data_3ROG
# 
_entry.id   3ROG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.399 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3ROG         pdb_00003rog 10.2210/pdb3rog/pdb 
RCSB  RCSB065181   ?            ?                   
WWPDB D_1000065181 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-18 
2 'Structure model' 1 1 2012-10-31 
3 'Structure model' 1 2 2022-04-13 
4 'Structure model' 1 3 2023-09-13 
5 'Structure model' 1 4 2023-12-06 
6 'Structure model' 1 5 2024-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 3 'Structure model' 'Derived calculations'   
4 3 'Structure model' 'Structure summary'      
5 4 'Structure model' 'Data collection'        
6 4 'Structure model' 'Refinement description' 
7 5 'Structure model' 'Data collection'        
8 6 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' audit_author                  
2  3 'Structure model' citation_author               
3  3 'Structure model' database_2                    
4  3 'Structure model' struct_conn                   
5  3 'Structure model' struct_ref_seq_dif            
6  3 'Structure model' struct_site                   
7  4 'Structure model' chem_comp_atom                
8  4 'Structure model' chem_comp_bond                
9  4 'Structure model' pdbx_initial_refinement_model 
10 5 'Structure model' chem_comp_atom                
11 5 'Structure model' chem_comp_bond                
12 6 'Structure model' pdbx_entry_details            
13 6 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_audit_author.identifier_ORCID'      
2  3 'Structure model' '_citation_author.identifier_ORCID'   
3  3 'Structure model' '_database_2.pdbx_DOI'                
4  3 'Structure model' '_database_2.pdbx_database_accession' 
5  3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  3 'Structure model' '_struct_ref_seq_dif.details'         
7  3 'Structure model' '_struct_site.pdbx_auth_asym_id'      
8  3 'Structure model' '_struct_site.pdbx_auth_comp_id'      
9  3 'Structure model' '_struct_site.pdbx_auth_seq_id'       
10 5 'Structure model' '_chem_comp_atom.atom_id'             
11 5 'Structure model' '_chem_comp_bond.atom_id_2'           
# 
_pdbx_database_status.entry_id                        3ROG 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-25 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O8N Apo-protein unspecified 
PDB 2DG2 Apo-protein unspecified 
PDB 3RNO .           unspecified 
PDB 3RO7 .           unspecified 
PDB 3ROE .           unspecified 
PDB 3ROX .           unspecified 
PDB 3ROZ .           unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shumilin, I.A.'  1 ?                   
'Jha, K.N.'       2 ?                   
'Cymborowski, M.' 3 ?                   
'Herr, J.C.'      4 ?                   
'Minor, W.'       5 0000-0001-7075-7090 
# 
_citation.id                        primary 
_citation.title                     'Identification of unknown protein function using metabolite cocktail screening.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                1715 
_citation.page_last                 1725 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22940582 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.07.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shumilin, I.A.'  1 ?                   
primary 'Cymborowski, M.' 2 ?                   
primary 'Chertihin, O.'   3 ?                   
primary 'Jha, K.N.'       4 ?                   
primary 'Herr, J.C.'      5 ?                   
primary 'Lesley, S.A.'    6 ?                   
primary 'Joachimiak, A.'  7 ?                   
primary 'Minor, W.'       8 0000-0001-7075-7090 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Apolipoprotein A-I-binding protein' 29872.963 1  ? ? ? ? 
2 non-polymer syn "THYMIDINE-3'-PHOSPHATE"             322.208   1  ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                        96.063    1  ? ? ? ? 
4 water       nat water                                18.015    59 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AI-BP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)QQSVCRARPIWWGTQRRGSET(MSE)AGAAVKYLSQEEAQAVDQELFNEYQFSVDQL(MSE)ELAGLSCATAIAK
AYPPTS(MSE)SKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQK(MSE)DIPFLGE
(MSE)PPEP(MSE)(MSE)VDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPD
LLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MQQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPP
TVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFG
FSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEK
KYQLNLPSYPDTECVYRLQHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "THYMIDINE-3'-PHOSPHATE" T3P 
3 'SULFATE ION'            SO4 
4 water                    HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   GLN n 
1 3   GLN n 
1 4   SER n 
1 5   VAL n 
1 6   CYS n 
1 7   ARG n 
1 8   ALA n 
1 9   ARG n 
1 10  PRO n 
1 11  ILE n 
1 12  TRP n 
1 13  TRP n 
1 14  GLY n 
1 15  THR n 
1 16  GLN n 
1 17  ARG n 
1 18  ARG n 
1 19  GLY n 
1 20  SER n 
1 21  GLU n 
1 22  THR n 
1 23  MSE n 
1 24  ALA n 
1 25  GLY n 
1 26  ALA n 
1 27  ALA n 
1 28  VAL n 
1 29  LYS n 
1 30  TYR n 
1 31  LEU n 
1 32  SER n 
1 33  GLN n 
1 34  GLU n 
1 35  GLU n 
1 36  ALA n 
1 37  GLN n 
1 38  ALA n 
1 39  VAL n 
1 40  ASP n 
1 41  GLN n 
1 42  GLU n 
1 43  LEU n 
1 44  PHE n 
1 45  ASN n 
1 46  GLU n 
1 47  TYR n 
1 48  GLN n 
1 49  PHE n 
1 50  SER n 
1 51  VAL n 
1 52  ASP n 
1 53  GLN n 
1 54  LEU n 
1 55  MSE n 
1 56  GLU n 
1 57  LEU n 
1 58  ALA n 
1 59  GLY n 
1 60  LEU n 
1 61  SER n 
1 62  CYS n 
1 63  ALA n 
1 64  THR n 
1 65  ALA n 
1 66  ILE n 
1 67  ALA n 
1 68  LYS n 
1 69  ALA n 
1 70  TYR n 
1 71  PRO n 
1 72  PRO n 
1 73  THR n 
1 74  SER n 
1 75  MSE n 
1 76  SER n 
1 77  LYS n 
1 78  SER n 
1 79  PRO n 
1 80  PRO n 
1 81  THR n 
1 82  VAL n 
1 83  LEU n 
1 84  VAL n 
1 85  ILE n 
1 86  CYS n 
1 87  GLY n 
1 88  PRO n 
1 89  GLY n 
1 90  ASN n 
1 91  ASN n 
1 92  GLY n 
1 93  GLY n 
1 94  ASP n 
1 95  GLY n 
1 96  LEU n 
1 97  VAL n 
1 98  CYS n 
1 99  ALA n 
1 100 ARG n 
1 101 HIS n 
1 102 LEU n 
1 103 LYS n 
1 104 LEU n 
1 105 PHE n 
1 106 GLY n 
1 107 TYR n 
1 108 GLN n 
1 109 PRO n 
1 110 THR n 
1 111 ILE n 
1 112 TYR n 
1 113 TYR n 
1 114 PRO n 
1 115 LYS n 
1 116 ARG n 
1 117 PRO n 
1 118 ASN n 
1 119 LYS n 
1 120 PRO n 
1 121 LEU n 
1 122 PHE n 
1 123 THR n 
1 124 GLY n 
1 125 LEU n 
1 126 VAL n 
1 127 THR n 
1 128 GLN n 
1 129 CYS n 
1 130 GLN n 
1 131 LYS n 
1 132 MSE n 
1 133 ASP n 
1 134 ILE n 
1 135 PRO n 
1 136 PHE n 
1 137 LEU n 
1 138 GLY n 
1 139 GLU n 
1 140 MSE n 
1 141 PRO n 
1 142 PRO n 
1 143 GLU n 
1 144 PRO n 
1 145 MSE n 
1 146 MSE n 
1 147 VAL n 
1 148 ASP n 
1 149 GLU n 
1 150 LEU n 
1 151 TYR n 
1 152 GLU n 
1 153 LEU n 
1 154 VAL n 
1 155 VAL n 
1 156 ASP n 
1 157 ALA n 
1 158 ILE n 
1 159 PHE n 
1 160 GLY n 
1 161 PHE n 
1 162 SER n 
1 163 PHE n 
1 164 LYS n 
1 165 GLY n 
1 166 ASP n 
1 167 VAL n 
1 168 ARG n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 HIS n 
1 173 SER n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 VAL n 
1 178 LEU n 
1 179 SER n 
1 180 GLY n 
1 181 LEU n 
1 182 THR n 
1 183 VAL n 
1 184 PRO n 
1 185 ILE n 
