data_3ROZ
# 
_entry.id   3ROZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.399 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3ROZ         pdb_00003roz 10.2210/pdb3roz/pdb 
RCSB  RCSB065200   ?            ?                   
WWPDB D_1000065200 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-18 
2 'Structure model' 1 1 2012-10-31 
3 'Structure model' 1 2 2022-04-13 
4 'Structure model' 1 3 2023-09-13 
5 'Structure model' 1 4 2023-12-06 
6 'Structure model' 1 5 2024-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 3 'Structure model' 'Derived calculations'   
4 3 'Structure model' 'Structure summary'      
5 4 'Structure model' 'Data collection'        
6 4 'Structure model' 'Refinement description' 
7 5 'Structure model' 'Data collection'        
8 6 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' audit_author                  
2  3 'Structure model' citation_author               
3  3 'Structure model' database_2                    
4  3 'Structure model' struct_conn                   
5  3 'Structure model' struct_ref_seq_dif            
6  3 'Structure model' struct_site                   
7  4 'Structure model' chem_comp_atom                
8  4 'Structure model' chem_comp_bond                
9  4 'Structure model' pdbx_initial_refinement_model 
10 5 'Structure model' chem_comp_atom                
11 5 'Structure model' chem_comp_bond                
12 6 'Structure model' pdbx_entry_details            
13 6 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_audit_author.identifier_ORCID'      
2  3 'Structure model' '_citation_author.identifier_ORCID'   
3  3 'Structure model' '_database_2.pdbx_DOI'                
4  3 'Structure model' '_database_2.pdbx_database_accession' 
5  3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  3 'Structure model' '_struct_ref_seq_dif.details'         
7  3 'Structure model' '_struct_site.pdbx_auth_asym_id'      
8  3 'Structure model' '_struct_site.pdbx_auth_comp_id'      
9  3 'Structure model' '_struct_site.pdbx_auth_seq_id'       
10 5 'Structure model' '_chem_comp_atom.atom_id'             
11 5 'Structure model' '_chem_comp_bond.atom_id_2'           
# 
_pdbx_database_status.entry_id                        3ROZ 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-26 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O8N Apo-protein unspecified 
PDB 2DG2 Apo-protein unspecified 
PDB 3RNO .           unspecified 
PDB 3RO7 .           unspecified 
PDB 3ROE .           unspecified 
PDB 3ROG .           unspecified 
PDB 3ROX .           unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shumilin, I.A.'  1 ?                   
'Jha, K.N.'       2 ?                   
'Cymborowski, M.' 3 ?                   
'Herr, J.C.'      4 ?                   
'Minor, W.'       5 0000-0001-7075-7090 
# 
_citation.id                        primary 
_citation.title                     'Identification of unknown protein function using metabolite cocktail screening.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                1715 
_citation.page_last                 1725 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22940582 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.07.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shumilin, I.A.'  1 ?                   
primary 'Cymborowski, M.' 2 ?                   
primary 'Chertihin, O.'   3 ?                   
primary 'Jha, K.N.'       4 ?                   
primary 'Herr, J.C.'      5 ?                   
primary 'Lesley, S.A.'    6 ?                   
primary 'Joachimiak, A.'  7 ?                   
primary 'Minor, W.'       8 0000-0001-7075-7090 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Apolipoprotein A-I-binding protein' 29872.963 1 ? ? ? ? 
2 non-polymer syn 'SULFATE ION'                        96.063    1 ? ? ? ? 
3 non-polymer syn NICOTINAMIDE                         122.125   1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AI-BP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)QQSVCRARPIWWGTQRRGSET(MSE)AGAAVKYLSQEEAQAVDQELFNEYQFSVDQL(MSE)ELAGLSCATAIAK
AYPPTS(MSE)SKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQK(MSE)DIPFLGE
(MSE)PPEP(MSE)(MSE)VDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPD
LLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MQQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPP
TVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFG
FSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEK
KYQLNLPSYPDTECVYRLQHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 NICOTINAMIDE  NCA 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   GLN n 
1 3   GLN n 
1 4   SER n 
1 5   VAL n 
1 6   CYS n 
1 7   ARG n 
1 8   ALA n 
1 9   ARG n 
1 10  PRO n 
1 11  ILE n 
1 12  TRP n 
1 13  TRP n 
1 14  GLY n 
1 15  THR n 
1 16  GLN n 
1 17  ARG n 
1 18  ARG n 
1 19  GLY n 
1 20  SER n 
1 21  GLU n 
1 22  THR n 
1 23  MSE n 
1 24  ALA n 
1 25  GLY n 
1 26  ALA n 
1 27  ALA n 
1 28  VAL n 
1 29  LYS n 
1 30  TYR n 
1 31  LEU n 
1 32  SER n 
1 33  GLN n 
1 34  GLU n 
1 35  GLU n 
1 36  ALA n 
1 37  GLN n 
1 38  ALA n 
1 39  VAL n 
1 40  ASP n 
1 41  GLN n 
1 42  GLU n 
1 43  LEU n 
1 44  PHE n 
1 45  ASN n 
1 46  GLU n 
1 47  TYR n 
1 48  GLN n 
1 49  PHE n 
1 50  SER n 
1 51  VAL n 
1 52  ASP n 
1 53  GLN n 
1 54  LEU n 
1 55  MSE n 
1 56  GLU n 
1 57  LEU n 
1 58  ALA n 
1 59  GLY n 
1 60  LEU n 
1 61  SER n 
1 62  CYS n 
1 63  ALA n 
1 64  THR n 
1 65  ALA n 
1 66  ILE n 
1 67  ALA n 
1 68  LYS n 
1 69  ALA n 
1 70  TYR n 
1 71  PRO n 
1 72  PRO n 
1 73  THR n 
1 74  SER n 
1 75  MSE n 
1 76  SER n 
1 77  LYS n 
1 78  SER n 
1 79  PRO n 
1 80  PRO n 
1 81  THR n 
1 82  VAL n 
1 83  LEU n 
1 84  VAL n 
1 85  ILE n 
1 86  CYS n 
1 87  GLY n 
1 88  PRO n 
1 89  GLY n 
1 90  ASN n 
1 91  ASN n 
1 92  GLY n 
1 93  GLY n 
1 94  ASP n 
1 95  GLY n 
1 96  LEU n 
1 97  VAL n 
1 98  CYS n 
1 99  ALA n 
1 100 ARG n 
1 101 HIS n 
1 102 LEU n 
1 103 LYS n 
1 104 LEU n 
1 105 PHE n 
1 106 GLY n 
1 107 TYR n 
1 108 GLN n 
1 109 PRO n 
1 110 THR n 
1 111 ILE n 
1 112 TYR n 
1 113 TYR n 
1 114 PRO n 
1 115 LYS n 
1 116 ARG n 
1 117 PRO n 
1 118 ASN n 
1 119 LYS n 
1 120 PRO n 
1 121 LEU n 
1 122 PHE n 
1 123 THR n 
1 124 GLY n 
