data_3RWQ # _entry.id 3RWQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3RWQ RCSB RCSB065471 WWPDB D_1000065471 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3RWP 'Same protein complexed with an inhibitor from the same chemical series.' unspecified PDB 3SC1 'Novel Isoquinolone PDK1 Inhibitors Discovered through Fragment-Based Lead Discovery' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3RWQ _pdbx_database_status.recvd_initial_deposition_date 2011-05-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kazmirski, S.' 1 'Kohls, D.' 2 # _citation.id primary _citation.title 'Discovery of Novel, Potent, and Selective Inhibitors of 3-Phosphoinositide-Dependent Kinase (PDK1).' _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 54 _citation.page_first 8490 _citation.page_last 8500 _citation.year 2011 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22040023 _citation.pdbx_database_id_DOI 10.1021/jm201019k # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Murphy, S.T.' 1 primary 'Alton, G.' 2 primary 'Bailey, S.' 3 primary 'Baxi, S.M.' 4 primary 'Burke, B.J.' 5 primary 'Chappie, T.A.' 6 primary 'Ermolieff, J.' 7 primary 'Ferre, R.' 8 primary 'Greasley, S.' 9 primary 'Hickey, M.' 10 primary 'Humphrey, J.' 11 primary 'Kablaoui, N.' 12 primary 'Kath, J.' 13 primary 'Kazmirski, S.' 14 primary 'Kraus, M.' 15 primary 'Kupchinsky, S.' 16 primary 'Li, J.' 17 primary 'Lingardo, L.' 18 primary 'Marx, M.A.' 19 primary 'Richter, D.' 20 primary 'Tanis, S.P.' 21 primary 'Tran, K.' 22 primary 'Vernier, W.' 23 primary 'Xie, Z.' 24 primary 'Yin, M.J.' 25 primary 'Yu, X.H.' 26 # _cell.entry_id 3RWQ _cell.length_a 123.213 _cell.length_b 123.213 _cell.length_c 47.424 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3RWQ _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-phosphoinositide-dependent protein kinase 1' 35555.738 1 2.7.11.1 ? 'Kinase domain, residues 51-359' ? 2 non-polymer syn '[4-amino-7-(propan-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl](6-{[2-(pyridin-3-yl)ethyl]amino}pyrazin-2-yl)methanone' 402.452 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 7 ? ? ? ? 5 water nat water 18.015 71 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hPDK1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GAMDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVT RERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKP ENILLNEDMHIQITDFGTAKVLSPESKQARAN(SEP)FVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRA GNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVT RERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKP ENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEY LIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ASP n 1 5 GLY n 1 6 THR n 1 7 ALA n 1 8 ALA n 1 9 GLU n 1 10 PRO n 1 11 ARG n 1 12 PRO n 1 13 GLY n 1 14 ALA n 1 15 GLY n 1 16 SER n 1 17 LEU n 1 18 GLN n 1 19 HIS n 1 20 ALA n 1 21 GLN n 1 22 PRO n 1 23 PRO n 1 24 PRO n 1 25 GLN n 1 26 PRO n 1 27 ARG n 1 28 LYS n 1 29 LYS n 1 30 ARG n 1 31 PRO n 1 32 GLU n 1 33 ASP n 1 34 PHE n 1 35 LYS n 1 36 PHE n 1 37 GLY n 1 38 LYS n 1 39 ILE n 1 40 LEU n 1 41 GLY n 1 42 GLU n 1 43 GLY n 1 44 SER n 1 45 PHE n 1 46 SER n 1 47 THR n 1 48 VAL n 1 49 VAL n 1 50 LEU n 1 51 ALA n 1 52 ARG n 1 53 GLU n 1 54 LEU n 1 55 ALA n 1 56 THR n 1 57 SER n 1 58 ARG n 1 59 GLU n 1 60 TYR n 1 61 ALA n 1 62 ILE n 1 63 LYS n 1 64 ILE n 1 65 LEU n 1 66 GLU n 1 67 LYS n 1 68 ARG n 1 69 HIS n 1 70 ILE n 1 71 ILE n 1 72 LYS n 1 73 GLU n 1 74 ASN n 1 75 LYS n 1 76 VAL n 1 77 PRO n 1 78 TYR n 1 79 VAL n 1 80 THR n 1 81 ARG n 1 82 GLU n 1 83 ARG n 1 84 ASP n 1 85 VAL n 1 86 MET n 1 87 SER n 1 88 ARG n 1 89 LEU n 1 90 ASP n 1 91 HIS n 1 92 PRO n 1 93 PHE n 1 94 PHE n 1 95 VAL n 1 96 LYS n 1 97 LEU n 1 98 TYR n 1 99 