1 186 ALA n 
1 187 SER n 
1 188 ILE n 
1 189 ASP n 
1 190 ILE n 
1 191 PRO n 
1 192 SER n 
1 193 GLY n 
1 194 TRP n 
1 195 ASP n 
1 196 VAL n 
1 197 GLU n 
1 198 LYS n 
1 199 GLY n 
1 200 ASN n 
1 201 PRO n 
1 202 SER n 
1 203 GLY n 
1 204 ILE n 
1 205 GLN n 
1 206 PRO n 
1 207 ASP n 
1 208 LEU n 
1 209 LEU n 
1 210 ILE n 
1 211 SER n 
1 212 LEU n 
1 213 THR n 
1 214 ALA n 
1 215 PRO n 
1 216 LYS n 
1 217 LYS n 
1 218 SER n 
1 219 ALA n 
1 220 THR n 
1 221 HIS n 
1 222 PHE n 
1 223 THR n 
1 224 GLY n 
1 225 ARG n 
1 226 TYR n 
1 227 HIS n 
1 228 TYR n 
1 229 LEU n 
1 230 GLY n 
1 231 GLY n 
1 232 ARG n 
1 233 PHE n 
1 234 VAL n 
1 235 PRO n 
1 236 PRO n 
1 237 ALA n 
1 238 LEU n 
1 239 GLU n 
1 240 LYS n 
1 241 LYS n 
1 242 TYR n 
1 243 GLN n 
1 244 LEU n 
1 245 ASN n 
1 246 LEU n 
1 247 PRO n 
1 248 SER n 
1 249 TYR n 
1 250 PRO n 
1 251 ASP n 
1 252 THR n 
1 253 GLU n 
1 254 CYS n 
1 255 VAL n 
1 256 TYR n 
1 257 ARG n 
1 258 LEU n 
1 259 GLN n 
1 260 HIS n 
1 261 HIS n 
1 262 HIS n 
1 263 HIS n 
1 264 HIS n 
1 265 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Aibp, Apoa1bp' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                                       'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                 ?                                       'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                                       'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                                       'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                                       'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                                       'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                                       'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                  ?                                       'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                                       'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                    ?                                       'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                                       'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                                       'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                   ?                                       'C6 H15 N2 O2 1'  147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE         ?                                       'C5 H11 N O2 Se'  196.106 
PHE 'L-peptide linking' y PHENYLALANINE            ?                                       'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                  ?                                       'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                   ?                                       'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'            ?                                       'O4 S -2'         96.063  
T3P 'DNA linking'       n "THYMIDINE-3'-PHOSPHATE" 
;ALPHA-ANOMERIC THYMIDINE-3'-PHOSPHATE
;
'C10 H15 N2 O8 P' 322.208 
THR 'L-peptide linking' y THREONINE                ?                                       'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                                       'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                                       'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                   ?                                       'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   0   ?   ?   ?   A . n 
A 1 2   GLN 2   1   ?   ?   ?   A . n 
A 1 3   GLN 3   2   ?   ?   ?   A . n 
A 1 4   SER 4   3   ?   ?   ?   A . n 
A 1 5   VAL 5   4   ?   ?   ?   A . n 
A 1 6   CYS 6   5   ?   ?   ?   A . n 
A 1 7   ARG 7   6   ?   ?   ?   A . n 
A 1 8   ALA 8   7   ?   ?   ?   A . n 
A 1 9   ARG 9   8   ?   ?   ?   A . n 
A 1 10  PRO 10  9   ?   ?   ?   A . n 
A 1 11  ILE 11  10  ?   ?   ?   A . n 
A 1 12  TRP 12  11  ?   ?   ?   A . n 
A 1 13  TRP 13  12  ?   ?   ?   A . n 
A 1 14  GLY 14  13  ?   ?   ?   A . n 
A 1 15  THR 15  14  ?   ?   ?   A . n 
A 1 16  GLN 16  15  ?   ?   ?   A . n 
A 1 17  ARG 17  16  ?   ?   ?   A . n 
A 1 18  ARG 18  17  ?   ?   ?   A . n 
A 1 19  GLY 19  18  ?   ?   ?   A . n 
A 1 20  SER 20  19  ?   ?   ?   A . n 
A 1 21  GLU 21  20  ?   ?   ?   A . n 
A 1 22  THR 22  21  ?   ?   ?   A . n 
A 1 23  MSE 23  22  ?   ?   ?   A . n 
A 1 24  ALA 24  23  ?   ?   ?   A . n 
A 1 25  GLY 25  24  ?   ?   ?   A . n 
A 1 26  ALA 26  25  ?   ?   ?   A . n 
A 1 27  ALA 27  26  26  ALA ALA A . n 
A 1 28  VAL 28  27  27  VAL VAL A . n 
A 1 29  LYS 29  28  28  LYS LYS A . n 
A 1 30  TYR 30  29  29  TYR TYR A . n 
A 1 31  LEU 31  30  30  LEU LEU A . n 
A 1 32  SER 32  31  31  SER SER A . n 
A 1 33  GLN 33  32  32  GLN GLN A . n 
A 1 34  GLU 34  33  33  GLU GLU A . n 
A 1 35  GLU 35  34  34  GLU GLU A . n 
A 1 36  ALA 36  35  35  ALA ALA A . n 
A 1 37  GLN 37  36  36  GLN GLN A . n 
A 1 38  ALA 38  37  37  ALA ALA A . n 
A 1 39  VAL 39  38  38  VAL VAL A . n 
A 1 40  ASP 40  39  39  ASP ASP A . n 
A 1 41  GLN 41  40  40  GLN GLN A . n 
A 1 42  GLU 42  41  41  GLU GLU A . n 
A 1 43  LEU 43  42  42  LEU LEU A . n 
A 1 44  PHE 44  43  43  PHE PHE A . n 
A 1 45  ASN 45  44  44  ASN ASN A . n 
A 1 46  GLU 46  45  45  GLU GLU A . n 
A 1 47  TYR 47  46  46  TYR TYR A . n 
A 1 48  GLN 48  47  47  GLN GLN A . n 
A 1 49  PHE 49  48  48  PHE PHE A . n 
A 1 50  SER 50  49  49  SER SER A . n 
A 1 51  VAL 51  50  50  VAL VAL A . n 
A 1 52  ASP 52  51  51  ASP ASP A . n 
A 1 53  GLN 53  52  52  GLN GLN A . n 
A 1 54  LEU 54  53  53  LEU LEU A . n 
A 1 55  MSE 55  54  54  MSE MSE A . n 
A 1 56  GLU 56  55  55  GLU GLU A . n 
A 1 57  LEU 57  56  56  LEU LEU A . n 
A 1 58  ALA 58  57  57  ALA ALA A . n 
A 1 59  GLY 59  58  58  GLY GLY A . n 
A 1 60  LEU 60  59  59  LEU LEU A . n 
A 1 61  SER 61  60  60  SER SER A . n 
A 1 62  CYS 62  61  61  CYS CYS A . n 
A 1 63  ALA 63  62  62  ALA ALA A . n 
A 1 64  THR 64  63  63  THR THR A . n 
A 1 65  ALA 65  64  64  ALA ALA A . n 
A 1 66  ILE 66  65  65  ILE ILE A . n 
A 1 67  ALA 67  66  66  ALA ALA A . n 
A 1 68  LYS 68  67  67  LYS LYS A . n 
A 1 69  ALA 69  68  68  ALA ALA A . n 
A 1 70  TYR 70  69  69  TYR TYR A . n 
A 1 71  PRO 71  70  70  PRO PRO A . n 
A 1 72  PRO 72  71  71  PRO PRO A . n 
A 1 73  THR 73  72  72  THR THR A . n 
A 1 74  SER 74  73  73  SER SER A . n 
A 1 75  MSE 75  74  74  MSE MSE A . n 
A 1 76  SER 76  75  75  SER SER A . n 
A 1 77  LYS 77  76  76  LYS LYS A . n 
A 1 78  SER 78  77  77  SER SER A . n 
A 1 79  PRO 79  78  78  PRO PRO A . n 
A 1 80  PRO 80  79  79  PRO PRO A . n 
A 1 81  THR 81  80  80  THR THR A . n 
A 1 82  VAL 82  81  81  VAL VAL A . n 
A 1 83  LEU 83  82  82  LEU LEU A . n 
A 1 84  VAL 84  83  83  VAL VAL A . n 
A 1 85  ILE 85  84  84  ILE ILE A . n 
A 1 86  CYS 86  85  85  CYS CYS A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  PRO 88  87  87  PRO PRO A . n 
A 1 89  GLY 89  88  88  GLY GLY A . n 
A 1 90  ASN 90  89  89  ASN ASN A . n 
A 1 91  ASN 91  90  90  ASN ASN A . n 
A 1 92  GLY 92  91  91  GLY GLY A . n 
A 1 93  GLY 93  92  92  GLY GLY A . n 
A 1 94  ASP 94  93  93  ASP ASP A . n 
