57 323 57 HOH HOH A . D 4 HOH 58 324 58 HOH HOH A . D 4 HOH 59 325 59 HOH HOH A . # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC 5.5.0109 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 2 HKL-3000 . ? ? ? ? 'data collection' ? ? ? 3 HKL-3000 . ? ? ? ? 'data reduction' ? ? ? 4 HKL-3000 . ? ? ? ? 'data scaling' ? ? ? 5 HKL-3000 MOLREP ? ? ? ? phasing ? ? ? 6 # _cell.entry_id 3ROG _cell.length_a 126.094 _cell.length_b 126.094 _cell.length_c 110.962 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 18 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3ROG _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 155 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 3ROG _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.84 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 56.71 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details '0.1 M SODIUM ACETATE, 1.5 M AMMONIUM SULFATE, PH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC-3 _diffrn_detector.details MIRRORS _diffrn_detector.pdbx_collection_date 2008-06-23 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.04399 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.04399 # _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 2.05 _reflns.number_obs 119546 _reflns.number_all 119546 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.061 _reflns.pdbx_Rsym_value 0.061 _reflns.pdbx_netI_over_sigmaI 38.741 _reflns.pdbx_redundancy 5.6 _reflns.entry_id 3ROG _reflns.B_iso_Wilson_estimate 35.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.09 _reflns_shell.percent_possible_all 99.4 _reflns_shell.Rmerge_I_obs 0.361 _reflns_shell.pdbx_Rsym_value 0.361 _reflns_shell.meanI_over_sigI_obs 3.203 _reflns_shell.pdbx_redundancy 3.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3ROG _refine.ls_d_res_high 2.050 _refine.ls_d_res_low 50.000 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.300 _refine.ls_number_reflns_obs 21270 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS; U VALUES: RESIDUAL ONLY' _refine.ls_R_factor_obs 0.180 _refine.ls_R_factor_R_work 0.179 _refine.ls_R_factor_R_free 0.201 _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 1089 _refine.B_iso_mean 55.107 _refine.aniso_B[1][1] -4.540 _refine.aniso_B[2][2] -4.540 _refine.aniso_B[3][3] 6.810 _refine.aniso_B[1][2] -2.270 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.969 _refine.correlation_coeff_Fo_to_Fc_free 0.961 _refine.pdbx_overall_ESU_R_Free 0.129 _refine.overall_SU_ML 0.112 _refine.overall_SU_B 8.857 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.B_iso_max 120.52 _refine.B_iso_min 34.24 _refine.occupancy_max 1.00 _refine.occupancy_min 1.00 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model 'PDB ENTRY 2O8N' _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1808 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 59 _refine_hist.number_atoms_total 1893 _refine_hist.d_res_high 2.050 _refine_hist.d_res_low 50.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 1885 0.021 0.022 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 1281 0.000 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2571 1.752 2.010 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 3152 4.042 3.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 232 6.372 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 75 41.640 24.667 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 301 15.567 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 6 17.589 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 281 0.110 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 2058 0.009 0.021 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 351 0.010 0.020 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 1169 0.971 1.500 ? ? 