PHE n 1 100 THR n 1 101 PHE n 1 102 GLN n 1 103 ASP n 1 104 ASP n 1 105 GLU n 1 106 LYS n 1 107 LEU n 1 108 TYR n 1 109 PHE n 1 110 GLY n 1 111 LEU n 1 112 SER n 1 113 TYR n 1 114 ALA n 1 115 LYS n 1 116 ASN n 1 117 GLY n 1 118 GLU n 1 119 LEU n 1 120 LEU n 1 121 LYS n 1 122 TYR n 1 123 ILE n 1 124 ARG n 1 125 LYS n 1 126 ILE n 1 127 GLY n 1 128 SER n 1 129 PHE n 1 130 ASP n 1 131 GLU n 1 132 THR n 1 133 CYS n 1 134 THR n 1 135 ARG n 1 136 PHE n 1 137 TYR n 1 138 THR n 1 139 ALA n 1 140 GLU n 1 141 ILE n 1 142 VAL n 1 143 SER n 1 144 ALA n 1 145 LEU n 1 146 GLU n 1 147 TYR n 1 148 LEU n 1 149 HIS n 1 150 GLY n 1 151 LYS n 1 152 GLY n 1 153 ILE n 1 154 ILE n 1 155 HIS n 1 156 ARG n 1 157 ASP n 1 158 LEU n 1 159 LYS n 1 160 PRO n 1 161 GLU n 1 162 ASN n 1 163 ILE n 1 164 LEU n 1 165 LEU n 1 166 ASN n 1 167 GLU n 1 168 ASP n 1 169 MET n 1 170 HIS n 1 171 ILE n 1 172 GLN n 1 173 ILE n 1 174 THR n 1 175 ASP n 1 176 PHE n 1 177 GLY n 1 178 THR n 1 179 ALA n 1 180 LYS n 1 181 VAL n 1 182 LEU n 1 183 SER n 1 184 PRO n 1 185 GLU n 1 186 SER n 1 187 LYS n 1 188 GLN n 1 189 ALA n 1 190 ARG n 1 191 ALA n 1 192 ASN n 1 193 SEP n 1 194 PHE n 1 195 VAL n 1 196 GLY n 1 197 THR n 1 198 ALA n 1 199 GLN n 1 200 TYR n 1 201 VAL n 1 202 SER n 1 203 PRO n 1 204 GLU n 1 205 LEU n 1 206 LEU n 1 207 THR n 1 208 GLU n 1 209 LYS n 1 210 SER n 1 211 ALA n 1 212 CYS n 1 213 LYS n 1 214 SER n 1 215 SER n 1 216 ASP n 1 217 LEU n 1 218 TRP n 1 219 ALA n 1 220 LEU n 1 221 GLY n 1 222 CYS n 1 223 ILE n 1 224 ILE n 1 225 TYR n 1 226 GLN n 1 227 LEU n 1 228 VAL n 1 229 ALA n 1 230 GLY n 1 231 LEU n 1 232 PRO n 1 233 PRO n 1 234 PHE n 1 235 ARG n 1 236 ALA n 1 237 GLY n 1 238 ASN n 1 239 GLU n 1 240 TYR n 1 241 LEU n 1 242 ILE n 1 243 PHE n 1 244 GLN n 1 245 LYS n 1 246 ILE n 1 247 ILE n 1 248 LYS n 1 249 LEU n 1 250 GLU n 1 251 TYR n 1 252 ASP n 1 253 PHE n 1 254 PRO n 1 255 GLU n 1 256 LYS n 1 257 PHE n 1 258 PHE n 1 259 PRO n 1 260 LYS n 1 261 ALA n 1 262 ARG n 1 263 ASP n 1 264 LEU n 1 265 VAL n 1 266 GLU n 1 267 LYS n 1 268 LEU n 1 269 LEU n 1 270 VAL n 1 271 LEU n 1 272 ASP n 1 273 ALA n 1 274 THR n 1 275 LYS n 1 276 ARG n 1 277 LEU n 1 278 GLY n 1 279 CYS n 1 280 GLU n 1 281 GLU n 1 282 MET n 1 283 GLU n 1 284 GLY n 1 285 TYR n 1 286 GLY n 1 287 PRO n 1 288 LEU n 1 289 LYS n 1 290 ALA n 1 291 HIS n 1 292 PRO n 1 293 PHE n 1 294 PHE n 1 295 GLU n 1 296 SER n 1 297 VAL n 1 298 THR n 1 299 TRP n 1 300 GLU n 1 301 ASN n 1 302 LEU n 1 303 HIS n 1 304 GLN n 1 305 GLN n 1 306 THR n 1 307 PRO n 1 308 PRO n 1 309 LYS n 1 310 LEU n 1 311 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PDPK1, PDK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PDPK1_HUMAN _struct_ref.pdbx_db_accession O15530 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRE RDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPEN ILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLI FQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT ; _struct_ref.pdbx_align_begin 51 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3RWQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 311 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15530 _struct_ref_seq.db_align_beg 51 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 51 _struct_ref_seq.pdbx_auth_seq_align_end 359 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3RWQ GLY A 1 ? UNP O15530 ? ? 'EXPRESSION TAG' 49 1 1 3RWQ ALA A 2 ? UNP O15530 ? ? 'EXPRESSION TAG' 50 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 3RW non-polymer . '[4-amino-7-(propan-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl](6-{[2-(pyridin-3-yl)ethyl]amino}pyrazin-2-yl)methanone' ? 'C21 H22 N8 O' 402.452 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3RWQ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.92 _exptl_crystal.density_percent_sol 57.