A 1 95  GLY 95  94  94  GLY GLY A . n 
A 1 96  LEU 96  95  95  LEU LEU A . n 
A 1 97  VAL 97  96  96  VAL VAL A . n 
A 1 98  CYS 98  97  97  CYS CYS A . n 
A 1 99  ALA 99  98  98  ALA ALA A . n 
A 1 100 ARG 100 99  99  ARG ARG A . n 
A 1 101 HIS 101 100 100 HIS HIS A . n 
A 1 102 LEU 102 101 101 LEU LEU A . n 
A 1 103 LYS 103 102 102 LYS LYS A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 PHE 105 104 104 PHE PHE A . n 
A 1 106 GLY 106 105 105 GLY GLY A . n 
A 1 107 TYR 107 106 106 TYR TYR A . n 
A 1 108 GLN 108 107 107 GLN GLN A . n 
A 1 109 PRO 109 108 108 PRO PRO A . n 
A 1 110 THR 110 109 109 THR THR A . n 
A 1 111 ILE 111 110 110 ILE ILE A . n 
A 1 112 TYR 112 111 111 TYR TYR A . n 
A 1 113 TYR 113 112 112 TYR TYR A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 LYS 115 114 114 LYS LYS A . n 
A 1 116 ARG 116 115 115 ARG ARG A . n 
A 1 117 PRO 117 116 116 PRO PRO A . n 
A 1 118 ASN 118 117 117 ASN ASN A . n 
A 1 119 LYS 119 118 118 LYS LYS A . n 
A 1 120 PRO 120 119 119 PRO PRO A . n 
A 1 121 LEU 121 120 120 LEU LEU A . n 
A 1 122 PHE 122 121 121 PHE PHE A . n 
A 1 123 THR 123 122 122 THR THR A . n 
A 1 124 GLY 124 123 123 GLY GLY A . n 
A 1 125 LEU 125 124 124 LEU LEU A . n 
A 1 126 VAL 126 125 125 VAL VAL A . n 
A 1 127 THR 127 126 126 THR THR A . n 
A 1 128 GLN 128 127 127 GLN GLN A . n 
A 1 129 CYS 129 128 128 CYS CYS A . n 
A 1 130 GLN 130 129 129 GLN GLN A . n 
A 1 131 LYS 131 130 130 LYS LYS A . n 
A 1 132 MSE 132 131 131 MSE MSE A . n 
A 1 133 ASP 133 132 132 ASP ASP A . n 
A 1 134 ILE 134 133 133 ILE ILE A . n 
A 1 135 PRO 135 134 134 PRO PRO A . n 
A 1 136 PHE 136 135 135 PHE PHE A . n 
A 1 137 LEU 137 136 136 LEU LEU A . n 
A 1 138 GLY 138 137 137 GLY GLY A . n 
A 1 139 GLU 139 138 138 GLU GLU A . n 
A 1 140 MSE 140 139 139 MSE MSE A . n 
A 1 141 PRO 141 140 140 PRO PRO A . n 
A 1 142 PRO 142 141 141 PRO PRO A . n 
A 1 143 GLU 143 142 142 GLU GLU A . n 
A 1 144 PRO 144 143 143 PRO PRO A . n 
A 1 145 MSE 145 144 144 MSE MSE A . n 
A 1 146 MSE 146 145 145 MSE MSE A . n 
A 1 147 VAL 147 146 146 VAL VAL A . n 
A 1 148 ASP 148 147 147 ASP ASP A . n 
A 1 149 GLU 149 148 148 GLU GLU A . n 
A 1 150 LEU 150 149 149 LEU LEU A . n 
A 1 151 TYR 151 150 150 TYR TYR A . n 
A 1 152 GLU 152 151 151 GLU GLU A . n 
A 1 153 LEU 153 152 152 LEU LEU A . n 
A 1 154 VAL 154 153 153 VAL VAL A . n 
A 1 155 VAL 155 154 154 VAL VAL A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 ALA 157 156 156 ALA ALA A . n 
A 1 158 ILE 158 157 157 ILE ILE A . n 
A 1 159 PHE 159 158 158 PHE PHE A . n 
A 1 160 GLY 160 159 159 GLY GLY A . n 
A 1 161 PHE 161 160 160 PHE PHE A . n 
A 1 162 SER 162 161 161 SER SER A . n 
A 1 163 PHE 163 162 162 PHE PHE A . n 
A 1 164 LYS 164 163 163 LYS LYS A . n 
A 1 165 GLY 165 164 164 GLY GLY A . n 
A 1 166 ASP 166 165 165 ASP ASP A . n 
A 1 167 VAL 167 166 166 VAL VAL A . n 
A 1 168 ARG 168 167 167 ARG ARG A . n 
A 1 169 GLU 169 168 168 GLU GLU A . n 
A 1 170 PRO 170 169 169 PRO PRO A . n 
A 1 171 PHE 171 170 170 PHE PHE A . n 
A 1 172 HIS 172 171 171 HIS HIS A . n 
A 1 173 SER 173 172 172 SER SER A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 SER 176 175 175 SER SER A . n 
A 1 177 VAL 177 176 176 VAL VAL A . n 
A 1 178 LEU 178 177 177 LEU LEU A . n 
A 1 179 SER 179 178 178 SER SER A . n 
A 1 180 GLY 180 179 179 GLY GLY A . n 
A 1 181 LEU 181 180 180 LEU LEU A . n 
A 1 182 THR 182 181 181 THR THR A . n 
A 1 183 VAL 183 182 182 VAL VAL A . n 
A 1 184 PRO 184 183 183 PRO PRO A . n 
A 1 185 ILE 185 184 184 ILE ILE A . n 
A 1 186 ALA 186 185 185 ALA ALA A . n 
A 1 187 SER 187 186 186 SER SER A . n 
A 1 188 ILE 188 187 187 ILE ILE A . n 
A 1 189 ASP 189 188 188 ASP ASP A . n 
A 1 190 ILE 190 189 189 ILE ILE A . n 
A 1 191 PRO 191 190 190 PRO PRO A . n 
A 1 192 SER 192 191 191 SER SER A . n 
A 1 193 GLY 193 192 192 GLY GLY A . n 
A 1 194 TRP 194 193 193 TRP TRP A . n 
A 1 195 ASP 195 194 194 ASP ASP A . n 
A 1 196 VAL 196 195 195 VAL VAL A . n 
A 1 197 GLU 197 196 196 GLU GLU A . n 
A 1 198 LYS 198 197 197 LYS LYS A . n 
A 1 199 GLY 199 198 198 GLY GLY A . n 
A 1 200 ASN 200 199 199 ASN ASN A . n 
A 1 201 PRO 201 200 200 PRO PRO A . n 
A 1 202 SER 202 201 201 SER SER A . n 
A 1 203 GLY 203 202 202 GLY GLY A . n 
A 1 204 ILE 204 203 203 ILE ILE A . n 
A 1 205 GLN 205 204 204 GLN GLN A . n 
A 1 206 PRO 206 205 205 PRO PRO A . n 
A 1 207 ASP 207 206 206 ASP ASP A . n 
A 1 208 LEU 208 207 207 LEU LEU A . n 
A 1 209 LEU 209 208 208 LEU LEU A . n 
A 1 210 ILE 210 209 209 ILE ILE A . n 
A 1 211 SER 211 210 210 SER SER A . n 
A 1 212 LEU 212 211 211 LEU LEU A . n 
A 1 213 THR 213 212 212 THR THR A . n 
A 1 214 ALA 214 213 213 ALA ALA A . n 
A 1 215 PRO 215 214 214 PRO PRO A . n 
A 1 216 LYS 216 215 215 LYS LYS A . n 
A 1 217 LYS 217 216 216 LYS LYS A . n 
A 1 218 SER 218 217 217 SER SER A . n 
A 1 219 ALA 219 218 218 ALA ALA A . n 
A 1 220 THR 220 219 219 THR THR A . n 
A 1 221 HIS 221 220 220 HIS HIS A . n 
A 1 222 PHE 222 221 221 PHE PHE A . n 
A 1 223 THR 223 222 222 THR THR A . n 
A 1 224 GLY 224 223 223 GLY GLY A . n 
A 1 225 ARG 225 224 224 ARG ARG A . n 
A 1 226 TYR 226 225 225 TYR TYR A . n 
A 1 227 HIS 227 226 226 HIS HIS A . n 
A 1 228 TYR 228 227 227 TYR TYR A . n 
A 1 229 LEU 229 228 228 LEU LEU A . n 
A 1 230 GLY 230 229 229 GLY GLY A . n 
A 1 231 GLY 231 230 230 GLY GLY A . n 
A 1 232 ARG 232 231 231 ARG ARG A . n 
A 1 233 PHE 233 232 232 PHE PHE A . n 
A 1 234 VAL 234 233 233 VAL VAL A . n 
A 1 235 PRO 235 234 234 PRO PRO A . n 
A 1 236 PRO 236 235 235 PRO PRO A . n 
A 1 237 ALA 237 236 236 ALA ALA A . n 
A 1 238 LEU 238 237 237 LEU LEU A . n 
A 1 239 GLU 239 238 238 GLU GLU A . n 
A 1 240 LYS 240 239 239 LYS LYS A . n 
A 1 241 LYS 241 240 240 LYS LYS A . n 
A 1 242 TYR 242 241 241 TYR TYR A . n 
A 1 243 GLN 243 242 242 GLN GLN A . n 
A 1 244 LEU 244 243 243 LEU LEU A . n 
A 1 245 ASN 245 244 244 ASN ASN A . n 
A 1 246 LEU 246 245 245 LEU LEU A . n 
A 1 247 PRO 247 246 246 PRO PRO A . n 
A 1 248 SER 248 247 247 SER SER A . n 
A 1 249 TYR 249 248 248 TYR TYR A . n 
A 1 250 PRO 250 249 249 PRO PRO A . n 
A 1 251 ASP 251 250 250 ASP ASP A . n 
A 1 252 THR 252 251 251 THR THR A . n 
A 1 253 GLU 253 252 252 GLU GLU A . n 
A 1 254 CYS 254 253 253 CYS CYS A . n 
A 1 255 VAL 255 254 254 VAL VAL A . n 
A 1 256 TYR 256 255 255 TYR TYR A . n 
A 1 257 ARG 257 256 256 ARG ARG A . n 
A 1 258 LEU 258 257 257 LEU LEU A . n 
A 1 259 GLN 259 258 258 GLN GLN A . n 
A 1 260 HIS 260 259 ?   ?   ?   A . n 
A 1 261 HIS 261 260 ?   ?   ?   A . n 
A 1 262 HIS 262 261 ?   ?   ?   A . n 
A 1 263 HIS 263 262 ?   ?   ?   A . n 
A 1 264 HIS 264 263 ?   ?   ?   A . n 
A 1 265 HIS 265 264 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 T3P 1  265 1  T3P T3P A . 
C 3 SO4 1  266 2  SO4 SO4 A . 
D 4 HOH 1  267 1  HOH HOH A . 
D 4 HOH 2  268 2  HOH HOH A . 
D 4 HOH 3  269 3  HOH HOH A . 
D 4 HOH 4  270 4  HOH HOH A . 
D 4 HOH 5  271 5  HOH HOH A . 
D 4 HOH 6  272 6  HOH HOH A . 
D 4 HOH 7  273 7  HOH HOH A . 
D 4 HOH 8  274 8  HOH HOH A . 
D 4 HOH 9  275 9  HOH HOH A . 
D 4 HOH 10 276 10 HOH HOH A . 
D 4 HOH 11 277 11 HOH HOH A . 
D 4 HOH 12 278 12 HOH HOH A . 
D 4 HOH 13 279 13 HOH HOH A . 
D 4 HOH 14 280 14 HOH HOH A . 
D 4 HOH 15 281 15 HOH HOH A . 