'X-RAY DIFFRACTION' r_mcbond_other 460 0.000 1.500 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 1900 1.658 2.000 ? ? 'X-RAY DIFFRACTION' r_scbond_it 716 2.885 3.000 ? ? 'X-RAY DIFFRACTION' r_scangle_it 671 4.238 4.500 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.050 _refine_ls_shell.d_res_low 2.103 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 95.060 _refine_ls_shell.number_reflns_R_work 1432 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.281 _refine_ls_shell.R_factor_R_free 0.244 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 70 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1502 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3ROG _struct.title ;Crystal Structure of Mouse Apolipoprotein A-I Binding Protein in Complex with Thymidine 3'-monophosphate ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ROG _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'ROSSMANN FOLD, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AIBP_MOUSE _struct_ref.pdbx_db_accession Q8K4Z3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPT VLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGF SFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKK YQLNLPSYPDTECVYRLQ ; _struct_ref.pdbx_align_begin 25 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ROG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 259 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8K4Z3 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 282 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 258 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3ROG MSE A 1 ? UNP Q8K4Z3 ? ? 'expression tag' 0 1 1 3ROG HIS A 260 ? UNP Q8K4Z3 ? ? 'expression tag' 259 2 1 3ROG HIS A 261 ? UNP Q8K4Z3 ? ? 'expression tag' 260 3 1 3ROG HIS A 262 ? UNP Q8K4Z3 ? ? 'expression tag' 261 4 1 3ROG HIS A 263 ? UNP Q8K4Z3 ? ? 'expression tag' 262 5 1 3ROG HIS A 264 ? UNP Q8K4Z3 ? ? 'expression tag' 263 6 1 3ROG HIS A 265 ? UNP Q8K4Z3 ? ? 'expression tag' 264 7 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 3 software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2730 ? 1 MORE -18 ? 1 'SSA (A^2)' 18620 ? 2 'ABSA (A^2)' 1630 ? 2 MORE -7 ? 2 'SSA (A^2)' 19720 ? 3 'ABSA (A^2)' 9380 ? 3 MORE -41 ? 3 'SSA (A^2)' 54660 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C,D 2 1,3 A,B,C,D 3 1,4,5,3,6,7 A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_555 -x+2/3,-x+y+1/3,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 63.0470000000 -0.8660254038 0.5000000000 0.0000000000 36.4002024216 0.0000000000 0.0000000000 -1.0000000000 36.9873333333 3 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 6 'crystal symmetry operation' 5_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 7 'crystal symmetry operation' 6_555 -x,-x+y,-z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 32 ? GLU A 46 ? SER A 31 GLU A 45 1 ? 15 HELX_P HELX_P2 2 SER A 50 ? TYR A 70 ? SER A 49 TYR A 69 1 ? 21 HELX_P HELX_P3 3 PRO A 71 ? MSE A 75 ? PRO A 70 MSE A 74 5 ? 5 HELX_P HELX_P4 4 GLY A 89 ? PHE A 105 ? GLY A 88 PHE A 104 1 ? 17 HELX_P HELX_P5 5 LYS A 119 ? MSE A 132 ? LYS A 118 MSE A 131 1 ? 14 HELX_P HELX_P6 6 GLU A 143 ? TYR A 151 ? GLU A 142 TYR A 150 1 ? 9 HELX_P HELX_P7 7 PRO A 170 ? GLY A 180 ? PRO A 169 GLY A 179 1 ? 