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details 'Ammonium Sulfate, pH 7.0, VAPOR DIFFUSION, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 2006-11-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Mirrors _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.54 # _reflns.entry_id 3RWQ _reflns.observed_criterion_sigma_I 1 _reflns.observed_criterion_sigma_F 1 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.55 _reflns.number_obs 13175 _reflns.number_all 13179 _reflns.percent_possible_obs 95.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.141 _reflns.pdbx_netI_over_sigmaI 13.69 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.99 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.55 _reflns_shell.d_res_low 2.64 _reflns_shell.percent_possible_all 95.6 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.459 _reflns_shell.meanI_over_sigI_obs 2.56 _reflns_shell.pdbx_redundancy 3.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1306 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3RWQ _refine.ls_number_reflns_obs 12514 _refine.ls_number_reflns_all 12514 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50 _refine.ls_d_res_high 2.55 _refine.ls_percent_reflns_obs 95.87 _refine.ls_R_factor_obs 0.19633 _refine.ls_R_factor_all 0.19633 _refine.ls_R_factor_R_work 0.19332 _refine.ls_R_factor_R_free 0.25550 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 659 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.934 _refine.correlation_coeff_Fo_to_Fc_free 0.881 _refine.B_iso_mean 42.118 _refine.aniso_B[1][1] 0.80 _refine.aniso_B[2][2] 0.80 _refine.aniso_B[3][3] -1.20 _refine.aniso_B[1][2] 0.40 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.299 _refine.overall_SU_ML 0.202 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 9.073 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2313 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 83 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 2467 _refine_hist.d_res_high 2.55 _refine_hist.d_res_low 50 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.014 0.022 ? 2446 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.553 2.011 ? 3302 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.366 5.000 ? 282 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 34.615 23.670 ? 109 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 17.832 15.035 ? 430 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 25.961 15.000 ? 14 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.105 0.200 ? 348 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.005 0.020 ? 1800 ? 'X-RAY DIFFRACTION' r_nbd_refined 0.211 0.200 ? 1076 ? 'X-RAY DIFFRACTION' r_nbtor_refined 0.308 0.200 ? 1612 ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined 0.189 0.200 ? 101 ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined 0.260 0.200 ? 35 ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined 0.275 0.200 ? 7 ? 'X-RAY DIFFRACTION' r_mcbond_it 0.884 1.500 ? 1475 ? 'X-RAY DIFFRACTION' r_mcangle_it 1.475 2.000 ? 2294 ? 'X-RAY DIFFRACTION' r_scbond_it 1.963 3.000 ? 1123 ? 'X-RAY DIFFRACTION' r_scangle_it 2.996 4.500 ? 1008 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.551 _refine_ls_shell.d_res_low 2.617 _refine_ls_shell.number_reflns_R_work 908 _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.percent_reflns_obs 95.95 _refine_ls_shell.R_factor_R_free 0.341 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 63 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3RWQ _struct.title 'Discovery of a Novel, Potent and Selective Inhibitor of 3-Phosphoinositide Dependent Kinase (PDK1)' _struct.pdbx_descriptor '3-phosphoinositide-dependent protein kinase 1 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3RWQ _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text 'Kinase domain, Transferase, Phosphoserine: SEP, TRANSFERASE-TRANSFERASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 4 ? H N N 4 ? I N N 4 ? J N N 4 ? K N N 4 ? L N N 4 ? M N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 30 ? GLU A 32 ? ARG A 78 GLU A 80 5 ? 