D 4 HOH 16 282 16 HOH HOH A . 
D 4 HOH 17 283 17 HOH HOH A . 
D 4 HOH 18 284 18 HOH HOH A . 
D 4 HOH 19 285 19 HOH HOH A . 
D 4 HOH 20 286 20 HOH HOH A . 
D 4 HOH 21 287 21 HOH HOH A . 
D 4 HOH 22 288 22 HOH HOH A . 
D 4 HOH 23 289 23 HOH HOH A . 
D 4 HOH 24 290 24 HOH HOH A . 
D 4 HOH 25 291 25 HOH HOH A . 
D 4 HOH 26 292 26 HOH HOH A . 
D 4 HOH 27 293 27 HOH HOH A . 
D 4 HOH 28 294 28 HOH HOH A . 
D 4 HOH 29 295 29 HOH HOH A . 
D 4 HOH 30 296 30 HOH HOH A . 
D 4 HOH 31 297 31 HOH HOH A . 
D 4 HOH 32 298 32 HOH HOH A . 
D 4 HOH 33 299 33 HOH HOH A . 
D 4 HOH 34 300 34 HOH HOH A . 
D 4 HOH 35 301 35 HOH HOH A . 
D 4 HOH 36 302 36 HOH HOH A . 
D 4 HOH 37 303 37 HOH HOH A . 
D 4 HOH 38 304 38 HOH HOH A . 
D 4 HOH 39 305 39 HOH HOH A . 
D 4 HOH 40 306 40 HOH HOH A . 
D 4 HOH 41 307 41 HOH HOH A . 
D 4 HOH 42 308 42 HOH HOH A . 
D 4 HOH 43 309 43 HOH HOH A . 
D 4 HOH 44 310 44 HOH HOH A . 
D 4 HOH 45 311 45 HOH HOH A . 
D 4 HOH 46 312 46 HOH HOH A . 
D 4 HOH 47 313 47 HOH HOH A . 
D 4 HOH 48 314 48 HOH HOH A . 
D 4 HOH 49 315 49 HOH HOH A . 
D 4 HOH 50 316 50 HOH HOH A . 
D 4 HOH 51 317 51 HOH HOH A . 
D 4 HOH 52 318 52 HOH HOH A . 
D 4 HOH 53 319 53 HOH HOH A . 
D 4 HOH 54 320 54 HOH HOH A . 
D 4 HOH 55 321 55 HOH HOH A . 
D 4 HOH 56 322 56 HOH HOH A . 
D 4 HOH 57 323 57 HOH HOH A . 
D 4 HOH 58 324 58 HOH HOH A . 
D 4 HOH 59 325 59 HOH HOH A . 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 2 
HKL-3000    .        ?               ?       ?                    ?                     'data collection' ? ?          ? 3 
HKL-3000    .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 4 
HKL-3000    .        ?               ?       ?                    ?                     'data scaling'    ? ?          ? 5 
HKL-3000    MOLREP   ?               ?       ?                    ?                     phasing           ? ?          ? 6 
# 
_cell.entry_id           3ROG 
_cell.length_a           126.094 
_cell.length_b           126.094 
_cell.length_c           110.962 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              18 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3ROG 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                155 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3ROG 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.84 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'0.1 M SODIUM ACETATE, 1.5 M AMMONIUM SULFATE, PH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   SBC-3 
_diffrn_detector.details                MIRRORS 
_diffrn_detector.pdbx_collection_date   2008-06-23 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.04399 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.04399 
# 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   119546 
_reflns.number_all                   119546 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              0.061 
_reflns.pdbx_netI_over_sigmaI        38.741 
_reflns.pdbx_redundancy              5.6 
_reflns.entry_id                     3ROG 
_reflns.B_iso_Wilson_estimate        35.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.09 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.361 
_reflns_shell.pdbx_Rsym_value        0.361 
_reflns_shell.meanI_over_sigI_obs    3.203 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3ROG 
_refine.ls_d_res_high                            2.050 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.300 
_refine.ls_number_reflns_obs                     21270 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS; U VALUES: RESIDUAL ONLY' 
_refine.ls_R_factor_obs                          0.180 
_refine.ls_R_factor_R_work                       0.179 
_refine.ls_R_factor_R_free                       0.201 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1089 
_refine.B_iso_mean                               55.107 
_refine.aniso_B[1][1]                            -4.540 
_refine.aniso_B[2][2]                            -4.540 
_refine.aniso_B[3][3]                            6.810 
_refine.aniso_B[1][2]                            -2.270 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.969 
_refine.correlation_coeff_Fo_to_Fc_free          0.961 
_refine.pdbx_overall_ESU_R_Free                  0.129 
_refine.overall_SU_ML                            0.112 
_refine.overall_SU_B                             8.857 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                120.52 
_refine.B_iso_min                                34.24 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2O8N' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1808 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         26 
_refine_hist.number_atoms_solvent             59 
_refine_hist.number_atoms_total               1893 
_refine_hist.d_res_high                       2.050 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       1885 0.021  0.022  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         1281 0.000  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2571 1.752  2.010  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      3152 4.042  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 232  6.372  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 75   41.640 24.667 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 301  15.567 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 6    17.589 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         281  0.110  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   2058 0.009  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     351  0.010  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1169 0.971  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         460  0.000  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1900 1.658  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            716  2.885  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           671  4.238  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.050 
_refine_ls_shell.d_res_low                        2.103 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               95.060 
_refine_ls_shell.number_reflns_R_work             1432 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.281 
_refine_ls_shell.R_factor_R_free                  0.244 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             70 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1502 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3ROG 
_struct.title                     
;Crystal Structure of Mouse Apolipoprotein A-I Binding Protein in Complex with Thymidine 3'-monophosphate
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ROG 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'ROSSMANN FOLD, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AIBP_MOUSE 
_struct_ref.pdbx_db_accession          Q8K4Z3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPT
VLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGF
SFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKK
YQLNLPSYPDTECVYRLQ
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3ROG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 259 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8K4Z3 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  282 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       258 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ROG MSE A 1   ? UNP Q8K4Z3 ? ? 'expression tag' 0   1 
1 3ROG HIS A 260 ? UNP Q8K4Z3 ? ? 'expression tag' 259 2 
1 3ROG HIS A 261 ? UNP Q8K4Z3 ? ? 'expression tag' 260 3 
1 3ROG HIS A 262 ? UNP Q8K4Z3 ? ? 'expression tag' 261 4 
1 3ROG HIS A 263 ? UNP Q8K4Z3 ? ? 'expression tag' 262 5 
1 3ROG HIS A 264 ? UNP Q8K4Z3 ? ? 'expression tag' 263 6 
1 3ROG HIS A 265 ? UNP Q8K4Z3 ? ? 'expression tag' 264 7 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly            PISA dimeric   2 
2 author_and_software_defined_assembly PISA dimeric   2 
3 software_defined_assembly            PISA hexameric 6 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2730  ? 
1 MORE         -18   ? 
1 'SSA (A^2)'  18620 ? 
2 'ABSA (A^2)' 1630  ? 
2 MORE         -7    ? 
2 'SSA (A^2)'  19720 ? 
3 'ABSA (A^2)' 9380  ? 
3 MORE         -41   ? 
3 'SSA (A^2)'  54660 ? 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2         A,B,C,D 
2 1,3         A,B,C,D 
3 1,4,5,3,6,7 A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z                  1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 12_555 -x+2/3,-x+y+1/3,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 63.0470000000 -0.8660254038 
0.5000000000  0.0000000000 36.4002024216 0.0000000000 0.0000000000 -1.0000000000 36.9873333333 
3 'crystal symmetry operation' 4_555  y,x,-z                 -0.5000000000 0.8660254038  0.0000000000 0.0000000000  0.8660254038  
0.5000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
4 'crystal symmetry operation' 2_555  -y,x-y,z               -0.5000000000 -0.8660254038 0.0000000000 0.0000000000  0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
5 'crystal symmetry operation' 3_555  -x+y,-x,z              -0.5000000000 0.8660254038  0.0000000000 0.0000000000  -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
6 'crystal symmetry operation' 5_555  x-y,-y,-z              1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
-1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
7 'crystal symmetry operation' 6_555  -x,-x+y,-z             -0.5000000000 -0.8660254038 0.0000000000 0.0000000000  -0.8660254038 
0.5000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 32  ? GLU A 46  ? SER A 31  GLU A 45  1 ? 15 
HELX_P HELX_P2 2 SER A 50  ? TYR A 70  ? SER A 49  TYR A 69  1 ? 21 
HELX_P HELX_P3 3 PRO A 71  ? MSE A 75  ? PRO A 70  MSE A 74  5 ? 5  
HELX_P HELX_P4 4 GLY A 89  ? PHE A 105 ? GLY A 88  PHE A 104 1 ? 17 
HELX_P HELX_P5 5 LYS A 119 ? MSE A 132 ? LYS A 118 MSE A 131 1 ? 14 
HELX_P HELX_P6 6 GLU A 143 ? TYR A 151 ? GLU A 142 TYR A 150 1 ? 9  
HELX_P HELX_P7 7 PRO A 170 ? GLY A 180 ? PRO A 169 GLY A 179 1 ? 11 
HELX_P HELX_P8 8 LYS A 216 ? PHE A 222 ? LYS A 215 PHE A 221 5 ? 7  
HELX_P HELX_P9 9 PRO A 235 ? TYR A 242 ? PRO A 234 TYR A 241 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A LEU 54  C ? ? ? 1_555 A MSE 55  N ? ? A LEU 53  A MSE 54  1_555 ? ? ? ? ? ? ? 1.312 ? ? 
covale2  covale both ? A MSE 55  C ? ? ? 1_555 A GLU 56  N ? ? A MSE 54  A GLU 55  1_555 ? ? ? ? ? ? ? 1.324 ? ? 