1 125 LEU n 
1 126 VAL n 
1 127 THR n 
1 128 GLN n 
1 129 CYS n 
1 130 GLN n 
1 131 LYS n 
1 132 MSE n 
1 133 ASP n 
1 134 ILE n 
1 135 PRO n 
1 136 PHE n 
1 137 LEU n 
1 138 GLY n 
1 139 GLU n 
1 140 MSE n 
1 141 PRO n 
1 142 PRO n 
1 143 GLU n 
1 144 PRO n 
1 145 MSE n 
1 146 MSE n 
1 147 VAL n 
1 148 ASP n 
1 149 GLU n 
1 150 LEU n 
1 151 TYR n 
1 152 GLU n 
1 153 LEU n 
1 154 VAL n 
1 155 VAL n 
1 156 ASP n 
1 157 ALA n 
1 158 ILE n 
1 159 PHE n 
1 160 GLY n 
1 161 PHE n 
1 162 SER n 
1 163 PHE n 
1 164 LYS n 
1 165 GLY n 
1 166 ASP n 
1 167 VAL n 
1 168 ARG n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 HIS n 
1 173 SER n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 VAL n 
1 178 LEU n 
1 179 SER n 
1 180 GLY n 
1 181 LEU n 
1 182 THR n 
1 183 VAL n 
1 184 PRO n 
1 185 ILE n 
1 186 ALA n 
1 187 SER n 
1 188 ILE n 
1 189 ASP n 
1 190 ILE n 
1 191 PRO n 
1 192 SER n 
1 193 GLY n 
1 194 TRP n 
1 195 ASP n 
1 196 VAL n 
1 197 GLU n 
1 198 LYS n 
1 199 GLY n 
1 200 ASN n 
1 201 PRO n 
1 202 SER n 
1 203 GLY n 
1 204 ILE n 
1 205 GLN n 
1 206 PRO n 
1 207 ASP n 
1 208 LEU n 
1 209 LEU n 
1 210 ILE n 
1 211 SER n 
1 212 LEU n 
1 213 THR n 
1 214 ALA n 
1 215 PRO n 
1 216 LYS n 
1 217 LYS n 
1 218 SER n 
1 219 ALA n 
1 220 THR n 
1 221 HIS n 
1 222 PHE n 
1 223 THR n 
1 224 GLY n 
1 225 ARG n 
1 226 TYR n 
1 227 HIS n 
1 228 TYR n 
1 229 LEU n 
1 230 GLY n 
1 231 GLY n 
1 232 ARG n 
1 233 PHE n 
1 234 VAL n 
1 235 PRO n 
1 236 PRO n 
1 237 ALA n 
1 238 LEU n 
1 239 GLU n 
1 240 LYS n 
1 241 LYS n 
1 242 TYR n 
1 243 GLN n 
1 244 LEU n 
1 245 ASN n 
1 246 LEU n 
1 247 PRO n 
1 248 SER n 
1 249 TYR n 
1 250 PRO n 
1 251 ASP n 
1 252 THR n 
1 253 GLU n 
1 254 CYS n 
1 255 VAL n 
1 256 TYR n 
1 257 ARG n 
1 258 LEU n 
1 259 GLN n 
1 260 HIS n 
1 261 HIS n 
1 262 HIS n 
1 263 HIS n 
1 264 HIS n 
1 265 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Aibp, Apoa1bp' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
NCA non-polymer         . NICOTINAMIDE     ? 'C6 H6 N2 O'     122.125 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'    ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   0   ?   ?   ?   A . n 
A 1 2   GLN 2   1   ?   ?   ?   A . n 
A 1 3   GLN 3   2   ?   ?   ?   A . n 
A 1 4   SER 4   3   ?   ?   ?   A . n 
A 1 5   VAL 5   4   ?   ?   ?   A . n 
A 1 6   CYS 6   5   ?   ?   ?   A . n 
A 1 7   ARG 7   6   ?   ?   ?   A . n 
A 1 8   ALA 8   7   ?   ?   ?   A . n 
A 1 9   ARG 9   8   ?   ?   ?   A . n 
A 1 10  PRO 10  9   ?   ?   ?   A . n 
A 1 11  ILE 11  10  ?   ?   ?   A . n 
A 1 12  TRP 12  11  ?   ?   ?   A . n 
A 1 13  TRP 13  12  ?   ?   ?   A . n 
A 1 14  GLY 14  13  ?   ?   ?   A . n 
A 1 15  THR 15  14  ?   ?   ?   A . n 
A 1 16  GLN 16  15  ?   ?   ?   A . n 
A 1 17  ARG 17  16  ?   ?   ?   A . n 
A 1 18  ARG 18  17  ?   ?   ?   A . n 
A 1 19  GLY 19  18  ?   ?   ?   A . n 
A 1 20  SER 20  19  ?   ?   ?   A . n 
A 1 21  GLU 21  20  ?   ?   ?   A . n 
A 1 22  THR 22  21  ?   ?   ?   A . n 
A 1 23  MSE 23  22  ?   ?   ?   A . n 
A 1 24  ALA 24  23  ?   ?   ?   A . n 
A 1 25  GLY 25  24  ?   ?   ?   A . n 
A 1 26  ALA 26  25  ?   ?   ?   A . n 
A 1 27  ALA 27  26  26  ALA ALA A . n 
A 1 28  VAL 28  27  27  VAL VAL A . n 
A 1 29  LYS 29  28  28  LYS LYS A . n 
A 1 30  TYR 30  29  29  TYR TYR A . n 
A 1 31  LEU 31  30  30  LEU LEU A . n 
A 1 32  SER 32  31  31  SER SER A . n 
A 1 33  GLN 33  32  32  GLN GLN A . n 
A 1 34  GLU 34  33  33  GLU GLU A . n 
A 1 35  GLU 35  34  34  GLU GLU A . n 
A 1 36  ALA 36  35  35  ALA ALA A . n 
A 1 37  GLN 37  36  36  GLN GLN A . n 
A 1 38  ALA 38  37  37  ALA ALA A . n 
A 1 39  VAL 39  38  38  VAL VAL A . n 
A 1 40  ASP 40  39  39  ASP ASP A . n 
A 1 41  GLN 41  40  40  GLN GLN A . n 
A 1 42  GLU 42  41  41  GLU GLU A . n 
A 1 43  LEU 43  42  42  LEU LEU A . n 
A 1 44  PHE 44  43  43  PHE PHE A . n 
A 1 45  ASN 45  44  44  ASN ASN A . n 
A 1 46  GLU 46  45  45  GLU GLU A . n 
A 1 47  TYR 47  46  46  TYR TYR A . n 
A 1 48  GLN 48  47  47  GLN GLN A . n 
A 1 49  PHE 49  48  48  PHE PHE A . n 
A 1 50  SER 50  49  49  SER SER A . n 
A 1 51  VAL 51  50  50  VAL VAL A . n 
A 1 52  ASP 52  51  51  ASP ASP A . n 
A 1 53  GLN 53  52  52  GLN GLN A . n 
A 1 54  LEU 54  53  53  LEU LEU A . n 
A 1 55  MSE 55  54  54  MSE MSE A . n 
A 1 56  GLU 56  55  55  GLU GLU A . n 
A 1 57  LEU 57  56  56  LEU LEU A . n 
A 1 58  ALA 58  57  57  ALA ALA A . n 
A 1 59  GLY 59  58  58  GLY GLY A . n 
A 1 60  LEU 60  59  59  LEU LEU A . n 
A 1 61  SER 61  60  60  SER SER A . n 
A 1 62  CYS 62  61  61  CYS CYS A . n 
A 1 63  ALA 63  62  62  ALA ALA A . n 
A 1 64  THR 64  63  63  THR THR A . n 
A 1 65  ALA 65  64  64  ALA ALA A . n 
A 1 66  ILE 66  65  65  ILE ILE A . n 
A 1 67  ALA 67  66  66  ALA ALA A . n 
A 1 68  LYS 68  67  67  LYS LYS A . n 
A 1 69  ALA 69  68  68  ALA ALA A . n 
A 1 70  TYR 70  69  69  TYR TYR A . n 
A 1 71  PRO 71  70  70  PRO PRO A . n 
A 1 72  PRO 72  71  71  PRO PRO A . n 
A 1 73  THR 73  72  72  THR THR A . n 
A 1 74  SER 74  73  73  SER SER A . n 
A 1 75  MSE 75  74  74  MSE MSE A . n 
A 1 76  SER 76  75  75  SER SER A . n 
A 1 77  LYS 77  76  76  LYS LYS A . n 
A 1 78  SER 78  77  77  SER SER A . n 
A 1 79  PRO 79  78  78  PRO PRO A . n 
A 1 80  PRO 80  79  79  PRO PRO A . n 
A 1 81  THR 81  80  80  THR THR A . n 
A 1 82  VAL 82  81  81  VAL VAL A . n 
A 1 83  LEU 83  82  82  LEU LEU A . n 
A 1 84  VAL 84  83  83  VAL VAL A . n 
A 1 85  ILE 85  84  84  ILE ILE A . n 
A 1 86  CYS 86  85  85  CYS CYS A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  PRO 88  87  87  PRO PRO A . n 
A 1 89  GLY 89  88  88  GLY GLY A . n 
A 1 90  ASN 90  89  89  ASN ASN A . n 
A 1 91  ASN 91  90  90  ASN ASN A . n 
A 1 92  GLY 92  91  91  GLY GLY A . n 
A 1 93  GLY 93  92  92  GLY GLY A . n 
A 1 94  ASP 94  93  93  ASP ASP A . n 
A 1 95  GLY 95  94  94  GLY GLY A . n 
A 1 96  LEU 96  95  95  LEU LEU A . n 
A 1 97  VAL 97  96  96  VAL VAL A . n 
A 1 98  CYS 98  97  97  CYS CYS A . n 
A 1 99  ALA 99  98  98  ALA ALA A . n 
A 1 100 ARG 100 99  99  ARG ARG A . n 
A 1 101 HIS 101 100 100 HIS HIS A . n 
A 1 102 LEU 102 101 101 LEU LEU A . n 
A 1 103 LYS 103 102 102 LYS LYS A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 PHE 105 104 104 PHE PHE A . n 