3 HELX_P HELX_P2 2 LYS A 67 ? GLU A 73 ? LYS A 115 GLU A 121 1 ? 7 HELX_P HELX_P3 3 LYS A 75 ? LEU A 89 ? LYS A 123 LEU A 137 1 ? 15 HELX_P HELX_P4 4 GLU A 118 ? GLY A 127 ? GLU A 166 GLY A 175 1 ? 10 HELX_P HELX_P5 5 ASP A 130 ? LYS A 151 ? ASP A 178 LYS A 199 1 ? 22 HELX_P HELX_P6 6 THR A 197 ? VAL A 201 ? THR A 245 VAL A 249 5 ? 5 HELX_P HELX_P7 7 SER A 202 ? GLU A 208 ? SER A 250 GLU A 256 1 ? 7 HELX_P HELX_P8 8 CYS A 212 ? GLY A 230 ? CYS A 260 GLY A 278 1 ? 19 HELX_P HELX_P9 9 ASN A 238 ? LEU A 249 ? ASN A 286 LEU A 297 1 ? 12 HELX_P HELX_P10 10 PHE A 258 ? LYS A 267 ? PHE A 306 LYS A 315 1 ? 10 HELX_P HELX_P11 11 ASP A 272 ? ARG A 276 ? ASP A 320 ARG A 324 5 ? 5 HELX_P HELX_P12 12 CYS A 279 ? GLU A 283 ? CYS A 327 GLU A 331 5 ? 5 HELX_P HELX_P13 13 GLY A 284 ? ALA A 290 ? GLY A 332 ALA A 338 1 ? 7 HELX_P HELX_P14 14 HIS A 291 ? GLU A 295 ? HIS A 339 GLU A 343 5 ? 5 HELX_P HELX_P15 15 ASN A 301 ? GLN A 305 ? ASN A 349 GLN A 353 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ASN 192 C ? ? ? 1_555 A SEP 193 N ? ? A ASN 240 A SEP 241 1_555 ? ? ? ? ? ? ? 1.334 ? covale2 covale ? ? A SEP 193 C ? ? ? 1_555 A PHE 194 N ? ? A SEP 241 A PHE 242 1_555 ? ? ? ? ? ? ? 1.332 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 310 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 358 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 THR _struct_mon_prot_cis.pdbx_label_seq_id_2 311 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 THR _struct_mon_prot_cis.pdbx_auth_seq_id_2 359 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -15.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 34 ? GLU A 42 ? PHE A 82 GLU A 90 A 2 SER A 46 ? GLU A 53 ? SER A 94 GLU A 101 A 3 GLU A 59 ? GLU A 66 ? GLU A 107 GLU A 114 A 4 LYS A 106 ? SER A 112 ? LYS A 154 SER A 160 A 5 LEU A 97 ? GLN A 102 ? LEU A 145 GLN A 150 B 1 ILE A 153 ? ILE A 154 ? ILE A 201 ILE A 202 B 2 LYS A 180 ? VAL A 181 ? LYS A 228 VAL A 229 C 1 ILE A 163 ? LEU A 165 ? ILE A 211 LEU A 213 C 2 ILE A 171 ? ILE A 173 ? ILE A 219 ILE A 221 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 37 ? N GLY A 85 O LEU A 50 ? O LEU A 98 A 2 3 N THR A 47 ? N THR A 95 O ILE A 64 ? O ILE A 112 A 3 4 N LEU A 65 ? N LEU A 113 O LEU A 107 ? O LEU A 155 A 4 5 O TYR A 108 ? O TYR A 156 N PHE A 101 ? N PHE A 149 B 1 2 N ILE A 154 ? N ILE A 202 O LYS A 180 ? O LYS A 228 C 1 2 N LEU A 164 ? N LEU A 212 O GLN A 172 ? O GLN A 220 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE 3RW A 1' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 9001' AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 9002' AC4 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL A 9003' AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 9004' AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 9005' AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 9006' AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 9007' AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 9008' BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 9009' BC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 9010' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 LEU A 40 ? LEU A 88 . ? 1_555 ? 2 AC1 19 GLY A 41 ? GLY A 89 . ? 1_555 ? 3 AC1 19 GLU A 42 ? GLU A 90 . ? 1_555 ? 4 AC1 19 GLY A 43 ? GLY A 91 . ? 1_555 ? 5 AC1 19 SER A 46 ? SER A 94 . ? 1_555 ? 6 AC1 19 VAL A 48 ? VAL A 96 . ? 