covale3  covale both ? A SER 74  C ? ? ? 1_555 A MSE 75  N ? ? A SER 73  A MSE 74  1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale4  covale both ? A MSE 75  C ? ? ? 1_555 A SER 76  N ? ? A MSE 74  A SER 75  1_555 ? ? ? ? ? ? ? 1.322 ? ? 
covale5  covale both ? A LYS 131 C ? ? ? 1_555 A MSE 132 N ? ? A LYS 130 A MSE 131 1_555 ? ? ? ? ? ? ? 1.318 ? ? 
covale6  covale both ? A MSE 132 C ? ? ? 1_555 A ASP 133 N ? ? A MSE 131 A ASP 132 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale7  covale both ? A GLU 139 C ? ? ? 1_555 A MSE 140 N ? ? A GLU 138 A MSE 139 1_555 ? ? ? ? ? ? ? 1.317 ? ? 
covale8  covale both ? A MSE 140 C ? ? ? 1_555 A PRO 141 N ? ? A MSE 139 A PRO 140 1_555 ? ? ? ? ? ? ? 1.355 ? ? 
covale9  covale both ? A PRO 144 C ? ? ? 1_555 A MSE 145 N ? ? A PRO 143 A MSE 144 1_555 ? ? ? ? ? ? ? 1.310 ? ? 
covale10 covale both ? A MSE 145 C ? ? ? 1_555 A MSE 146 N ? ? A MSE 144 A MSE 145 1_555 ? ? ? ? ? ? ? 1.314 ? ? 
covale11 covale both ? A MSE 146 C ? ? ? 1_555 A VAL 147 N ? ? A MSE 145 A VAL 146 1_555 ? ? ? ? ? ? ? 1.318 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 MSE A 55  ? . . . . MSE A 54  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
2 MSE A 75  ? . . . . MSE A 74  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
3 MSE A 132 ? . . . . MSE A 131 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
4 MSE A 140 ? . . . . MSE A 139 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
5 MSE A 145 ? . . . . MSE A 144 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
6 MSE A 146 ? . . . . MSE A 145 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 78  A . ? SER 77  A PRO 79  A ? PRO 78  A 1 1.15  
2 GLY 165 A . ? GLY 164 A ASP 166 A ? ASP 165 A 1 8.48  
3 GLU 169 A . ? GLU 168 A PRO 170 A ? PRO 169 A 1 -0.82 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 108 ? TYR A 112 ? GLN A 107 TYR A 111 
A 2 THR A 81  ? CYS A 86  ? THR A 80  CYS A 85  
A 3 LEU A 153 ? ALA A 157 ? LEU A 152 ALA A 156 
A 4 ILE A 185 ? ILE A 188 ? ILE A 184 ILE A 187 
A 5 LEU A 208 ? LEU A 212 ? LEU A 207 LEU A 211 
A 6 TYR A 226 ? GLY A 230 ? TYR A 225 GLY A 229 
A 7 TYR A 256 ? LEU A 258 ? TYR A 255 LEU A 257 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 110 ? O THR A 109 N VAL A 84  ? N VAL A 83  
A 2 3 N LEU A 83  ? N LEU A 82  O VAL A 155 ? O VAL A 154 
A 3 4 N VAL A 154 ? N VAL A 153 O ALA A 186 ? O ALA A 185 
A 4 5 N SER A 187 ? N SER A 186 O LEU A 208 ? O LEU A 207 
A 5 6 N SER A 211 ? N SER A 210 O GLY A 230 ? O GLY A 229 
A 6 7 N LEU A 229 ? N LEU A 228 O TYR A 256 ? O TYR A 255 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A T3P 265 ? 15 'BINDING SITE FOR RESIDUE T3P A 265' 
AC2 Software A SO4 266 ? 6  'BINDING SITE FOR RESIDUE SO4 A 266' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 ALA A 36  ? ALA A 35  . ? 1_555 ? 
2  AC1 15 VAL A 39  ? VAL A 38  . ? 1_555 ? 
3  AC1 15 ASP A 40  ? ASP A 39  . ? 1_555 ? 
4  AC1 15 LEU A 43  ? LEU A 42  . ? 1_555 ? 
5  AC1 15 LEU A 54  ? LEU A 53  . ? 1_555 ? 
6  AC1 15 MSE A 55  ? MSE A 54  . ? 1_555 ? 
7  AC1 15 ASN A 90  ? ASN A 89  . ? 1_555 ? 
8  AC1 15 ASP A 94  ? ASP A 93  . ? 1_555 ? 
9  AC1 15 PHE A 161 ? PHE A 160 . ? 1_555 ? 
10 AC1 15 ASP A 189 ? ASP A 188 . ? 1_555 ? 
11 AC1 15 LEU A 212 ? LEU A 211 . ? 1_555 ? 
12 AC1 15 THR A 213 ? THR A 212 . ? 1_555 ? 
13 AC1 15 LYS A 216 ? LYS A 215 . ? 1_555 ? 
14 AC1 15 PHE A 233 ? PHE A 232 . ? 1_555 ? 
15 AC1 15 HOH D .   ? HOH A 280 . ? 1_555 ? 
16 AC2 6  GLY A 89  ? GLY A 88  . ? 1_555 ? 
17 AC2 6  ASN A 90  ? ASN A 89  . ? 1_555 ? 
18 AC2 6  ASN A 91  ? ASN A 90  . ? 1_555 ? 
19 AC2 6  GLY A 160 ? GLY A 159 . ? 1_555 ? 
20 AC2 6  SER A 162 ? SER A 161 . ? 1_555 ? 
21 AC2 6  HOH D .   ? HOH A 275 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   3ROG 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 165 ? ? 70.20   68.67   
2 1 ASP A 188 ? ? 73.59   -53.50  
3 1 ASN A 199 ? ? -171.99 99.04   
4 1 THR A 212 ? ? 73.11   -59.00  
5 1 PHE A 232 ? ? -164.79 6.36    
6 1 GLN A 242 ? ? 38.41   59.61   
7 1 ASP A 250 ? ? 38.66   -114.97 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 55  A MSE 54  ? MET SELENOMETHIONINE 
2 A MSE 75  A MSE 74  ? MET SELENOMETHIONINE 
3 A MSE 132 A MSE 131 ? MET SELENOMETHIONINE 
4 A MSE 140 A MSE 139 ? MET SELENOMETHIONINE 
5 A MSE 145 A MSE 144 ? MET SELENOMETHIONINE 
6 A MSE 146 A MSE 145 ? MET SELENOMETHIONINE 
# 
_diffrn_reflns.av_R_equivalents   0.061 
_diffrn_reflns.number             119546 
_diffrn_reflns.diffrn_id          1 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 19.8250 22.2860 27.4130 0.4017 0.5537 0.1464 -0.0791 0.0069  -0.0779 2.1641  1.9069  1.2353  1.6702  0.9645  0.4211 
0.2330  -0.2597 0.0267  -0.6018 0.2473  0.1982  0.2377  0.0464  -0.2576 'X-RAY DIFFRACTION' 
2 ? refined 22.6610 3.8740  5.3750  0.3592 0.5144 0.1983 0.0048  -0.0021 -0.1288 30.7182 33.9384 23.9877 -1.1779 19.2287 5.3457 
0.7001  -0.3791 -0.3210 0.9298  -0.0043 0.1405  0.6586  0.9845  1.0527  'X-RAY DIFFRACTION' 
3 ? refined 11.1760 19.2580 11.1400 0.3631 0.3878 0.1645 -0.0254 -0.0499 -0.0090 2.8505  2.5272  1.3514  1.7470  1.0743  0.0869 
-0.0578 -0.0388 0.0966  -0.1194 0.3018  0.3292  -0.0324 -0.0684 -0.0938 'X-RAY DIFFRACTION' 
4 ? refined 16.1020 12.4170 26.7990 0.4657 0.5506 0.0712 -0.1450 -0.0348 0.0411  3.0666  1.7225  1.7743  1.5079  1.2602  1.0593 
0.4221  -0.3391 -0.0830 -0.7064 -0.1372 -0.0429 0.3636  0.2852  -0.3466 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 26  A 70  ? . . . . 'X-RAY DIFFRACTION' ? 
2 2 A 71  A 77  ? . . . . 'X-RAY DIFFRACTION' ? 
3 3 A 78  A 169 ? . . . . 'X-RAY DIFFRACTION' ? 