11 HELX_P HELX_P8 8 LYS A 216 ? PHE A 222 ? LYS A 215 PHE A 221 5 ? 7 HELX_P HELX_P9 9 PRO A 235 ? TYR A 242 ? PRO A 234 TYR A 241 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 54 C ? ? ? 1_555 A MSE 55 N ? ? A LEU 53 A MSE 54 1_555 ? ? ? ? ? ? ? 1.312 ? ? covale2 covale both ? A MSE 55 C ? ? ? 1_555 A GLU 56 N ? ? A MSE 54 A GLU 55 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale3 covale both ? A SER 74 C ? ? ? 1_555 A MSE 75 N ? ? A SER 73 A MSE 74 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale4 covale both ? A MSE 75 C ? ? ? 1_555 A SER 76 N ? ? A MSE 74 A SER 75 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale5 covale both ? A LYS 131 C ? ? ? 1_555 A MSE 132 N ? ? A LYS 130 A MSE 131 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale6 covale both ? A MSE 132 C ? ? ? 1_555 A ASP 133 N ? ? A MSE 131 A ASP 132 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale7 covale both ? A GLU 139 C ? ? ? 1_555 A MSE 140 N ? ? A GLU 138 A MSE 139 1_555 ? ? ? ? ? ? ? 1.317 ? ? covale8 covale both ? A MSE 140 C ? ? ? 1_555 A PRO 141 N ? ? A MSE 139 A PRO 140 1_555 ? ? ? ? ? ? ? 1.355 ? ? covale9 covale both ? A PRO 144 C ? ? ? 1_555 A MSE 145 N ? ? A PRO 143 A MSE 144 1_555 ? ? ? ? ? ? ? 1.310 ? ? covale10 covale both ? A MSE 145 C ? ? ? 1_555 A MSE 146 N ? ? A MSE 144 A MSE 145 1_555 ? ? ? ? ? ? ? 1.314 ? ? covale11 covale both ? A MSE 146 C ? ? ? 1_555 A VAL 147 N ? ? A MSE 145 A VAL 146 1_555 ? ? ? ? ? ? ? 1.318 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 55 ? . . . . MSE A 54 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 75 ? . . . . MSE A 74 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 132 ? . . . . MSE A 131 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 140 ? . . . . MSE A 139 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 145 ? . . . . MSE A 144 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 146 ? . . . . MSE A 145 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 78 A . ? SER 77 A PRO 79 A ? PRO 78 A 1 1.15 2 GLY 165 A . ? GLY 164 A ASP 166 A ? ASP 165 A 1 8.48 3 GLU 169 A . ? GLU 168 A PRO 170 A ? PRO 169 A 1 -0.82 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 108 ? TYR A 112 ? GLN A 107 TYR A 111 A 2 THR A 81 ? CYS A 86 ? THR A 80 CYS A 85 A 3 LEU A 153 ? ALA A 157 ? LEU A 152 ALA A 156 A 4 ILE A 185 ? ILE A 188 ? ILE A 184 ILE A 187 A 5 LEU A 208 ? LEU A 212 ? LEU A 207 LEU A 211 A 6 TYR A 226 ? GLY A 230 ? TYR A 225 GLY A 229 A 7 TYR A 256 ? LEU A 258 ? TYR A 255 LEU A 257 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 110 ? O THR A 109 N VAL A 84 ? N VAL A 83 A 2 3 N LEU A 83 ? N LEU A 82 O VAL A 155 ? O VAL A 154 A 3 4 N VAL A 154 ? N VAL A 153 O ALA A 186 ? O ALA A 185 A 4 5 N SER A 187 ? N SER A 186 O LEU A 208 ? O LEU A 207 A 5 6 N SER A 211 ? N SER A 210 O GLY A 230 ? O GLY A 229 A 6 7 N LEU A 229 ? N LEU A 228 O TYR A 256 ? O TYR A 255 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A T3P 265 ? 15 'BINDING SITE FOR RESIDUE T3P A 265' AC2 Software A SO4 266 ? 6 'BINDING SITE FOR RESIDUE SO4 A 266' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 ALA A 36 ? ALA A 35 . ? 1_555 ? 2 AC1 15 VAL A 39 ? VAL A 38 . ? 1_555 ? 3 AC1 15 ASP A 40 ? ASP A 39 . ? 1_555 ? 4 AC1 15 LEU A 43 ? LEU A 42 . ? 1_555 ? 5 AC1 15 LEU A 54 ? LEU A 53 . ? 1_555 ? 6 AC1 15 MSE A 55 ? MSE A 54 . ? 1_555 ? 7 AC1 15 ASN A 90 ? ASN A 89 . ? 1_555 ? 8 AC1 15 ASP A 94 ? ASP A 93 . ? 1_555 ? 9 AC1 15 PHE A 161 ? PHE A 160 . ? 1_555 ? 10 AC1 15 ASP A 189 ? ASP A 188 . ? 