A 1 106 GLY 106 105 105 GLY GLY A . n 
A 1 107 TYR 107 106 106 TYR TYR A . n 
A 1 108 GLN 108 107 107 GLN GLN A . n 
A 1 109 PRO 109 108 108 PRO PRO A . n 
A 1 110 THR 110 109 109 THR THR A . n 
A 1 111 ILE 111 110 110 ILE ILE A . n 
A 1 112 TYR 112 111 111 TYR TYR A . n 
A 1 113 TYR 113 112 112 TYR TYR A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 LYS 115 114 114 LYS LYS A . n 
A 1 116 ARG 116 115 115 ARG ARG A . n 
A 1 117 PRO 117 116 116 PRO PRO A . n 
A 1 118 ASN 118 117 117 ASN ASN A . n 
A 1 119 LYS 119 118 118 LYS LYS A . n 
A 1 120 PRO 120 119 119 PRO PRO A . n 
A 1 121 LEU 121 120 120 LEU LEU A . n 
A 1 122 PHE 122 121 121 PHE PHE A . n 
A 1 123 THR 123 122 122 THR THR A . n 
A 1 124 GLY 124 123 123 GLY GLY A . n 
A 1 125 LEU 125 124 124 LEU LEU A . n 
A 1 126 VAL 126 125 125 VAL VAL A . n 
A 1 127 THR 127 126 126 THR THR A . n 
A 1 128 GLN 128 127 127 GLN GLN A . n 
A 1 129 CYS 129 128 128 CYS CYS A . n 
A 1 130 GLN 130 129 129 GLN GLN A . n 
A 1 131 LYS 131 130 130 LYS LYS A . n 
A 1 132 MSE 132 131 131 MSE MSE A . n 
A 1 133 ASP 133 132 132 ASP ASP A . n 
A 1 134 ILE 134 133 133 ILE ILE A . n 
A 1 135 PRO 135 134 134 PRO PRO A . n 
A 1 136 PHE 136 135 135 PHE PHE A . n 
A 1 137 LEU 137 136 136 LEU LEU A . n 
A 1 138 GLY 138 137 137 GLY GLY A . n 
A 1 139 GLU 139 138 138 GLU GLU A . n 
A 1 140 MSE 140 139 139 MSE MSE A . n 
A 1 141 PRO 141 140 140 PRO PRO A . n 
A 1 142 PRO 142 141 141 PRO PRO A . n 
A 1 143 GLU 143 142 142 GLU GLU A . n 
A 1 144 PRO 144 143 143 PRO PRO A . n 
A 1 145 MSE 145 144 144 MSE MSE A . n 
A 1 146 MSE 146 145 145 MSE MSE A . n 
A 1 147 VAL 147 146 146 VAL VAL A . n 
A 1 148 ASP 148 147 147 ASP ASP A . n 
A 1 149 GLU 149 148 148 GLU GLU A . n 
A 1 150 LEU 150 149 149 LEU LEU A . n 
A 1 151 TYR 151 150 150 TYR TYR A . n 
A 1 152 GLU 152 151 151 GLU GLU A . n 
A 1 153 LEU 153 152 152 LEU LEU A . n 
A 1 154 VAL 154 153 153 VAL VAL A . n 
A 1 155 VAL 155 154 154 VAL VAL A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 ALA 157 156 156 ALA ALA A . n 
A 1 158 ILE 158 157 157 ILE ILE A . n 
A 1 159 PHE 159 158 158 PHE PHE A . n 
A 1 160 GLY 160 159 159 GLY GLY A . n 
A 1 161 PHE 161 160 160 PHE PHE A . n 
A 1 162 SER 162 161 161 SER SER A . n 
A 1 163 PHE 163 162 162 PHE PHE A . n 
A 1 164 LYS 164 163 163 LYS LYS A . n 
A 1 165 GLY 165 164 164 GLY GLY A . n 
A 1 166 ASP 166 165 165 ASP ASP A . n 
A 1 167 VAL 167 166 166 VAL VAL A . n 
A 1 168 ARG 168 167 167 ARG ARG A . n 
A 1 169 GLU 169 168 168 GLU GLU A . n 
A 1 170 PRO 170 169 169 PRO PRO A . n 
A 1 171 PHE 171 170 170 PHE PHE A . n 
A 1 172 HIS 172 171 171 HIS HIS A . n 
A 1 173 SER 173 172 172 SER SER A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 SER 176 175 175 SER SER A . n 
A 1 177 VAL 177 176 176 VAL VAL A . n 
A 1 178 LEU 178 177 177 LEU LEU A . n 
A 1 179 SER 179 178 178 SER SER A . n 
A 1 180 GLY 180 179 179 GLY GLY A . n 
A 1 181 LEU 181 180 180 LEU LEU A . n 
A 1 182 THR 182 181 181 THR THR A . n 
A 1 183 VAL 183 182 182 VAL VAL A . n 
A 1 184 PRO 184 183 183 PRO PRO A . n 
A 1 185 ILE 185 184 184 ILE ILE A . n 
A 1 186 ALA 186 185 185 ALA ALA A . n 
A 1 187 SER 187 186 186 SER SER A . n 
A 1 188 ILE 188 187 187 ILE ILE A . n 
A 1 189 ASP 189 188 188 ASP ASP A . n 
A 1 190 ILE 190 189 189 ILE ILE A . n 
A 1 191 PRO 191 190 190 PRO PRO A . n 
A 1 192 SER 192 191 191 SER SER A . n 
A 1 193 GLY 193 192 192 GLY GLY A . n 
A 1 194 TRP 194 193 193 TRP TRP A . n 
A 1 195 ASP 195 194 194 ASP ASP A . n 
A 1 196 VAL 196 195 195 VAL VAL A . n 
A 1 197 GLU 197 196 196 GLU GLU A . n 
A 1 198 LYS 198 197 197 LYS LYS A . n 
A 1 199 GLY 199 198 198 GLY GLY A . n 
A 1 200 ASN 200 199 199 ASN ASN A . n 
A 1 201 PRO 201 200 200 PRO PRO A . n 
A 1 202 SER 202 201 201 SER SER A . n 
A 1 203 GLY 203 202 202 GLY GLY A . n 
A 1 204 ILE 204 203 203 ILE ILE A . n 
A 1 205 GLN 205 204 204 GLN GLN A . n 
A 1 206 PRO 206 205 205 PRO PRO A . n 
A 1 207 ASP 207 206 206 ASP ASP A . n 
A 1 208 LEU 208 207 207 LEU LEU A . n 
A 1 209 LEU 209 208 208 LEU LEU A . n 
A 1 210 ILE 210 209 209 ILE ILE A . n 
A 1 211 SER 211 210 210 SER SER A . n 
A 1 212 LEU 212 211 211 LEU LEU A . n 
A 1 213 THR 213 212 212 THR THR A . n 
A 1 214 ALA 214 213 213 ALA ALA A . n 
A 1 215 PRO 215 214 214 PRO PRO A . n 
A 1 216 LYS 216 215 215 LYS LYS A . n 
A 1 217 LYS 217 216 216 LYS LYS A . n 
A 1 218 SER 218 217 217 SER SER A . n 
A 1 219 ALA 219 218 218 ALA ALA A . n 
A 1 220 THR 220 219 219 THR THR A . n 
A 1 221 HIS 221 220 220 HIS HIS A . n 
A 1 222 PHE 222 221 221 PHE PHE A . n 
A 1 223 THR 223 222 222 THR THR A . n 
A 1 224 GLY 224 223 223 GLY GLY A . n 
A 1 225 ARG 225 224 224 ARG ARG A . n 
A 1 226 TYR 226 225 225 TYR TYR A . n 
A 1 227 HIS 227 226 226 HIS HIS A . n 
A 1 228 TYR 228 227 227 TYR TYR A . n 
A 1 229 LEU 229 228 228 LEU LEU A . n 
A 1 230 GLY 230 229 229 GLY GLY A . n 
A 1 231 GLY 231 230 230 GLY GLY A . n 
A 1 232 ARG 232 231 231 ARG ARG A . n 
A 1 233 PHE 233 232 232 PHE PHE A . n 
A 1 234 VAL 234 233 233 VAL VAL A . n 
A 1 235 PRO 235 234 234 PRO PRO A . n 
A 1 236 PRO 236 235 235 PRO PRO A . n 
A 1 237 ALA 237 236 236 ALA ALA A . n 
A 1 238 LEU 238 237 237 LEU LEU A . n 
A 1 239 GLU 239 238 238 GLU GLU A . n 
A 1 240 LYS 240 239 239 LYS LYS A . n 
A 1 241 LYS 241 240 240 LYS LYS A . n 
A 1 242 TYR 242 241 241 TYR TYR A . n 
A 1 243 GLN 243 242 242 GLN GLN A . n 
A 1 244 LEU 244 243 243 LEU LEU A . n 
A 1 245 ASN 245 244 244 ASN ASN A . n 
A 1 246 LEU 246 245 245 LEU LEU A . n 
A 1 247 PRO 247 246 246 PRO PRO A . n 
A 1 248 SER 248 247 247 SER SER A . n 
A 1 249 TYR 249 248 248 TYR TYR A . n 
A 1 250 PRO 250 249 249 PRO PRO A . n 
A 1 251 ASP 251 250 250 ASP ASP A . n 
A 1 252 THR 252 251 251 THR THR A . n 
A 1 253 GLU 253 252 252 GLU GLU A . n 
A 1 254 CYS 254 253 253 CYS CYS A . n 
A 1 255 VAL 255 254 254 VAL VAL A . n 
A 1 256 TYR 256 255 255 TYR TYR A . n 
A 1 257 ARG 257 256 256 ARG ARG A . n 
A 1 258 LEU 258 257 257 LEU LEU A . n 
A 1 259 GLN 259 258 258 GLN GLN A . n 
A 1 260 HIS 260 259 ?   ?   ?   A . n 
A 1 261 HIS 261 260 ?   ?   ?   A . n 
A 1 262 HIS 262 261 ?   ?   ?   A . n 
A 1 263 HIS 263 262 ?   ?   ?   A . n 
A 1 264 HIS 264 263 ?   ?   ?   A . n 
A 1 265 HIS 265 264 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1 265 1 SO4 SO4 A . 