4 4 A 170 A 258 ? . . . . 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE 0   ? A MSE 1   
2  1 Y 1 A GLN 1   ? A GLN 2   
3  1 Y 1 A GLN 2   ? A GLN 3   
4  1 Y 1 A SER 3   ? A SER 4   
5  1 Y 1 A VAL 4   ? A VAL 5   
6  1 Y 1 A CYS 5   ? A CYS 6   
7  1 Y 1 A ARG 6   ? A ARG 7   
8  1 Y 1 A ALA 7   ? A ALA 8   
9  1 Y 1 A ARG 8   ? A ARG 9   
10 1 Y 1 A PRO 9   ? A PRO 10  
11 1 Y 1 A ILE 10  ? A ILE 11  
12 1 Y 1 A TRP 11  ? A TRP 12  
13 1 Y 1 A TRP 12  ? A TRP 13  
14 1 Y 1 A GLY 13  ? A GLY 14  
15 1 Y 1 A THR 14  ? A THR 15  
16 1 Y 1 A GLN 15  ? A GLN 16  
17 1 Y 1 A ARG 16  ? A ARG 17  
18 1 Y 1 A ARG 17  ? A ARG 18  
19 1 Y 1 A GLY 18  ? A GLY 19  
20 1 Y 1 A SER 19  ? A SER 20  
21 1 Y 1 A GLU 20  ? A GLU 21  
22 1 Y 1 A THR 21  ? A THR 22  
23 1 Y 1 A MSE 22  ? A MSE 23  
24 1 Y 1 A ALA 23  ? A ALA 24  
25 1 Y 1 A GLY 24  ? A GLY 25  
26 1 Y 1 A ALA 25  ? A ALA 26  
27 1 Y 1 A HIS 259 ? A HIS 260 
28 1 Y 1 A HIS 260 ? A HIS 261 
29 1 Y 1 A HIS 261 ? A HIS 262 
30 1 Y 1 A HIS 262 ? A HIS 263 
31 1 Y 1 A HIS 263 ? A HIS 264 
32 1 Y 1 A HIS 264 ? A HIS 265 
# 
_cell_measurement.reflns_used   119546 
_cell_measurement.entry_id      3ROG 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
CYS N      N  N N 74  
CYS CA     C  N R 75  
CYS C      C  N N 76  
CYS O      O  N N 77  
CYS CB     C  N N 78  
CYS SG     S  N N 79  
CYS OXT    O  N N 80  
CYS H      H  N N 81  
CYS H2     H  N N 82  
CYS HA     H  N N 83  
CYS HB2    H  N N 84  
CYS HB3    H  N N 85  
CYS HG     H  N N 86  
CYS HXT    H  N N 87  
GLN N      N  N N 88  
GLN CA     C  N S 89  
GLN C      C  N N 90  
GLN O      O  N N 91  
GLN CB     C  N N 92  
GLN CG     C  N N 93  
GLN CD     C  N N 94  
GLN OE1    O  N N 95  
GLN NE2    N  N N 96  
GLN OXT    O  N N 97  
GLN H      H  N N 98  
GLN H2     H  N N 99  
GLN HA     H  N N 100 
GLN HB2    H  N N 101 
GLN HB3    H  N N 102 
GLN HG2    H  N N 103 
GLN HG3    H  N N 104 
GLN HE21   H  N N 105 
GLN HE22   H  N N 106 
GLN HXT    H  N N 107 
GLU N      N  N N 108 
GLU CA     C  N S 109 
GLU C      C  N N 110 
GLU O      O  N N 111 
GLU CB     C  N N 112 
GLU CG     C  N N 113 
GLU CD     C  N N 114 
GLU OE1    O  N N 115 
GLU OE2    O  N N 116 
GLU OXT    O  N N 117 
GLU H      H  N N 118 
GLU H2     H  N N 119 
GLU HA     H  N N 120 
GLU HB2    H  N N 121 
GLU HB3    H  N N 122 
GLU HG2    H  N N 123 
GLU HG3    H  N N 124 
GLU HE2    H  N N 125 
GLU HXT    H  N N 126 
GLY N      N  N N 127 
GLY CA     C  N N 128 
GLY C      C  N N 129 
GLY O      O  N N 130 
GLY OXT    O  N N 131 
GLY H      H  N N 132 
GLY H2     H  N N 133 
GLY HA2    H  N N 134 
GLY HA3    H  N N 135 
GLY HXT    H  N N 136 
HIS N      N  N N 137 
HIS CA     C  N S 138 
HIS C      C  N N 139 
HIS O      O  N N 140 
HIS CB     C  N N 141 
HIS CG     C  Y N 142 
HIS ND1    N  Y N 143 
HIS CD2    C  Y N 144 
HIS CE1    C  Y N 145 
HIS NE2    N  Y N 146 
HIS OXT    O  N N 147 
HIS H      H  N N 148 
HIS H2     H  N N 149 
HIS HA     H  N N 150 
HIS HB2    H  N N 151 
HIS HB3    H  N N 152 
HIS HD1    H  N N 153 
HIS HD2    H  N N 154 
HIS HE1    H  N N 155 
HIS HE2    H  N N 156 
HIS HXT    H  N N 157 
HOH O      O  N N 158 
HOH H1     H  N N 159 
HOH H2     H  N N 160 
ILE N      N  N N 161 
ILE CA     C  N S 162 
ILE C      C  N N 163 
ILE O      O  N N 164 
ILE CB     C  N S 165 
ILE CG1    C  N N 166 
ILE CG2    C  N N 167 
ILE CD1    C  N N 168 
ILE OXT    O  N N 169 
ILE H      H  N N 170 
ILE H2     H  N N 171 
ILE HA     H  N N 172 
ILE HB     H  N N 173 
ILE HG12   H  N N 174 
ILE HG13   H  N N 175 
ILE HG21   H  N N 176 
ILE HG22   H  N N 177 
ILE HG23   H  N N 178 
ILE HD11   H  N N 179 
ILE HD12   H  N N 180 
ILE HD13   H  N N 181 
ILE HXT    H  N N 182 
LEU N      N  N N 183 
LEU CA     C  N S 184 
LEU C      C  N N 185 
LEU O      O  N N 186 
LEU CB     C  N N 187 
LEU CG     C  N N 188 
LEU CD1    C  N N 189 
LEU CD2    C  N N 190 
LEU OXT    O  N N 191 
LEU H      H  N N 192 
LEU H2     H  N N 193 
LEU HA     H  N N 194 
LEU HB2    H  N N 195 
LEU HB3    H  N N 196 
LEU HG     H  N N 197 
LEU HD11   H  N N 198 
LEU HD12   H  N N 199 
LEU HD13   H  N N 200 
LEU HD21   H  N N 201 
LEU HD22   H  N N 202 
LEU HD23   H  N N 203 
LEU HXT    H  N N 204 
LYS N      N  N N 205 
LYS CA     C  N S 206 
LYS C      C  N N 207 
LYS O      O  N N 208 
LYS CB     C  N N 209 
LYS CG     C  N N 210 
LYS CD     C  N N 211 
LYS CE     C  N N 212 
LYS NZ     N  N N 213 
LYS OXT    O  N N 214 
LYS H      H  N N 215 
LYS H2     H  N N 216 
LYS HA     H  N N 217 
LYS HB2    H  N N 218 
LYS HB3    H  N N 219 
LYS HG2    H  N N 220 
LYS HG3    H  N N 221 
LYS HD2    H  N N 222 
LYS HD3    H  N N 223 
LYS HE2    H  N N 224 
LYS HE3    H  N N 225 
LYS HZ1    H  N N 226 
LYS HZ2    H  N N 227 
LYS HZ3    H  N N 228 
LYS HXT    H  N N 229 
MSE N      N  N N 230 
MSE CA     C  N S 231 
MSE C      C  N N 232 
MSE O      O  N N 233 
MSE OXT    O  N N 234 
MSE CB     C  N N 235 
MSE CG     C  N N 236 
MSE SE     SE N N 237 
MSE CE     C  N N 238 
MSE H      H  N N 239 
MSE H2     H  N N 240 
MSE HA     H  N N 241 
MSE HXT    H  N N 242 
MSE HB2    H  N N 243 
MSE HB3    H  N N 244 
MSE HG2    H  N N 245 
MSE HG3    H  N N 246 
MSE HE1    H  N N 247 
MSE HE2    H  N N 248 
MSE HE3    H  N N 249 
PHE N      N  N N 250 
PHE CA     C  N S 251 
PHE C      C  N N 252 
PHE O      O  N N 253 
PHE CB     C  N N 254 
PHE CG     C  Y N 255 
PHE CD1    C  Y N 256 
PHE CD2    C  Y N 257 
PHE CE1    C  Y N 258 
PHE CE2    C  Y N 259 
PHE CZ     C  Y N 260 
PHE OXT    O  N N 261 
PHE H      H  N N 262 
PHE H2     H  N N 263 
PHE HA     H  N N 264 
PHE HB2    H  N N 265 
PHE HB3    H  N N 266 
PHE HD1    H  N N 267 
PHE HD2    H  N N 268 
PHE HE1    H  N N 269 
PHE HE2    H  N N 270 
PHE HZ     H  N N 271 
PHE HXT    H  N N 272 
PRO N      N  N N 273 
PRO CA     C  N S 274 
PRO C      C  N N 275 
PRO O      O  N N 276 
PRO CB     C  N N 277 
PRO CG     C  N N 278 
PRO CD     C  N N 279 
PRO OXT    O  N N 280 
PRO H      H  N N 281 
PRO HA     H  N N 282 
PRO HB2    H  N N 283 
PRO HB3    H  N N 284 
PRO HG2    H  N N 285 
PRO HG3    H  N N 286 
PRO HD2    H  N N 287 
PRO HD3    H  N N 288 
PRO HXT    H  N N 289 
SER N      N  N N 290 
SER CA     C  N S 291 
SER C      C  N N 292 
SER O      O  N N 293 
SER CB     C  N N 294 
SER OG     O  N N 295 
SER OXT    O  N N 296 
SER H      H  N N 297 
SER H2     H  N N 298 
SER HA     H  N N 299 
SER HB2    H  N N 300 
SER HB3    H  N N 301 
SER HG     H  N N 302 
SER HXT    H  N N 303 
SO4 S      S  N N 304 
SO4 O1     O  N N 305 
SO4 O2     O  N N 306 
SO4 O3     O  N N 307 
SO4 O4     O  N N 308 
T3P P      P  N N 309 
T3P OP1    O  N N 310 
T3P OP2    O  N N 311 
T3P OP3    O  N N 312 
T3P "O5'"  O  N N 313 
T3P "C5'"  C  N N 314 
T3P "C4'"  C  N R 315 
T3P "O4'"  O  N N 316 
T3P "C3'"  C  N S 317 
T3P "O3'"  O  N N 318 
T3P "C2'"  C  N N 319 
T3P "C1'"  C  N R 320 