1_555 ? 11 AC1 15 LEU A 212 ? LEU A 211 . ? 1_555 ? 12 AC1 15 THR A 213 ? THR A 212 . ? 1_555 ? 13 AC1 15 LYS A 216 ? LYS A 215 . ? 1_555 ? 14 AC1 15 PHE A 233 ? PHE A 232 . ? 1_555 ? 15 AC1 15 HOH D . ? HOH A 280 . ? 1_555 ? 16 AC2 6 GLY A 89 ? GLY A 88 . ? 1_555 ? 17 AC2 6 ASN A 90 ? ASN A 89 . ? 1_555 ? 18 AC2 6 ASN A 91 ? ASN A 90 . ? 1_555 ? 19 AC2 6 GLY A 160 ? GLY A 159 . ? 1_555 ? 20 AC2 6 SER A 162 ? SER A 161 . ? 1_555 ? 21 AC2 6 HOH D . ? HOH A 275 . ? 1_555 ? # _pdbx_entry_details.entry_id 3ROG _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 165 ? ? 70.20 68.67 2 1 ASP A 188 ? ? 73.59 -53.50 3 1 ASN A 199 ? ? -171.99 99.04 4 1 THR A 212 ? ? 73.11 -59.00 5 1 PHE A 232 ? ? -164.79 6.36 6 1 GLN A 242 ? ? 38.41 59.61 7 1 ASP A 250 ? ? 38.66 -114.97 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 55 A MSE 54 ? MET SELENOMETHIONINE 2 A MSE 75 A MSE 74 ? MET SELENOMETHIONINE 3 A MSE 132 A MSE 131 ? MET SELENOMETHIONINE 4 A MSE 140 A MSE 139 ? MET SELENOMETHIONINE 5 A MSE 145 A MSE 144 ? MET SELENOMETHIONINE 6 A MSE 146 A MSE 145 ? MET SELENOMETHIONINE # _diffrn_reflns.av_R_equivalents 0.061 _diffrn_reflns.number 119546 _diffrn_reflns.diffrn_id 1 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.pdbx_refine_id 1 ? refined 19.8250 22.2860 27.4130 0.4017 0.5537 0.1464 -0.0791 0.0069 -0.0779 2.1641 1.9069 1.2353 1.6702 0.9645 0.4211 0.2330 -0.2597 0.0267 -0.6018 0.2473 0.1982 0.2377 0.0464 -0.2576 'X-RAY DIFFRACTION' 2 ? refined 22.6610 3.8740 5.3750 0.3592 0.5144 0.1983 0.0048 -0.0021 -0.1288 30.7182 33.9384 23.9877 -1.1779 19.2287 5.3457 0.7001 -0.3791 -0.3210 0.9298 -0.0043 0.1405 0.6586 0.9845 1.0527 'X-RAY DIFFRACTION' 3 ? refined 11.1760 19.2580 11.1400 0.3631 0.3878 0.1645 -0.0254 -0.0499 -0.0090 2.8505 2.5272 1.3514 1.7470 1.0743 0.0869 -0.0578 -0.0388 0.0966 -0.1194 0.3018 0.3292 -0.0324 -0.0684 -0.0938 'X-RAY DIFFRACTION' 4 ? refined 16.1020 12.4170 26.7990 0.4657 0.5506 0.0712 -0.1450 -0.0348 0.0411 3.0666 1.7225 1.7743 1.5079 1.2602 1.0593 0.4221 -0.3391 -0.0830 -0.7064 -0.1372 -0.0429 0.3636 0.2852 -0.3466 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.selection_details 1 1 A 26 A 70 ? . . . . 'X-RAY DIFFRACTION' ? 2 2 A 71 A 77 ? . . . . 'X-RAY DIFFRACTION' ? 3 3 A 78 A 169 ? . . . . 'X-RAY DIFFRACTION' ? 4 4 A 170 A 258 ? . . . . 'X-RAY DIFFRACTION' ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 0 ? A MSE 1 2 1 Y 1 A GLN 1 ? A GLN 2 3 1 Y 1 A GLN 2 ? A GLN 3 4 1 Y 1 A SER 3 ? A SER 4 5 1 Y 1 A VAL 4 ? A VAL 5 6 1 Y 1 A CYS 5 ? A CYS 6 7 1 Y 1 A ARG 6 ? A ARG 7 8 1 Y 1 A ALA 7 ? A ALA 8 9 1 Y 1 A ARG 8 ? A ARG 9 10 1 Y 1 A PRO 9 ? A PRO 10 11 1 Y 1 A ILE 10 ? A ILE 11 12 1 Y 1 A TRP 11 ? A TRP 12 13 1 Y 1 A TRP 12 ? A TRP 13 14 1 Y 1 A GLY 13 ? A GLY 14 15 1 Y 1 A THR 14 ? A THR 15 16 1 Y 1 A GLN 15 ? A GLN 16 17 1 Y 1 A ARG 16 ? A ARG 17 18 1 Y 1 A ARG 17 ? A ARG 18 19 1 Y 1 A GLY 18 ? A GLY 19 20 1 Y 1 A SER 19 ? A SER 20 21 1 Y 1 A GLU 20 ? A GLU 21 22 1 Y 1 A THR 21 ? A THR 22 23 1 Y 1 A MSE 22 ? A MSE 23 24 1 Y 1 A ALA 23 ? A ALA 24 25 1 Y 1 A GLY 24 ? A GLY 25 26 1 Y 1 A ALA 25 ? A ALA 26 27 1 Y 1 A HIS 259 ? A HIS 260 28 1 Y 1 A HIS 260 ? A HIS 261 29 1 Y 1 A HIS 261 ? A HIS 262 30 1 Y 1 A HIS 262 ? A HIS 263 31 1 Y 1 A HIS 263 ? A HIS 264 32 1 Y 1 A HIS 264 ? A HIS 265 # _cell_measurement.reflns_used 119546 _cell_measurement.entry_id 3ROG # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 T3P P P N N 309 T3P OP1 O N N 310 T3P OP2 O N N 311 T3P OP3 O N N 312 T3P "O5'" O N N 313 T3P "C5'" C