C 3 NCA 1 266 2 NCA NCA A . 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 2 
HKL-3000    .        ?               ?       ?                    ?                     'data collection' ? ?          ? 3 
HKL-3000    .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 4 
HKL-3000    .        ?               ?       ?                    ?                     'data scaling'    ? ?          ? 5 
HKL-3000    MOLREP   ?               ?       ?                    ?                     phasing           ? ?          ? 6 
# 
_cell.entry_id           3ROZ 
_cell.length_a           125.115 
_cell.length_b           125.115 
_cell.length_c           119.801 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              18 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3ROZ 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                155 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3ROZ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.02 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'0.1 M SODIUM ACETATE, 1.5 M AMMONIUM SULFATE, PH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210r' 
_diffrn_detector.details                MIRRORS 
_diffrn_detector.pdbx_collection_date   2009-06-11 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   52928 
_reflns.number_all                   52928 
_reflns.percent_possible_obs         84.4 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_Rsym_value              0.086 
_reflns.pdbx_netI_over_sigmaI        39.119 
_reflns.pdbx_redundancy              6.8 
_reflns.entry_id                     3ROZ 
_reflns.B_iso_Wilson_estimate        89.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   95.4 
_reflns_shell.Rmerge_I_obs           0.568 
_reflns_shell.pdbx_Rsym_value        0.568 
_reflns_shell.meanI_over_sigI_obs    2.777 
_reflns_shell.pdbx_redundancy        6.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3ROZ 
_refine.ls_d_res_high                            2.800 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    82.740 
_refine.ls_number_reflns_obs                     7494 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS; U VALUES: RESIDUAL ONLY' 
_refine.ls_R_factor_obs                          0.210 
_refine.ls_R_factor_R_work                       0.208 
_refine.ls_R_factor_R_free                       0.243 
_refine.ls_percent_reflns_R_free                 4.800 
_refine.ls_number_reflns_R_free                  360 
_refine.B_iso_mean                               151.936 
_refine.aniso_B[1][1]                            -6.850 
_refine.aniso_B[2][2]                            -6.850 
_refine.aniso_B[3][3]                            10.270 
_refine.aniso_B[1][2]                            -3.420 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.pdbx_overall_ESU_R_Free                  0.373 
_refine.overall_SU_ML                            0.328 
_refine.overall_SU_B                             39.558 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                297.89 
_refine.B_iso_min                                99.26 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2O8N' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1808 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1822 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       1872 0.014  0.022  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         1278 0.000  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2549 1.457  2.001  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      3140 4.007  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 232  7.151  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 75   40.338 24.667 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 301  17.655 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 6    10.253 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         278  0.073  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   2061 0.009  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     357  0.004  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1169 2.588  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         460  0.003  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1900 4.469  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            703  3.070  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           649  4.979  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               93.670 
_refine_ls_shell.number_reflns_R_work             594 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.310 
_refine_ls_shell.R_factor_R_free                  0.412 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             27 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                621 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3ROZ 
_struct.title                     'Crystal Structure of Mouse Apolipoprotein A-I Binding Protein in Complex with Nicotinamide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ROZ 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'ROSSMANN FOLD, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AIBP_MOUSE 
_struct_ref.pdbx_db_accession          Q8K4Z3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPT
VLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGF
SFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKK
YQLNLPSYPDTECVYRLQ
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3ROZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 259 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8K4Z3 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  282 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       258 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ROZ MSE A 1   ? UNP Q8K4Z3 ? ? 'expression tag' 0   1 
1 3ROZ HIS A 260 ? UNP Q8K4Z3 ? ? 'expression tag' 259 2 
1 3ROZ HIS A 261 ? UNP Q8K4Z3 ? ? 'expression tag' 260 3 
1 3ROZ HIS A 262 ? UNP Q8K4Z3 ? ? 'expression tag' 261 4 
1 3ROZ HIS A 263 ? UNP Q8K4Z3 ? ? 'expression tag' 262 5 
1 3ROZ HIS A 264 ? UNP Q8K4Z3 ? ? 'expression tag' 263 6 
1 3ROZ HIS A 265 ? UNP Q8K4Z3 ? ? 'expression tag' 264 7 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2770  ? 