T3P N1     N  N N 321 
T3P C2     C  N N 322 
T3P O2     O  N N 323 
T3P N3     N  N N 324 
T3P C4     C  N N 325 
T3P O4     O  N N 326 
T3P C5     C  N N 327 
T3P C5M    C  N N 328 
T3P C6     C  N N 329 
T3P HOP2   H  N N 330 
T3P HOP3   H  N N 331 
T3P "H5'"  H  N N 332 
T3P "H5'1" H  N N 333 
T3P "H5''" H  N N 334 
T3P "H4'"  H  N N 335 
T3P "H3'"  H  N N 336 
T3P "H2'"  H  N N 337 
T3P "H2''" H  N N 338 
T3P "H1'"  H  N N 339 
T3P H3     H  N N 340 
T3P H51    H  N N 341 
T3P H52    H  N N 342 
T3P H53    H  N N 343 
T3P H6     H  N N 344 
THR N      N  N N 345 
THR CA     C  N S 346 
THR C      C  N N 347 
THR O      O  N N 348 
THR CB     C  N R 349 
THR OG1    O  N N 350 
THR CG2    C  N N 351 
THR OXT    O  N N 352 
THR H      H  N N 353 
THR H2     H  N N 354 
THR HA     H  N N 355 
THR HB     H  N N 356 
THR HG1    H  N N 357 
THR HG21   H  N N 358 
THR HG22   H  N N 359 
THR HG23   H  N N 360 
THR HXT    H  N N 361 
TRP N      N  N N 362 
TRP CA     C  N S 363 
TRP C      C  N N 364 
TRP O      O  N N 365 
TRP CB     C  N N 366 
TRP CG     C  Y N 367 
TRP CD1    C  Y N 368 
TRP CD2    C  Y N 369 
TRP NE1    N  Y N 370 
TRP CE2    C  Y N 371 
TRP CE3    C  Y N 372 
TRP CZ2    C  Y N 373 
TRP CZ3    C  Y N 374 
TRP CH2    C  Y N 375 
TRP OXT    O  N N 376 
TRP H      H  N N 377 
TRP H2     H  N N 378 
TRP HA     H  N N 379 
TRP HB2    H  N N 380 
TRP HB3    H  N N 381 
TRP HD1    H  N N 382 
TRP HE1    H  N N 383 
TRP HE3    H  N N 384 
TRP HZ2    H  N N 385 
TRP HZ3    H  N N 386 
TRP HH2    H  N N 387 
TRP HXT    H  N N 388 
TYR N      N  N N 389 
TYR CA     C  N S 390 
TYR C      C  N N 391 
TYR O      O  N N 392 
TYR CB     C  N N 393 
TYR CG     C  Y N 394 
TYR CD1    C  Y N 395 
TYR CD2    C  Y N 396 
TYR CE1    C  Y N 397 
TYR CE2    C  Y N 398 
TYR CZ     C  Y N 399 
TYR OH     O  N N 400 
TYR OXT    O  N N 401 
TYR H      H  N N 402 
TYR H2     H  N N 403 
TYR HA     H  N N 404 
TYR HB2    H  N N 405 
TYR HB3    H  N N 406 
TYR HD1    H  N N 407 
TYR HD2    H  N N 408 
TYR HE1    H  N N 409 
TYR HE2    H  N N 410 
TYR HH     H  N N 411 
TYR HXT    H  N N 412 
VAL N      N  N N 413 
VAL CA     C  N S 414 
VAL C      C  N N 415 
VAL O      O  N N 416 
VAL CB     C  N N 417 
VAL CG1    C  N N 418 
VAL CG2    C  N N 419 
VAL OXT    O  N N 420 
VAL H      H  N N 421 
VAL H2     H  N N 422 
VAL HA     H  N N 423 
VAL HB     H  N N 424 
VAL HG11   H  N N 425 
VAL HG12   H  N N 426 
VAL HG13   H  N N 427 
VAL HG21   H  N N 428 
VAL HG22   H  N N 429 
VAL HG23   H  N N 430 
VAL HXT    H  N N 431 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
CYS N     CA     sing N N 70  
CYS N     H      sing N N 71  
CYS N     H2     sing N N 72  
CYS CA    C      sing N N 73  
CYS CA    CB     sing N N 74  
CYS CA    HA     sing N N 75  
CYS C     O      doub N N 76  
CYS C     OXT    sing N N 77  
CYS CB    SG     sing N N 78  
CYS CB    HB2    sing N N 79  
CYS CB    HB3    sing N N 80  
CYS SG    HG     sing N N 81  
CYS OXT   HXT    sing N N 82  
GLN N     CA     sing N N 83  
GLN N     H      sing N N 84  
GLN N     H2     sing N N 85  
GLN CA    C      sing N N 86  
GLN CA    CB     sing N N 87  
GLN CA    HA     sing N N 88  
GLN C     O      doub N N 89  
GLN C     OXT    sing N N 90  
GLN CB    CG     sing N N 91  
GLN CB    HB2    sing N N 92  
GLN CB    HB3    sing N N 93  
GLN CG    CD     sing N N 94  
GLN CG    HG2    sing N N 95  
GLN CG    HG3    sing N N 96  
GLN CD    OE1    doub N N 97  
GLN CD    NE2    sing N N 98  
GLN NE2   HE21   sing N N 99  
GLN NE2   HE22   sing N N 100 
GLN OXT   HXT    sing N N 101 
GLU N     CA     sing N N 102 
GLU N     H      sing N N 103 
GLU N     H2     sing N N 104 
GLU CA    C      sing N N 105 
GLU CA    CB     sing N N 106 
GLU CA    HA     sing N N 107 
GLU C     O      doub N N 108 
GLU C     OXT    sing N N 109 
GLU CB    CG     sing N N 110 
GLU CB    HB2    sing N N 111 
GLU CB    HB3    sing N N 112 
GLU CG    CD     sing N N 113 
GLU CG    HG2    sing N N 114 
GLU CG    HG3    sing N N 115 
GLU CD    OE1    doub N N 116 
GLU CD    OE2    sing N N 117 
GLU OE2   HE2    sing N N 118 
GLU OXT   HXT    sing N N 119 
GLY N     CA     sing N N 120 
GLY N     H      sing N N 121 
GLY N     H2     sing N N 122 
GLY CA    C      sing N N 123 
GLY CA    HA2    sing N N 124 
GLY CA    HA3    sing N N 125 
GLY C     O      doub N N 126 
GLY C     OXT    sing N N 127 
GLY OXT   HXT    sing N N 128 
HIS N     CA     sing N N 129 
HIS N     H      sing N N 130 
HIS N     H2     sing N N 131 
HIS CA    C      sing N N 132 
HIS CA    CB     sing N N 133 
HIS CA    HA     sing N N 134 
HIS C     O      doub N N 135 
HIS C     OXT    sing N N 136 
HIS CB    CG     sing N N 137 
HIS CB    HB2    sing N N 138 
HIS CB    HB3    sing N N 139 
HIS CG    ND1    sing Y N 140 
HIS CG    CD2    doub Y N 141 
HIS ND1   CE1    doub Y N 142 
HIS ND1   HD1    sing N N 143 
HIS CD2   NE2    sing Y N 144 
HIS CD2   HD2    sing N N 145 
HIS CE1   NE2    sing Y N 146 
HIS CE1   HE1    sing N N 147 
HIS NE2   HE2    sing N N 148 
HIS OXT   HXT    sing N N 149 
HOH O     H1     sing N N 150 
HOH O     H2     sing N N 151 
ILE N     CA     sing N N 152 
ILE N     H      sing N N 153 
ILE N     H2     sing N N 154 
ILE CA    C      sing N N 155 
ILE CA    CB     sing N N 156 
ILE CA    HA     sing N N 157 
ILE C     O      doub N N 158 
ILE C     OXT    sing N N 159 
ILE CB    CG1    sing N N 160 
ILE CB    CG2    sing N N 161 
ILE CB    HB     sing N N 162 
ILE CG1   CD1    sing N N 163 
ILE CG1   HG12   sing N N 164 
ILE CG1   HG13   sing N N 165 
ILE CG2   HG21   sing N N 166 
ILE CG2   HG22   sing N N 167 
ILE CG2   HG23   sing N N 168 
ILE CD1   HD11   sing N N 169 
ILE CD1   HD12   sing N N 170 
ILE CD1   HD13   sing N N 171 
ILE OXT   HXT    sing N N 172 
LEU N     CA     sing N N 173 
LEU N     H      sing N N 174 
LEU N     H2     sing N N 175 
LEU CA    C      sing N N 176 
LEU CA    CB     sing N N 177 
LEU CA    HA     sing N N 178 
LEU C     O      doub N N 179 
LEU C     OXT    sing N N 180 
LEU CB    CG     sing N N 181 
LEU CB    HB2    sing N N 182 
LEU CB    HB3    sing N N 183 
LEU CG    CD1    sing N N 184 
LEU CG    CD2    sing N N 185 
LEU CG    HG     sing N N 186 
LEU CD1   HD11   sing N N 187 
LEU CD1   HD12   sing N N 188 
LEU CD1   HD13   sing N N 189 
LEU CD2   HD21   sing N N 190 
LEU CD2   HD22   sing N N 191 
LEU CD2   HD23   sing N N 192 
LEU OXT   HXT    sing N N 193 
LYS N     CA     sing N N 194 
LYS N     H      sing N N 195 
LYS N     H2     sing N N 196 
LYS CA    C      sing N N 197 
LYS CA    CB     sing N N 198 
LYS CA    HA     sing N N 199 
LYS C     O      doub N N 200 
LYS C     OXT    sing N N 201 
LYS CB    CG     sing N N 202 
LYS CB    HB2    sing N N 203 
LYS CB    HB3    sing N N 204 
LYS CG    CD     sing N N 205 
LYS CG    HG2    sing N N 206 
LYS CG    HG3    sing N N 207 
LYS CD    CE     sing N N 208 