1_555 ? 7 AC1 19 ALA A 61 ? ALA A 109 . ? 1_555 ? 8 AC1 19 LYS A 63 ? LYS A 111 . ? 1_555 ? 9 AC1 19 LEU A 111 ? LEU A 159 . ? 1_555 ? 10 AC1 19 SER A 112 ? SER A 160 . ? 1_555 ? 11 AC1 19 TYR A 113 ? TYR A 161 . ? 1_555 ? 12 AC1 19 ALA A 114 ? ALA A 162 . ? 1_555 ? 13 AC1 19 GLU A 118 ? GLU A 166 . ? 1_555 ? 14 AC1 19 GLU A 161 ? GLU A 209 . ? 1_555 ? 15 AC1 19 LEU A 164 ? LEU A 212 . ? 1_555 ? 16 AC1 19 THR A 174 ? THR A 222 . ? 1_555 ? 17 AC1 19 ASP A 175 ? ASP A 223 . ? 1_555 ? 18 AC1 19 HOH M . ? HOH A 380 . ? 1_555 ? 19 AC1 19 SO4 K . ? SO4 A 9009 . ? 1_555 ? 20 AC2 4 LYS A 35 ? LYS A 83 . ? 1_555 ? 21 AC2 4 LEU A 50 ? LEU A 98 . ? 1_555 ? 22 AC2 4 ARG A 52 ? ARG A 100 . ? 1_555 ? 23 AC2 4 GLU A 59 ? GLU A 107 . ? 1_555 ? 24 AC3 8 ARG A 58 ? ARG A 106 . ? 1_555 ? 25 AC3 8 GLU A 59 ? GLU A 107 . ? 1_555 ? 26 AC3 8 TYR A 98 ? TYR A 146 . ? 1_555 ? 27 AC3 8 SER A 112 ? SER A 160 . ? 1_555 ? 28 AC3 8 TYR A 113 ? TYR A 161 . ? 1_555 ? 29 AC3 8 HOH M . ? HOH A 383 . ? 1_555 ? 30 AC3 8 SO4 F . ? SO4 A 9004 . ? 1_555 ? 31 AC3 8 SO4 H . ? SO4 A 9006 . ? 1_555 ? 32 AC4 9 ALA A 55 ? ALA A 103 . ? 6_554 ? 33 AC4 9 THR A 56 ? THR A 104 . ? 6_554 ? 34 AC4 9 SER A 57 ? SER A 105 . ? 6_554 ? 35 AC4 9 HIS A 91 ? HIS A 139 . ? 1_555 ? 36 AC4 9 TRP A 299 ? TRP A 347 . ? 1_555 ? 37 AC4 9 GLU A 300 ? GLU A 348 . ? 1_555 ? 38 AC4 9 ASN A 301 ? ASN A 349 . ? 1_555 ? 39 AC4 9 LEU A 302 ? LEU A 350 . ? 1_555 ? 40 AC4 9 HIS A 303 ? HIS A 351 . ? 1_555 ? 41 AC5 4 ARG A 58 ? ARG A 106 . ? 1_555 ? 42 AC5 4 PRO A 92 ? PRO A 140 . ? 6_554 ? 43 AC5 4 HIS A 303 ? HIS A 351 . ? 6_554 ? 44 AC5 4 GOL D . ? GOL A 9002 . ? 1_555 ? 45 AC6 4 PHE A 34 ? PHE A 82 . ? 1_555 ? 46 AC6 4 LYS A 35 ? LYS A 83 . ? 1_555 ? 47 AC6 4 PHE A 36 ? PHE A 84 . ? 1_555 ? 48 AC6 4 GLY A 286 ? GLY A 334 . ? 1_554 ? 49 AC7 5 ARG A 58 ? ARG A 106 . ? 1_555 ? 50 AC7 5 GLU A 59 ? GLU A 107 . ? 1_555 ? 51 AC7 5 HIS A 303 ? HIS A 351 . ? 6_554 ? 52 AC7 5 GLN A 304 ? GLN A 352 . ? 6_554 ? 53 AC7 5 GOL D . ? GOL A 9002 . ? 1_555 ? 54 AC8 3 LYS A 106 ? LYS A 154 . ? 1_556 ? 55 AC8 3 TYR A 108 ? TYR A 156 . ? 1_556 ? 56 AC8 3 GLU A 283 ? GLU A 331 . ? 1_555 ? 57 AC9 4 PRO A 26 ? PRO A 74 . ? 6_554 ? 58 AC9 4 ARG A 27 ? ARG A 75 . ? 6_554 ? 59 AC9 4 ARG A 88 ? ARG A 136 . ? 1_555 ? 60 AC9 4 LYS A 151 ? LYS A 199 . ? 1_555 ? 61 BC1 6 3RW B . ? 3RW A 1 . ? 1_555 ? 62 BC1 6 HOH M . ? HOH A 34 . ? 1_555 ? 63 BC1 6 HOH M . ? HOH A 39 . ? 1_555 ? 64 BC1 6 HOH M . ? HOH A 45 . ? 1_555 ? 65 BC1 6 GLY A 43 ? GLY A 91 . ? 1_555 ? 66 BC1 6 SER A 44 ? SER A 92 . ? 1_555 ? 67 BC2 5 LYS A 28 ? LYS A 76 . ? 1_555 ? 68 BC2 5 ARG A 83 ? ARG A 131 . ? 1_555 ? 69 BC2 5 THR A 100 ? THR A 148 . ? 1_555 ? 70 BC2 5 PHE A 101 ? PHE A 149 . ? 1_555 ? 71 BC2 5 GLN A 102 ? GLN A 150 . ? 1_555 ? # _database_PDB_matrix.entry_id 3RWQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3RWQ _atom_sites.fract_transf_matrix[1][1] 0.008116 _atom_sites.fract_transf_matrix[1][2] 0.004686 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009372 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021086 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 49 ? ? ? A . n A 1 2 ALA 2 50 ? ? ? A . n A 1 3 MET 3 51 ? ? ? A . n A 1 4 ASP 4 52 ? ? ? A . n A 1 5 GLY 5 53 ? ? ? A . n A 1 6 THR 6 54 ? ? ? A . n A 1 7 ALA 7 55 ? ? ? A . n A 1 8 ALA 8 56 ? ? ? A . n A 1 9 GLU 9 57 ? ? ? A . n A 1 10 PRO 10 58 ? ? ? A . n A 1 11 ARG 11 59 ? ? ? A . n A 1 12 PRO 12 60 ? ? ? A . n A 1 13 GLY 13 61 ? ? ? A . n A 1 14 ALA 14 62 ? ? ? A . n A 1 15 GLY 15 63 ? ? ? A . n A 1 16 SER 16 64 ? ? ? A . n A 1 17 LEU 17 65 ? ? ? A . n A 1 18 GLN 18 66 ? ? ? A . n A 1 19 HIS 19 67 ? ? ? A . n A 1 20 ALA 20 68 ? ? ? A . n A 1 21 GLN 21 69 ? ? ? A . n A 1 22 PRO 22 70 ? ? ? A . n A 1 23 PRO 23 71 ? ? ? A . n A 1 24 PRO 24 72 72 PRO PRO A . n A 1 25 GLN 25 73 73 GLN GLN A . n A 1 26 PRO 26 74 74 PRO PRO A . n A 1 27 ARG 27 75 75 ARG ARG A . n A 1 28 LYS 28 76 76 LYS LYS A . n A 1 29 LYS 29 77 77 LYS LYS A . n A 1 30 ARG 30 78 78 ARG ARG A . n A 1 31 PRO 31 79 79 PRO PRO A . n A 1 32 GLU 32 80 80 GLU GLU A . n A 1 33 ASP 33 81 81 ASP ASP A . n A 1 34 PHE 34 82 82 PHE PHE A . n A 1 35 LYS 35 83 83 LYS LYS A . n A 1 36 PHE 36 84 84 PHE PHE A . n A 1 37 GLY 37 85 85 GLY GLY A . n A 1 38 LYS 38 86 86 LYS LYS A . n A 1 39 ILE 39 87 87 ILE ILE A . n A 1 40 LEU 40 88 88 LEU LEU A . n A 1 41 GLY 41 89 89 GLY GLY A . n A 1 42 GLU 42 90 90 GLU GLU A . n A 1 43 GLY 43 91 91 GLY GLY A . n A 1 44 SER 44 92 92 SER SER A . n A 1 45 PHE 45 93 93 PHE PHE A . n A 1 46 SER 46 94 94 SER SER A . n A 1 47 THR 47 95 95 THR THR A . n A 1 48 VAL 48 96 96 VAL VAL A . n A 1 49 VAL 49 97 97 VAL VAL A . n A 1 50 LEU 50 98 98 LEU LEU A . n A 1 51 ALA 51 99 99 ALA ALA A . n A 1 52 ARG 52 100 100 ARG ARG A . n A 1 53 GLU 53 101 101 GLU GLU A . n A 1 54 LEU 54 102 102 LEU LEU A . n A 1 55 ALA 55 103 103 ALA ALA A . n A 1 56 THR 56 104 104 THR THR A . n A 1 57 SER 57 105 105 SER SER A . n A 1 58 ARG 58 106 106 ARG ARG A . n A 1 59 GLU 59 107 107 GLU GLU A . n A 1 60 TYR 60 108 108 TYR TYR A . n A 1 61 ALA 61 109 109 ALA ALA A . n A 1 62 ILE 62 110 110 ILE ILE A . n A 1 63 LYS 63 111 111 LYS LYS A . n A 1 64 ILE 64 112 112 ILE ILE A . n A 1 65 LEU 65 113 113 LEU LEU A . n A 1 66 GLU 66 114 114 GLU GLU A . n A 1 67 LYS 67 115 115 LYS LYS A . n A 1 68 ARG 68 116 116 ARG ARG A . n A 1 69 HIS 69 117 117 HIS HIS A . n A 1 70 ILE 70 118 118 ILE ILE A . n A 1 71 ILE 71 119 119 ILE ILE A . n A 1 72 LYS 72 120 120 LYS LYS A . n A 1 73 GLU 73 121 121 GLU GLU A . n A 1 74 ASN 74 122 122 ASN ASN A . n A 1 75 LYS 75 123 123 LYS LYS A . n A 1 76 VAL 76 124 124 VAL VAL A . n A 1 77 PRO 77 125 125 PRO PRO A . n A 1 78 TYR 78 126 126 TYR TYR A . n A 1 79 VAL 79 127 127 VAL VAL A . n A 1 80 THR 80 128 128 THR THR A . n A 1 81 ARG 81 129 129 ARG ARG A . n A 1 82 GLU 82 130 130 GLU GLU A . n A 1 83 ARG 83 131 131 ARG ARG A . n A 1 84 ASP 84 132 132 ASP ASP A . n A 1 85 VAL 85 133 133 VAL VAL A . n A 1 86 MET 86 134 134 MET MET A . n A 1 87 SER 87 135 135 SER SER A . n A 1 88 ARG 88 136 136 ARG ARG A . n A 1 89 LEU 89 137 137 LEU LEU A . n A 1 90 ASP 90 138 138 ASP ASP A . n A 1 91 HIS 91 139 139 HIS HIS A . n A 1 92 PRO 92 140 140 PRO PRO A . n A 1 93 PHE 93 141 141 PHE PHE A . n A 1 94 PHE 94 142 142 PHE PHE A . n A 1 95 VAL 95 143 143 VAL VAL A . n A 1 96 LYS 96 144 144 LYS LYS A . n A 1 97 LEU 97 145 145 LEU LEU A . n A 1 98 TYR 98 146 146 TYR TYR A . n A 1 99 PHE 99 147 147 PHE PHE A . n A 1 100 THR 100 148 148 THR THR A . n A 1 101 PHE 101 149 149 PHE PHE A . n A 1 102 GLN 102 150 150 GLN GLN A . n A 1 103 ASP 103 151 151 ASP ASP A . n A 1 104 ASP 104 152 152 ASP ASP A . n A 1 105 GLU 105 153 153 GLU GLU A . n A 1 106 LYS 106 154 154 LYS LYS A . n A 1 107 LEU 107 155 155 LEU LEU A . n A 1 108 TYR 108 156 156 TYR TYR A . n A 1 109 PHE 109 157 157 PHE PHE A . n A 1 110 GLY 110 158 158 GLY GLY A . n A 1 111 LEU 111 159 159 LEU LEU A . n A 1 112 SER 112 160 160 SER SER A . n A 1 113 TYR 113 161 161 TYR TYR A . n A 1 114 ALA 114 162 162 ALA ALA A . n A 1 115 LYS 115 163 163 LYS LYS A . n A 1 116 ASN 116 164 164 ASN ASN A . n A 1 117 GLY 117 165 165 GLY GLY A . n A 1 118 GLU 118 166 166 GLU GLU A . n A 1 119 LEU 119 167 167 LEU LEU A . n A 1 120 LEU 120 168 168 LEU LEU A . n A 1 121 LYS 121 169 169 LYS LYS A . n A 1 122 TYR 122 170 170 TYR TYR A . n A 1 123 ILE 123 171 171 ILE ILE A . n A 1 124 ARG 124 172 172 ARG ARG A . n A 1 125 LYS 125 173 173 LYS LYS A . n A 1 126 ILE 126 174 174 ILE ILE A . n A 1 127 GLY 127 175 175 GLY GLY A . n A 1 128 SER 