N N 314 T3P "C4'" C N R 315 T3P "O4'" O N N 316 T3P "C3'" C N S 317 T3P "O3'" O N N 318 T3P "C2'" C N N 319 T3P "C1'" C N R 320 T3P N1 N N N 321 T3P C2 C N N 322 T3P O2 O N N 323 T3P N3 N N N 324 T3P C4 C N N 325 T3P O4 O N N 326 T3P C5 C N N 327 T3P C5M C N N 328 T3P C6 C N N 329 T3P HOP2 H N N 330 T3P HOP3 H N N 331 T3P "H5'" H N N 332 T3P "H5'1" H N N 333 T3P "H5''" H N N 334 T3P "H4'" H N N 335 T3P "H3'" H N N 336 T3P "H2'" H N N 337 T3P "H2''" H N N 338 T3P "H1'" H N N 339 T3P H3 H N N 340 T3P H51 H N N 341 T3P H52 H N N 342 T3P H53 H N N 343 T3P H6 H N N 344 THR N N N N 345 THR CA C N S 346 THR C C N N 347 THR O O N N 348 THR CB C N R 349 THR OG1 O N N 350 THR CG2 C N N 351 THR OXT O N N 352 THR H H N N 353 THR H2 H N N 354 THR HA H N N 355 THR HB H N N 356 THR HG1 H N N 357 THR HG21 H N N 358 THR HG22 H N N 359 THR HG23 H N N 360 THR HXT H N N 361 TRP N N N N 362 TRP CA C N S 363 TRP C C N N 364 TRP O O N N 365 TRP CB C N N 366 TRP CG C Y N 367 TRP CD1 C Y N 368 TRP CD2 C Y N 369 TRP NE1 N Y N 370 TRP CE2 C Y N 371 TRP CE3 C Y N 372 TRP CZ2 C Y N 373 TRP CZ3 C Y N 374 TRP CH2 C Y N 375 TRP OXT O N N 376 TRP H H N N 377 TRP H2 H N N 378 TRP HA H N N 379 TRP HB2 H N N 380 TRP HB3 H N N 381 TRP HD1 H N N 382 TRP HE1 H N N 383 TRP HE3 H N N 384 TRP HZ2 H N N 385 TRP HZ3 H N N 386 TRP HH2 H N N 387 TRP HXT H N N 388 TYR N N N N 389 TYR CA C N S 390 TYR C C N N 391 TYR O O N N 392 TYR CB C N N 393 TYR CG C Y N 394 TYR CD1 C Y N 395 TYR CD2 C Y N 396 TYR CE1 C Y N 397 TYR CE2 C Y N 398 TYR CZ C Y N 399 TYR OH O N N 400 TYR OXT O N N 401 TYR H H N N 402 TYR H2 H N N 403 TYR HA H N N 404 TYR HB2 H N N 405 TYR HB3 H N N 406 TYR HD1 H N N 407 TYR HD2 H N N 408 TYR HE1 H N N 409 TYR HE2 H N N 410 TYR HH H N N 411 TYR HXT H N N 412 VAL N N N N 413 VAL CA C N S 414 VAL C C N N 415 VAL O O N N 416 VAL CB C N N 417 VAL CG1 C N N 418 VAL CG2 C N N 419 VAL OXT O N N 420 VAL H H N N 421 VAL H2 H N N 422 VAL HA H N N 423 VAL HB H N N 424 VAL HG11 H N N 425 VAL HG12 H N N 426 VAL HG13 H N N 427 VAL HG21 H N N 428 VAL HG22 H N N 429 VAL HG23 H N N 430 VAL HXT H N N 431 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 T3P P OP1 doub N N 294 T3P P OP2 sing N N 295 T3P P OP3 sing N N 296 T3P P "O3'" sing N N 297 T3P OP2 HOP2 sing N N 298 T3P OP3 HOP3 sing N N 299 T3P "O5'" "C5'" sing N N 300 T3P "O5'" "H5'" sing N N 301 T3P "C5'" "C4'" sing N N 302 T3P "C5'" "H5'1" sing N N 303 T3P "C5'" "H5''" sing N N 304 T3P "C4'" "O4'" sing N N 305 T3P "C4'" "C3'" sing N N 306 T3P "C4'" "H4'" sing N N 307 T3P "O4'" "C1'" sing N N 308 T3P "C3'" "O3'" sing N N 309 T3P "C3'" "C2'" sing N N 310 T3P "C3'" "H3'" sing N N 311 T3P "C2'" "C1'" sing N N 312 T3P "C2'" "H2'" sing N N 313 T3P "C2'" "H2''" sing N N 314 T3P "C1'" N1 sing N N 315 T3P "C1'" "H1'" sing N N 316 T3P N1 C2 sing N N 317 T3P N1 C6 sing N N 318 T3P C2 O2 doub N N 319 T3P C2 N3 sing N N 320 T3P N3 C4 sing N N 321 T3P N3 H3 sing N N 322 T3P C4 O4 doub N N 323 T3P C4 C5 sing N N 324 T3P C5 C5M sing N N 325 T3P C5 C6 doub N N 326 T3P C5M H51 sing N N 327 T3P C5M H52 sing N N 328 T3P C5M H53 sing N N 329 T3P C6 H6 sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2O8N _pdbx_initial_refinement_model.details 'PDB ENTRY 2O8N' # _atom_sites.entry_id 3ROG _atom_sites.fract_transf_matrix[1][1] 0.007931 _atom_sites.fract_transf_matrix[1][2] 0.004579 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009157 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009012 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S SE # loop_