LYS CD    HD2    sing N N 209 
LYS CD    HD3    sing N N 210 
LYS CE    NZ     sing N N 211 
LYS CE    HE2    sing N N 212 
LYS CE    HE3    sing N N 213 
LYS NZ    HZ1    sing N N 214 
LYS NZ    HZ2    sing N N 215 
LYS NZ    HZ3    sing N N 216 
LYS OXT   HXT    sing N N 217 
MSE N     CA     sing N N 218 
MSE N     H      sing N N 219 
MSE N     H2     sing N N 220 
MSE CA    C      sing N N 221 
MSE CA    CB     sing N N 222 
MSE CA    HA     sing N N 223 
MSE C     O      doub N N 224 
MSE C     OXT    sing N N 225 
MSE OXT   HXT    sing N N 226 
MSE CB    CG     sing N N 227 
MSE CB    HB2    sing N N 228 
MSE CB    HB3    sing N N 229 
MSE CG    SE     sing N N 230 
MSE CG    HG2    sing N N 231 
MSE CG    HG3    sing N N 232 
MSE SE    CE     sing N N 233 
MSE CE    HE1    sing N N 234 
MSE CE    HE2    sing N N 235 
MSE CE    HE3    sing N N 236 
PHE N     CA     sing N N 237 
PHE N     H      sing N N 238 
PHE N     H2     sing N N 239 
PHE CA    C      sing N N 240 
PHE CA    CB     sing N N 241 
PHE CA    HA     sing N N 242 
PHE C     O      doub N N 243 
PHE C     OXT    sing N N 244 
PHE CB    CG     sing N N 245 
PHE CB    HB2    sing N N 246 
PHE CB    HB3    sing N N 247 
PHE CG    CD1    doub Y N 248 
PHE CG    CD2    sing Y N 249 
PHE CD1   CE1    sing Y N 250 
PHE CD1   HD1    sing N N 251 
PHE CD2   CE2    doub Y N 252 
PHE CD2   HD2    sing N N 253 
PHE CE1   CZ     doub Y N 254 
PHE CE1   HE1    sing N N 255 
PHE CE2   CZ     sing Y N 256 
PHE CE2   HE2    sing N N 257 
PHE CZ    HZ     sing N N 258 
PHE OXT   HXT    sing N N 259 
PRO N     CA     sing N N 260 
PRO N     CD     sing N N 261 
PRO N     H      sing N N 262 
PRO CA    C      sing N N 263 
PRO CA    CB     sing N N 264 
PRO CA    HA     sing N N 265 
PRO C     O      doub N N 266 
PRO C     OXT    sing N N 267 
PRO CB    CG     sing N N 268 
PRO CB    HB2    sing N N 269 
PRO CB    HB3    sing N N 270 
PRO CG    CD     sing N N 271 
PRO CG    HG2    sing N N 272 
PRO CG    HG3    sing N N 273 
PRO CD    HD2    sing N N 274 
PRO CD    HD3    sing N N 275 
PRO OXT   HXT    sing N N 276 
SER N     CA     sing N N 277 
SER N     H      sing N N 278 
SER N     H2     sing N N 279 
SER CA    C      sing N N 280 
SER CA    CB     sing N N 281 
SER CA    HA     sing N N 282 
SER C     O      doub N N 283 
SER C     OXT    sing N N 284 
SER CB    OG     sing N N 285 
SER CB    HB2    sing N N 286 
SER CB    HB3    sing N N 287 
SER OG    HG     sing N N 288 
SER OXT   HXT    sing N N 289 
SO4 S     O1     doub N N 290 
SO4 S     O2     doub N N 291 
SO4 S     O3     sing N N 292 
SO4 S     O4     sing N N 293 
T3P P     OP1    doub N N 294 
T3P P     OP2    sing N N 295 
T3P P     OP3    sing N N 296 
T3P P     "O3'"  sing N N 297 
T3P OP2   HOP2   sing N N 298 
T3P OP3   HOP3   sing N N 299 
T3P "O5'" "C5'"  sing N N 300 
T3P "O5'" "H5'"  sing N N 301 
T3P "C5'" "C4'"  sing N N 302 
T3P "C5'" "H5'1" sing N N 303 
T3P "C5'" "H5''" sing N N 304 
T3P "C4'" "O4'"  sing N N 305 
T3P "C4'" "C3'"  sing N N 306 
T3P "C4'" "H4'"  sing N N 307 
T3P "O4'" "C1'"  sing N N 308 
T3P "C3'" "O3'"  sing N N 309 
T3P "C3'" "C2'"  sing N N 310 
T3P "C3'" "H3'"  sing N N 311 
T3P "C2'" "C1'"  sing N N 312 
T3P "C2'" "H2'"  sing N N 313 
T3P "C2'" "H2''" sing N N 314 
T3P "C1'" N1     sing N N 315 
T3P "C1'" "H1'"  sing N N 316 
T3P N1    C2     sing N N 317 
T3P N1    C6     sing N N 318 
T3P C2    O2     doub N N 319 
T3P C2    N3     sing N N 320 
T3P N3    C4     sing N N 321 
T3P N3    H3     sing N N 322 
T3P C4    O4     doub N N 323 
T3P C4    C5     sing N N 324 
T3P C5    C5M    sing N N 325 
T3P C5    C6     doub N N 326 
T3P C5M   H51    sing N N 327 
T3P C5M   H52    sing N N 328 
T3P C5M   H53    sing N N 329 
T3P C6    H6     sing N N 330 
THR N     CA     sing N N 331 
THR N     H      sing N N 332 
THR N     H2     sing N N 333 
THR CA    C      sing N N 334 
THR CA    CB     sing N N 335 
THR CA    HA     sing N N 336 
THR C     O      doub N N 337 
THR C     OXT    sing N N 338 
THR CB    OG1    sing N N 339 
THR CB    CG2    sing N N 340 
THR CB    HB     sing N N 341 
THR OG1   HG1    sing N N 342 
THR CG2   HG21   sing N N 343 
THR CG2   HG22   sing N N 344 
THR CG2   HG23   sing N N 345 
THR OXT   HXT    sing N N 346 
TRP N     CA     sing N N 347 
TRP N     H      sing N N 348 
TRP N     H2     sing N N 349 
TRP CA    C      sing N N 350 
TRP CA    CB     sing N N 351 
TRP CA    HA     sing N N 352 
TRP C     O      doub N N 353 
TRP C     OXT    sing N N 354 
TRP CB    CG     sing N N 355 
TRP CB    HB2    sing N N 356 
TRP CB    HB3    sing N N 357 
TRP CG    CD1    doub Y N 358 
TRP CG    CD2    sing Y N 359 
TRP CD1   NE1    sing Y N 360 
TRP CD1   HD1    sing N N 361 
TRP CD2   CE2    doub Y N 362 
TRP CD2   CE3    sing Y N 363 
TRP NE1   CE2    sing Y N 364 
TRP NE1   HE1    sing N N 365 
TRP CE2   CZ2    sing Y N 366 
TRP CE3   CZ3    doub Y N 367 
TRP CE3   HE3    sing N N 368 
TRP CZ2   CH2    doub Y N 369 
TRP CZ2   HZ2    sing N N 370 
TRP CZ3   CH2    sing Y N 371 
TRP CZ3   HZ3    sing N N 372 
TRP CH2   HH2    sing N N 373 
TRP OXT   HXT    sing N N 374 
TYR N     CA     sing N N 375 
TYR N     H      sing N N 376 
TYR N     H2     sing N N 377 
TYR CA    C      sing N N 378 
TYR CA    CB     sing N N 379 
TYR CA    HA     sing N N 380 
TYR C     O      doub N N 381 
TYR C     OXT    sing N N 382 
TYR CB    CG     sing N N 383 
TYR CB    HB2    sing N N 384 
TYR CB    HB3    sing N N 385 
TYR CG    CD1    doub Y N 386 
TYR CG    CD2    sing Y N 387 
TYR CD1   CE1    sing Y N 388 
TYR CD1   HD1    sing N N 389 
TYR CD2   CE2    doub Y N 390 
TYR CD2   HD2    sing N N 391 
TYR CE1   CZ     doub Y N 392 
TYR CE1   HE1    sing N N 393 
TYR CE2   CZ     sing Y N 394 
TYR CE2   HE2    sing N N 395 
TYR CZ    OH     sing N N 396 
TYR OH    HH     sing N N 397 
TYR OXT   HXT    sing N N 398 
VAL N     CA     sing N N 399 
VAL N     H      sing N N 400 
VAL N     H2     sing N N 401 
VAL CA    C      sing N N 402 
VAL CA    CB     sing N N 403 
VAL CA    HA     sing N N 404 
VAL C     O      doub N N 405 
VAL C     OXT    sing N N 406 
VAL CB    CG1    sing N N 407 
VAL CB    CG2    sing N N 408 
VAL CB    HB     sing N N 409 
VAL CG1   HG11   sing N N 410 
VAL CG1   HG12   sing N N 411 
VAL CG1   HG13   sing N N 412 
VAL CG2   HG21   sing N N 413 
VAL CG2   HG22   sing N N 414 
VAL CG2   HG23   sing N N 415 
VAL OXT   HXT    sing N N 416 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   2O8N 
_pdbx_initial_refinement_model.details          'PDB ENTRY 2O8N' 
# 
_atom_sites.entry_id                    3ROG 
_atom_sites.fract_transf_matrix[1][1]   0.007931 
_atom_sites.fract_transf_matrix[1][2]   0.004579 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009157 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009012 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
SE 
# 
loop_