128 176 176 SER SER A . n A 1 129 PHE 129 177 177 PHE PHE A . n A 1 130 ASP 130 178 178 ASP ASP A . n A 1 131 GLU 131 179 179 GLU GLU A . n A 1 132 THR 132 180 180 THR THR A . n A 1 133 CYS 133 181 181 CYS CYS A . n A 1 134 THR 134 182 182 THR THR A . n A 1 135 ARG 135 183 183 ARG ARG A . n A 1 136 PHE 136 184 184 PHE PHE A . n A 1 137 TYR 137 185 185 TYR TYR A . n A 1 138 THR 138 186 186 THR THR A . n A 1 139 ALA 139 187 187 ALA ALA A . n A 1 140 GLU 140 188 188 GLU GLU A . n A 1 141 ILE 141 189 189 ILE ILE A . n A 1 142 VAL 142 190 190 VAL VAL A . n A 1 143 SER 143 191 191 SER SER A . n A 1 144 ALA 144 192 192 ALA ALA A . n A 1 145 LEU 145 193 193 LEU LEU A . n A 1 146 GLU 146 194 194 GLU GLU A . n A 1 147 TYR 147 195 195 TYR TYR A . n A 1 148 LEU 148 196 196 LEU LEU A . n A 1 149 HIS 149 197 197 HIS HIS A . n A 1 150 GLY 150 198 198 GLY GLY A . n A 1 151 LYS 151 199 199 LYS LYS A . n A 1 152 GLY 152 200 200 GLY GLY A . n A 1 153 ILE 153 201 201 ILE ILE A . n A 1 154 ILE 154 202 202 ILE ILE A . n A 1 155 HIS 155 203 203 HIS HIS A . n A 1 156 ARG 156 204 204 ARG ARG A . n A 1 157 ASP 157 205 205 ASP ASP A . n A 1 158 LEU 158 206 206 LEU LEU A . n A 1 159 LYS 159 207 207 LYS LYS A . n A 1 160 PRO 160 208 208 PRO PRO A . n A 1 161 GLU 161 209 209 GLU GLU A . n A 1 162 ASN 162 210 210 ASN ASN A . n A 1 163 ILE 163 211 211 ILE ILE A . n A 1 164 LEU 164 212 212 LEU LEU A . n A 1 165 LEU 165 213 213 LEU LEU A . n A 1 166 ASN 166 214 214 ASN ASN A . n A 1 167 GLU 167 215 215 GLU GLU A . n A 1 168 ASP 168 216 216 ASP ASP A . n A 1 169 MET 169 217 217 MET MET A . n A 1 170 HIS 170 218 218 HIS HIS A . n A 1 171 ILE 171 219 219 ILE ILE A . n A 1 172 GLN 172 220 220 GLN GLN A . n A 1 173 ILE 173 221 221 ILE ILE A . n A 1 174 THR 174 222 222 THR THR A . n A 1 175 ASP 175 223 223 ASP ASP A . n A 1 176 PHE 176 224 224 PHE PHE A . n A 1 177 GLY 177 225 225 GLY GLY A . n A 1 178 THR 178 226 226 THR THR A . n A 1 179 ALA 179 227 227 ALA ALA A . n A 1 180 LYS 180 228 228 LYS LYS A . n A 1 181 VAL 181 229 229 VAL VAL A . n A 1 182 LEU 182 230 230 LEU LEU A . n A 1 183 SER 183 231 231 SER SER A . n A 1 184 PRO 184 232 232 PRO PRO A . n A 1 185 GLU 185 233 ? ? ? A . n A 1 186 SER 186 234 ? ? ? A . n A 1 187 LYS 187 235 ? ? ? A . n A 1 188 GLN 188 236 ? ? ? A . n A 1 189 ALA 189 237 237 ALA ALA A . n A 1 190 ARG 190 238 238 ARG ARG A . n A 1 191 ALA 191 239 239 ALA ALA A . n A 1 192 ASN 192 240 240 ASN ASN A . n A 1 193 SEP 193 241 241 SEP SEP A . n A 1 194 PHE 194 242 242 PHE PHE A . n A 1 195 VAL 195 243 243 VAL VAL A . n A 1 196 GLY 196 244 244 GLY GLY A . n A 1 197 THR 197 245 245 THR THR A . n A 1 198 ALA 198 246 246 ALA ALA A . n A 1 199 GLN 199 247 247 GLN GLN A . n A 1 200 TYR 200 248 248 TYR TYR A . n A 1 201 VAL 201 249 249 VAL VAL A . n A 1 202 SER 202 250 250 SER SER A . n A 1 203 PRO 203 251 251 PRO PRO A . n A 1 204 GLU 204 252 252 GLU GLU A . n A 1 205 LEU 205 253 253 LEU LEU A . n A 1 206 LEU 206 254 254 LEU LEU A . n A 1 207 THR 207 255 255 THR THR A . n A 1 208 GLU 208 256 256 GLU GLU A . n A 1 209 LYS 209 257 257 LYS LYS A . n A 1 210 SER 210 258 258 SER SER A . n A 1 211 ALA 211 259 259 ALA ALA A . n A 1 212 CYS 212 260 260 CYS CYS A . n A 1 213 LYS 213 261 261 LYS LYS A . n A 1 214 SER 214 262 262 SER SER A . n A 1 215 SER 215 263 263 SER SER A . n A 1 216 ASP 216 264 264 ASP ASP A . n A 1 217 LEU 217 265 265 LEU LEU A . n A 1 218 TRP 218 266 266 TRP TRP A . n A 1 219 ALA 219 267 267 ALA ALA A . n A 1 220 LEU 220 268 268 LEU LEU A . n A 1 221 GLY 221 269 269 GLY GLY A . n A 1 222 CYS 222 270 270 CYS CYS A . n A 1 223 ILE 223 271 271 ILE ILE A . n A 1 224 ILE 224 272 272 ILE ILE A . n A 1 225 TYR 225 273 273 TYR TYR A . n A 1 226 GLN 226 274 274 GLN GLN A . n A 1 227 LEU 227 275 275 LEU LEU A . n