1 MORE         -16   ? 
1 'SSA (A^2)'  19120 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z                 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 17_555 x-y+1/3,-y+2/3,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
-1.0000000000 0.0000000000 72.2351789297 0.0000000000 0.0000000000 -1.0000000000 79.8673333333 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 32  ? ASN A 45  ? SER A 31  ASN A 44  1 ? 14 
HELX_P HELX_P2 2 SER A 50  ? TYR A 70  ? SER A 49  TYR A 69  1 ? 21 
HELX_P HELX_P3 3 GLY A 89  ? GLY A 106 ? GLY A 88  GLY A 105 1 ? 18 
HELX_P HELX_P4 4 LYS A 119 ? LYS A 131 ? LYS A 118 LYS A 130 1 ? 13 
HELX_P HELX_P5 5 GLU A 143 ? TYR A 151 ? GLU A 142 TYR A 150 1 ? 9  
HELX_P HELX_P6 6 PRO A 170 ? SER A 179 ? PRO A 169 SER A 178 1 ? 10 
HELX_P HELX_P7 7 LYS A 216 ? PHE A 222 ? LYS A 215 PHE A 221 5 ? 7  
HELX_P HELX_P8 8 PRO A 235 ? TYR A 242 ? PRO A 234 TYR A 241 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A LEU 54  C ? ? ? 1_555 A MSE 55  N ? ? A LEU 53  A MSE 54  1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale2  covale both ? A MSE 55  C ? ? ? 1_555 A GLU 56  N ? ? A MSE 54  A GLU 55  1_555 ? ? ? ? ? ? ? 1.319 ? ? 
covale3  covale both ? A SER 74  C ? ? ? 1_555 A MSE 75  N ? ? A SER 73  A MSE 74  1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale4  covale both ? A MSE 75  C ? ? ? 1_555 A SER 76  N ? ? A MSE 74  A SER 75  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale5  covale both ? A LYS 131 C ? ? ? 1_555 A MSE 132 N ? ? A LYS 130 A MSE 131 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale6  covale both ? A MSE 132 C ? ? ? 1_555 A ASP 133 N ? ? A MSE 131 A ASP 132 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale7  covale both ? A GLU 139 C ? ? ? 1_555 A MSE 140 N ? ? A GLU 138 A MSE 139 1_555 ? ? ? ? ? ? ? 1.321 ? ? 
covale8  covale both ? A MSE 140 C ? ? ? 1_555 A PRO 141 N ? ? A MSE 139 A PRO 140 1_555 ? ? ? ? ? ? ? 1.344 ? ? 
covale9  covale both ? A PRO 144 C ? ? ? 1_555 A MSE 145 N ? ? A PRO 143 A MSE 144 1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale10 covale both ? A MSE 145 C ? ? ? 1_555 A MSE 146 N ? ? A MSE 144 A MSE 145 1_555 ? ? ? ? ? ? ? 1.318 ? ? 
covale11 covale both ? A MSE 146 C ? ? ? 1_555 A VAL 147 N ? ? A MSE 145 A VAL 146 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 MSE A 55  ? . . . . MSE A 54  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
2 MSE A 75  ? . . . . MSE A 74  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
3 MSE A 132 ? . . . . MSE A 131 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
4 MSE A 140 ? . . . . MSE A 139 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
5 MSE A 145 ? . . . . MSE A 144 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
6 MSE A 146 ? . . . . MSE A 145 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 78  A . ? SER 77  A PRO 79  A ? PRO 78  A 1 4.92 
2 GLU 169 A . ? GLU 168 A PRO 170 A ? PRO 169 A 1 2.02 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 136 ? LEU A 137 ? PHE A 135 LEU A 136 
A 2 GLN A 108 ? TYR A 112 ? GLN A 107 TYR A 111 
A 3 THR A 81  ? CYS A 86  ? THR A 80  CYS A 85  
A 4 VAL A 154 ? ALA A 157 ? VAL A 153 ALA A 156 
A 5 ILE A 185 ? ILE A 188 ? ILE A 184 ILE A 187 
A 6 LEU A 208 ? LEU A 212 ? LEU A 207 LEU A 211 
A 7 TYR A 228 ? GLY A 230 ? TYR A 227 GLY A 229 
A 8 VAL A 255 ? ARG A 257 ? VAL A 254 ARG A 256 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 137 ? O LEU A 136 N ILE A 111 ? N ILE A 110 
A 2 3 O THR A 110 ? O THR A 109 N VAL A 84  ? N VAL A 83  
A 3 4 N LEU A 83  ? N LEU A 82  O VAL A 155 ? O VAL A 154 
A 4 5 N ASP A 156 ? N ASP A 155 O ALA A 186 ? O ALA A 185 
A 5 6 N SER A 187 ? N SER A 186 O ILE A 210 ? O ILE A 209 
A 6 7 N SER A 211 ? N SER A 210 O TYR A 228 ? O TYR A 227 
A 7 8 N LEU A 229 ? N LEU A 228 O TYR A 256 ? O TYR A 255 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 265 ? 5 'BINDING SITE FOR RESIDUE SO4 A 265' 
AC2 Software A NCA 266 ? 6 'BINDING SITE FOR RESIDUE NCA A 266' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLY A 89  ? GLY A 88  . ? 1_555 ? 
2  AC1 5 ASN A 90  ? ASN A 89  . ? 1_555 ? 
3  AC1 5 ASN A 91  ? ASN A 90  . ? 1_555 ? 
4  AC1 5 GLY A 160 ? GLY A 159 . ? 1_555 ? 
5  AC1 5 SER A 162 ? SER A 161 . ? 1_555 ? 
6  AC2 6 ASP A 40  ? ASP A 39  . ? 1_555 ? 
7  AC2 6 LEU A 54  ? LEU A 53  . ? 1_555 ? 
8  AC2 6 MSE A 55  ? MSE A 54  . ? 1_555 ? 
9  AC2 6 ALA A 58  ? ALA A 57  . ? 1_555 ? 
10 AC2 6 ASP A 94  ? ASP A 93  . ? 1_555 ? 
11 AC2 6 THR A 213 ? THR A 212 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   3ROZ 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 44  ? ? -78.70  -78.17  
2  1 THR A 63  ? ? -53.88  -78.20  
3  1 ALA A 64  ? ? -23.46  -56.66  
4  1 LYS A 67  ? ? -71.75  -71.92  
5  1 ALA A 68  ? ? -23.51  -69.60  
6  1 GLN A 107 ? ? -119.36 69.68   
7  1 ILE A 157 ? ? -86.99  -71.18  
8  1 PHE A 160 ? ? -21.38  -57.62  
9  1 LYS A 163 ? ? -141.88 57.27   
10 1 VAL A 166 ? ? -66.12  99.78   
11 1 SER A 178 ? ? -68.47  2.97    
12 1 ASP A 188 ? ? 74.74   -52.61  
13 1 ASN A 199 ? ? -171.74 107.29  
14 1 THR A 212 ? ? 70.96   -71.14  
15 1 PHE A 232 ? ? -149.97 -3.70   
16 1 GLN A 242 ? ? -7.48   76.77   
17 1 ASP A 250 ? ? 37.94   -117.30 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 55  A MSE 54  ? MET SELENOMETHIONINE 
2 A MSE 75  A MSE 74  ? MET SELENOMETHIONINE 
3 A MSE 132 A MSE 131 ? MET SELENOMETHIONINE 
4 A MSE 140 A MSE 139 ? MET SELENOMETHIONINE 
5 A MSE 145 A MSE 144 ? MET SELENOMETHIONINE 
6 A MSE 146 A MSE 145 ? MET SELENOMETHIONINE 
# 
_diffrn_reflns.av_R_equivalents   0.086 
_diffrn_reflns.number             52928 
_diffrn_reflns.diffrn_id          1 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 14.1770 28.0160 27.4330 0.5728 0.0942 1.1825 0.1682  0.4910  0.1947 -1.5693 14.6302 -0.2663 -0.9906 0.7016  -3.4183 
0.7837 -0.9492 0.1655  -0.1953 -0.6980 -4.0826 -1.3601 0.0518  -0.7894 'X-RAY DIFFRACTION' 
2 ? refined 8.2110  21.2990 49.2920 0.7493 0.5919 0.3675 -0.0245 -0.0957 0.1083 2.2132  6.0560  0.9016  1.5263  -0.2720 -3.1086 
0.1385 -0.2919 0.1534  0.0649  -0.4471 -0.6348 0.3674  -0.2742 -0.1994 'X-RAY DIFFRACTION' 
3 ? refined 4.9790  18.3950 33.2340 1.0130 0.5742 0.2337 -0.0208 -0.0362 0.0382 0.6045  3.4296  1.4881  0.5580  0.2671  -1.3850 
0.0492 0.0177  -0.0670 0.2014  -0.3021 0.0699  -0.9882 0.3710  -0.0084 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 26  A 55  ? . . . . 'X-RAY DIFFRACTION' ? 
2 2 A 56  A 158 ? . . . . 'X-RAY DIFFRACTION' ? 
3 3 A 159 A 258 ? . . . . 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE 0   ? A MSE 1   
2  1 Y 1 A GLN 1   ? A GLN 2   
3  1 Y 1 A GLN 2   ? A GLN 3   
4  1 Y 1 A SER 3   ? A SER 4   
5  1 Y 1 A VAL 4   ? A VAL 5   
6  1 Y 1 A CYS 5   ? A CYS 6   
7  1 Y 1 A ARG 6   ? A ARG 7   
8  1 Y 1 A ALA 7   ? A ALA 8   
9  1 Y 1 A ARG 8   ? A ARG 9   
10 1 Y 1 A PRO 9   ? A PRO 10  
11 1 Y 1 A ILE 10  ? A ILE 11  
12 1 Y 1 A TRP 11  ? A TRP 12  
13 1 Y 1 A TRP 12  ? A TRP 13  
14 1 Y 1 A GLY 13  ? A GLY 14  
15 1 Y 1 A THR 14  ? A THR 15  
16 1 Y 1 A GLN 15  ? A GLN 16  
17 1 Y 1 A ARG 16  ? A ARG 17  
18 1 Y 1 A ARG 17  ? A ARG 18  
19 1 Y 1 A GLY 18  ? A GLY 19  
20 1 Y 1 A SER 19  ? A SER 20  
21 1 Y 1 A GLU 20  ? A GLU 21  
22 1 Y 1 A THR 21  ? A THR 22  
23 1 Y 1 A MSE 22  ? A MSE 23  
24 1 Y 1 A ALA 23  ? A ALA 24  
25 1 Y 1 A GLY 24  ? A GLY 25  
26 1 Y 1 A ALA 25  ? A ALA 26  
27 1 Y 1 A HIS 259 ? A HIS 260 
28 1 Y 1 A HIS 260 ? A HIS 261 
29 1 Y 1 A HIS 261 ? A HIS 262 
30 1 Y 1 A HIS 262 ? A HIS 263 
31 1 Y 1 A HIS 263 ? A HIS 264 
32 1 Y 1 A HIS 264 ? A HIS 265 
# 
_cell_measurement.reflns_used   52928 
_cell_measurement.entry_id      3ROZ 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
ILE N    N  N N 158 
ILE CA   C  N S 159 
ILE C    C  N N 160 
ILE O    O  N N 161 
ILE CB   C  N S 162 
ILE CG1  C  N N 163 
ILE CG2  C  N N 164 
ILE CD1  C  N N 165 
ILE OXT  O  N N 166 
ILE H    H  N N 167 
ILE H2   H  N N 168 
ILE HA   H  N N 169 
ILE HB   H  N N 170 
ILE HG12 H  N N 171 
ILE HG13 H  N N 172 
ILE HG21 H  N N 173 
ILE HG22 H  N N 174 
ILE HG23 H  N N 175 
ILE HD11 H  N N 176 
ILE HD12 H  N N 177 
ILE HD13 H  N N 178 
ILE HXT  H  N N 179 
LEU N    N  N N 180 
LEU CA   C  N S 181 
LEU C    C  N N 182 
LEU O    O  N N 183 
LEU CB   C  N N 184 
LEU CG   C  N N 185 
LEU CD1  C  N N 186 
LEU CD2  C  N N 187 
LEU OXT  O  N N 188 
LEU H    H  N N 189 
LEU H2   H  N N 190 
LEU HA   H  N N 191 
LEU HB2  H  N N 192 
LEU HB3  H  N N 193 
LEU HG   H  N N 194 
LEU HD11 H  N N 195 
LEU HD12 H  N N 196 
LEU HD13 H  N N 197 
LEU HD21 H  N N 198 
LEU HD22 H  N N 199 
LEU HD23 H  N N 200 
LEU HXT  H  N N 201 
LYS N    N  N N 202 
LYS CA   C  N S 203 
LYS C    C  N N 204 
LYS O    O  N N 205 
LYS CB   C  N N 206 
LYS CG   C  N N 207 
LYS CD   C  N N 208 
LYS CE   C  N N 209 
LYS NZ   N  N N 210 
LYS OXT  O  N N 211 
LYS H    H  N N 212 
LYS H2   H  N N 213 
LYS HA   H  N N 214 
LYS HB2  H  N N 215 
LYS HB3  H  N N 216 
LYS HG2  H  N N 217 
LYS HG3  H  N N 218 
LYS HD2  H  N N 219 
LYS HD3  H  N N 220 
LYS HE2  H  N N 221 
LYS HE3  H  N N 222 
LYS HZ1  H  N N 223 
LYS HZ2  H  N N 224 
LYS HZ3  H  N N 225 
LYS HXT  H  N N 226 
MSE N    N  N N 227 
MSE CA   C  N S 228 
MSE C    C  N N 229 
MSE O    O  N N 230 
MSE OXT  O  N N 231 
MSE CB   C  N N 232 
MSE CG   C  N N 233 
MSE SE   SE N N 234 
MSE CE   C  N N 235 
MSE H    H  N N 236 
MSE H2   H  N N 237 
MSE HA   H  N N 238 
MSE HXT  H  N N 239 
MSE HB2  H  N N 240 
MSE HB3  H  N N 241 
MSE HG2  H  N N 242 
MSE HG3  H  N N 243 
MSE HE1  H  N N 244 
MSE HE2  H  N N 245 
MSE HE3  H  N N 246 
NCA N1   N  Y N 247 
NCA C2   C  Y N 248 
NCA C3   C  Y N 249 
NCA C4   C  Y N 250 
NCA C5   C  Y N 251 
NCA C6   C  Y N 252 
NCA C7   C  N N 253 
NCA O7   O  N N 254 
NCA N7   N  N N 255 
NCA H2   H  N N 256 
NCA H4   H  N N 257 
NCA H5   H  N N 258 
NCA H6   H  N N 259 
NCA HN71 H  N N 260 
NCA HN72 H  N N 261 
PHE N    N  N N 262 
PHE CA   C  N S 263 
PHE C    C  N N 264 
PHE O    O  N N 265 
PHE CB   C  N N 266 
PHE CG   C  Y N 267 
PHE CD1  C  Y N 268 
PHE CD2  C  Y N 269 
PHE CE1  C  Y N 270 
PHE CE2  C  Y N 271 
PHE CZ   C  Y N 272 
PHE OXT  O  N N 273 
PHE H    H  N N 274 
PHE H2   H  N N 275 
PHE HA   H  N N 276 
PHE HB2  H  N N 277 
PHE HB3  H  N N 278 
PHE HD1  H  N N 279 
PHE HD2  H  N N 280 
PHE HE1  H  N N 281 
PHE HE2  H  N N 282 
PHE HZ   H  N N 283 
PHE HXT  H  N N 284 
PRO N    N  N N 285 
PRO CA   C  N S 286 
PRO C    C  N N 287 
PRO O    O  N N 288 
PRO CB   C  N N 289 
PRO CG   C  N N 290 
PRO CD   C  N N 291 
PRO OXT  O  N N 292 
PRO H    H  N N 293 
PRO HA   H  N N 294 
PRO HB2  H  N N 295 
PRO HB3  H  N N 296 
PRO HG2  H  N N 297 
PRO HG3  H  N N 298 
PRO HD2  H  N N 299 
PRO HD3  H  N N 300 
PRO HXT  H  N N 301 
SER N    N  N N 302 
SER CA   C  N S 303 
SER C    C  N N 304 
SER O    O  N N 305 
SER CB   C  N N 306 
SER OG   O  N N 307 
SER OXT  O  N N 308 
SER H    H  N N 309 
SER H2   H  N N 310 
SER HA   H  N N 311 
SER HB2  H  N N 312 
SER HB3  H  N N 313 
SER HG   H  N N 314 
SER HXT  H  N N 315 
SO4 S    S  N N 316 
SO4 O1   O  N N 317 
SO4 O2   O  N N 318 
SO4 O3   O  N N 319 
SO4 O4   O  N N 320 
THR N    N  N N 321 
THR CA   C  N S 322 
THR C    C  N N 323 
THR O    O  N N 324 
THR CB   C  N R 325 
THR OG1  O  N N 326 
THR CG2  C  N N 327 
THR OXT  O  N N 328 
THR H    H  N N 329 
THR H2   H  N N 330 
THR HA   H  N N 331 
THR HB   H  N N 332 
THR HG1  H  N N 333 
THR HG21 H  N N 334 
THR HG22 H  N N 335 
THR HG23 H  N N 336 
THR HXT  H  N N 337 
TRP N    N  N N 338 
TRP CA   C  N S 339 
TRP C    C  N N 340 
TRP O    O  N N 341 
TRP CB   C  N N 342 
TRP CG   C  Y N 343 
TRP CD1  C  Y N 344 
TRP CD2  C  Y N 345 
TRP NE1  N  Y N 346 
TRP CE2  C  Y N 347 
TRP CE3  C  Y N 348 
TRP CZ2  C  Y N 349 
TRP CZ3  C  Y N 350 
TRP CH2  C  Y N 351 
TRP OXT  O  N N 352 
TRP H    H  N N 353 
TRP H2   H  N N 354 
TRP HA   H  N N 355 
TRP HB2  H  N N 356 
TRP HB3  H  N N 357 
TRP HD1  H  N N 358 
TRP HE1  H  N N 359 
TRP HE3  H  N N 360 
TRP HZ2  H  N N 361 
TRP HZ3  H  N N 362 
TRP HH2  H  N N 363 
TRP HXT  H  N N 364 
TYR N    N  N N 365 
TYR CA   C  N S 366 
TYR C    C  N N 367 
TYR O    O  N N 368 
TYR CB   C  N N 369 
TYR CG   C  Y N 370 
TYR CD1  C  Y N 371 
TYR CD2  C  Y N 372 
TYR CE1  C  Y N 373 
TYR CE2  C  Y N 374 
TYR CZ   C  Y N 375 
TYR OH   O  N N 376 
TYR OXT  O  N N 377 
TYR H    H  N N 378 
TYR H2   H  N N 379 
TYR HA   H  N N 380 
TYR HB2  H  N N 381 
TYR HB3  H  N N 382 
TYR HD1  H  N N 383 
TYR HD2  H  N N 384 
TYR HE1  H  N N 385 
TYR HE2  H  N N 386 
TYR HH   H  N N 387 
TYR HXT  H  N N 388 
VAL N    N  N N 389 
VAL CA   C  N S 390 
VAL C    C  N N 391 
VAL O    O  N N 392 
VAL CB   C  N N 393 
VAL CG1  C  N N 394 
VAL CG2  C  N N 395 
VAL OXT  O  N N 396 
VAL H    H  N N 397 
VAL H2   H  N N 398 
VAL HA   H  N N 399 
VAL HB   H  N N 400 
VAL HG11 H  N N 401 
VAL HG12 H  N N 402 
VAL HG13 H  N N 403 
VAL HG21 H  N N 404 
VAL HG22 H  N N 405 
VAL HG23 H  N N 406 
VAL HXT  H  N N 407 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MSE N   CA   sing N N 216 
MSE N   H    sing N N 217 
MSE N   H2   sing N N 218 
MSE CA  C    sing N N 219 
MSE CA  CB   sing N N 220 
MSE CA  HA   sing N N 221 
MSE C   O    doub N N 222 
MSE C   OXT  sing N N 223 
MSE OXT HXT  sing N N 224 
MSE CB  CG   sing N N 225 
MSE CB  HB2  sing N N 226 
MSE CB  HB3  sing N N 227 
MSE CG  SE   sing N N 228 
MSE CG  HG2  sing N N 229 
MSE CG  HG3  sing N N 230 
MSE SE  CE   sing N N 231 
MSE CE  HE1  sing N N 232 
MSE CE  HE2  sing N N 233 
MSE CE  HE3  sing N N 234 
NCA N1  C2   doub Y N 235 
NCA N1  C6   sing Y N 236 
NCA C2  C3   sing Y N 237 
NCA C2  H2   sing N N 238 
NCA C3  C4   doub Y N 239 
NCA C3  C7   sing N N 240 
NCA C4  C5   sing Y N 241 
NCA C4  H4   sing N N 242 
NCA C5  C6   doub Y N 243 
NCA C5  H5   sing N N 244 
NCA C6  H6   sing N N 245 
NCA C7  O7   doub N N 246 
NCA C7  N7   sing N N 247 
NCA N7  HN71 sing N N 248 
NCA N7  HN72 sing N N 249 
PHE N   CA   sing N N 250 
PHE N   H    sing N N 251 
PHE N   H2   sing N N 252 
PHE CA  C    sing N N 253 
PHE CA  CB   sing N N 254 
PHE CA  HA   sing N N 255 
PHE C   O    doub N N 256 
PHE C   OXT  sing N N 257 
PHE CB  CG   sing N N 258 
PHE CB  HB2  sing N N 259 
PHE CB  HB3  sing N N 260 
PHE CG  CD1  doub Y N 261 
PHE CG  CD2  sing Y N 262 
PHE CD1 CE1  sing Y N 263 
PHE CD1 HD1  sing N N 264 
PHE CD2 CE2  doub Y N 265 
PHE CD2 HD2  sing N N 266 
PHE CE1 CZ   doub Y N 267 
PHE CE1 HE1  sing N N 268 
PHE CE2 CZ   sing Y N 269 
PHE CE2 HE2  sing N N 270 
PHE CZ  HZ   sing N N 271 
PHE OXT HXT  sing N N 272 
PRO N   CA   sing N N 273 
PRO N   CD   sing N N 274 
PRO N   H    sing N N 275 
PRO CA  C    sing N N 276 
PRO CA  CB   sing N N 277 
PRO CA  HA   sing N N 278 
PRO C   O    doub N N 279 
PRO C   OXT  sing N N 280 
PRO CB  CG   sing N N 281 
PRO CB  HB2  sing N N 282 
PRO CB  HB3  sing N N 283 
PRO CG  CD   sing N N 284 
PRO CG  HG2  sing N N 285 
PRO CG  HG3  sing N N 286 
PRO CD  HD2  sing N N 287 
PRO CD  HD3  sing N N 288 
PRO OXT HXT  sing N N 289 
SER N   CA   sing N N 290 
SER N   H    sing N N 291 
SER N   H2   sing N N 292 
SER CA  C    sing N N 293 
SER CA  CB   sing N N 294 
SER CA  HA   sing N N 295 
SER C   O    doub N N 296 
SER C   OXT  sing N N 297 
SER CB  OG   sing N N 298 
SER CB  HB2  sing N N 299 
SER CB  HB3  sing N N 300 
SER OG  HG   sing N N 301 
SER OXT HXT  sing N N 302 
SO4 S   O1   doub N N 303 
SO4 S   O2   doub N N 304 
SO4 S   O3   sing N N 305 
SO4 S   O4   sing N N 306 
THR N   CA   sing N N 307 
THR N   H    sing N N 308 
THR N   H2   sing N N 309 
THR CA  C    sing N N 310 
THR CA  CB   sing N N 311 
THR CA  HA   sing N N 312 
THR C   O    doub N N 313 
THR C   OXT  sing N N 314 
THR CB  OG1  sing N N 315 
THR CB  CG2  sing N N 316 
THR CB  HB   sing N N 317 
THR OG1 HG1  sing N N 318 
THR CG2 HG21 sing N N 319 
THR CG2 HG22 sing N N 320 
THR CG2 HG23 sing N N 321 
THR OXT HXT  sing N N 322 
TRP N   CA   sing N N 323 
TRP N   H    sing N N 324 
TRP N   H2   sing N N 325 
TRP CA  C    sing N N 326 
TRP CA  CB   sing N N 327 
TRP CA  HA   sing N N 328 
TRP C   O    doub N N 329 
TRP C   OXT  sing N N 330 
TRP CB  CG   sing N N 331 
TRP CB  HB2  sing N N 332 
TRP CB  HB3  sing N N 333 
TRP CG  CD1  doub Y N 334 
TRP CG  CD2  sing Y N 335 
TRP CD1 NE1  sing Y N 336 
TRP CD1 HD1  sing N N 337 
TRP CD2 CE2  doub Y N 338 
TRP CD2 CE3  sing Y N 339 
TRP NE1 CE2  sing Y N 340 
TRP NE1 HE1  sing N N 341 
TRP CE2 CZ2  sing Y N 342 
TRP CE3 CZ3  doub Y N 343 
TRP CE3 HE3  sing N N 344 
TRP CZ2 CH2  doub Y N 345 
TRP CZ2 HZ2  sing N N 346 
TRP CZ3 CH2  sing Y N 347 
TRP CZ3 HZ3  sing N N 348 
TRP CH2 HH2  sing N N 349 
TRP OXT HXT  sing N N 350 
TYR N   CA   sing N N 351 
TYR N   H    sing N N 352 
TYR N   H2   sing N N 353 
TYR CA  C    sing N N 354 
TYR CA  CB   sing N N 355 
TYR CA  HA   sing N N 356 
TYR C   O    doub N N 357 
TYR C   OXT  sing N N 358 
TYR CB  CG   sing N N 359 
TYR CB  HB2  sing N N 360 
TYR CB  HB3  sing N N 361 
TYR CG  CD1  doub Y N 362 
TYR CG  CD2  sing Y N 363 
TYR CD1 CE1  sing Y N 364 
TYR CD1 HD1  sing N N 365 
TYR CD2 CE2  doub Y N 366 
TYR CD2 HD2  sing N N 367 
TYR CE1 CZ   doub Y N 368 
TYR CE1 HE1  sing N N 369 
TYR CE2 CZ   sing Y N 370 
TYR CE2 HE2  sing N N 371 
TYR CZ  OH   sing N N 372 
TYR OH  HH   sing N N 373 
TYR OXT HXT  sing N N 374 
VAL N   CA   sing N N 375 
VAL N   H    sing N N 376 
VAL N   H2   sing N N 377 
VAL CA  C    sing N N 378 
VAL CA  CB   sing N N 379 
VAL CA  HA   sing N N 380 
VAL C   O    doub N N 381 
VAL C   OXT  sing N N 382 
VAL CB  CG1  sing N N 383 
VAL CB  CG2  sing N N 384 
VAL CB  HB   sing N N 385 
VAL CG1 HG11 sing N N 386 
VAL CG1 HG12 sing N N 387 
VAL CG1 HG13 sing N N 388 
VAL CG2 HG21 sing N N 389 
VAL CG2 HG22 sing N N 390 
VAL CG2 HG23 sing N N 391 
VAL OXT HXT  sing N N 392 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   2O8N 
_pdbx_initial_refinement_model.details          'PDB ENTRY 2O8N' 
# 
_atom_sites.entry_id                    3ROZ 
_atom_sites.fract_transf_matrix[1][1]   0.007993 
_atom_sites.fract_transf_matrix[1][2]   0.004615 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009229 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008347 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_