A 1 228 VAL 228 276 276 VAL VAL A . n A 1 229 ALA 229 277 277 ALA ALA A . n A 1 230 GLY 230 278 278 GLY GLY A . n A 1 231 LEU 231 279 279 LEU LEU A . n A 1 232 PRO 232 280 280 PRO PRO A . n A 1 233 PRO 233 281 281 PRO PRO A . n A 1 234 PHE 234 282 282 PHE PHE A . n A 1 235 ARG 235 283 283 ARG ARG A . n A 1 236 ALA 236 284 284 ALA ALA A . n A 1 237 GLY 237 285 285 GLY GLY A . n A 1 238 ASN 238 286 286 ASN ASN A . n A 1 239 GLU 239 287 287 GLU GLU A . n A 1 240 TYR 240 288 288 TYR TYR A . n A 1 241 LEU 241 289 289 LEU LEU A . n A 1 242 ILE 242 290 290 ILE ILE A . n A 1 243 PHE 243 291 291 PHE PHE A . n A 1 244 GLN 244 292 292 GLN GLN A . n A 1 245 LYS 245 293 293 LYS LYS A . n A 1 246 ILE 246 294 294 ILE ILE A . n A 1 247 ILE 247 295 295 ILE ILE A . n A 1 248 LYS 248 296 296 LYS LYS A . n A 1 249 LEU 249 297 297 LEU LEU A . n A 1 250 GLU 250 298 298 GLU GLU A . n A 1 251 TYR 251 299 299 TYR TYR A . n A 1 252 ASP 252 300 300 ASP ASP A . n A 1 253 PHE 253 301 301 PHE PHE A . n A 1 254 PRO 254 302 302 PRO PRO A . n A 1 255 GLU 255 303 303 GLU GLU A . n A 1 256 LYS 256 304 304 LYS LYS A . n A 1 257 PHE 257 305 305 PHE PHE A . n A 1 258 PHE 258 306 306 PHE PHE A . n A 1 259 PRO 259 307 307 PRO PRO A . n A 1 260 LYS 260 308 308 LYS LYS A . n A 1 261 ALA 261 309 309 ALA ALA A . n A 1 262 ARG 262 310 310 ARG ARG A . n A 1 263 ASP 263 311 311 ASP ASP A . n A 1 264 LEU 264 312 312 LEU LEU A . n A 1 265 VAL 265 313 313 VAL VAL A . n A 1 266 GLU 266 314 314 GLU GLU A . n A 1 267 LYS 267 315 315 LYS LYS A . n A 1 268 LEU 268 316 316 LEU LEU A . n A 1 269 LEU 269 317 317 LEU LEU A . n A 1 270 VAL 270 318 318 VAL VAL A . n A 1 271 LEU 271 319 319 LEU LEU A . n A 1 272 ASP 272 320 320 ASP ASP A . n A 1 273 ALA 273 321 321 ALA ALA A . n A 1 274 THR 274 322 322 THR THR A . n A 1 275 LYS 275 323 323 LYS LYS A . n A 1 276 ARG 276 324 324 ARG ARG A . n A 1 277 LEU 277 325 325 LEU LEU A . n A 1 278 GLY 278 326 326 GLY GLY A . n A 1 279 CYS 279 327 327 CYS CYS A . n A 1 280 GLU 280 328 328 GLU GLU A . n A 1 281 GLU 281 329 329 GLU GLU A . n A 1 282 MET 282 330 330 MET MET A . n A 1 283 GLU 283 331 331 GLU GLU A . n A 1 284 GLY 284 332 332 GLY GLY A . n A 1 285 TYR 285 333 333 TYR TYR A . n A 1 286 GLY 286 334 334 GLY GLY A . n A 1 287 PRO 287 335 335 PRO PRO A . n A 1 288 LEU 288 336 336 LEU LEU A . n A 1 289 LYS 289 337 337 LYS LYS A . n A 1 290 ALA 290 338 338 ALA ALA A . n A 1 291 HIS 291 339 339 HIS HIS A . n A 1 292 PRO 292 340 340 PRO PRO A . n A 1 293 PHE 293 341 341 PHE PHE A . n A 1 294 PHE 294 342 342 PHE PHE A . n A 1 295 GLU 295 343 343 GLU GLU A . n A 1 296 SER 296 344 344 SER SER A . n A 1 297 VAL 297 345 345 VAL VAL A . n A 1 298 THR 298 346 346 THR THR A . n A 1 299 TRP 299 347 347 TRP TRP A . n A 1 300 GLU 300 348 348 GLU GLU A . n A 1 301 ASN 301 349 349 ASN ASN A . n A 1 302 LEU 302 350 350 LEU LEU A . n A 1 303 HIS 303 351 351 HIS HIS A . n A 1 304 GLN 304 352 352 GLN GLN A . n A 1 305 GLN 305 353 353 GLN GLN A . n A 1 306 THR 306 354 354 THR THR A . n A 1 307 PRO 307 355 355 PRO PRO A . n A 1 308 PRO 308 356 356 PRO PRO A . n A 1 309 LYS 309 357 357 LYS LYS A . n A 1 310 LEU 310 358 358 LEU LEU A . n A 1 311 THR 311 359 359 THR THR A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 193 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 241 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details PHOSPHOSERINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G,H,I,J,K,L,M 2 1,2 A,B,C,D,E,F,G,H,I,J,K,L,M # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 6540 ? 2 MORE -218 ? 2 'SSA (A^2)' 25550 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_554 -x,-x+y,-z-1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -15.8080000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-16 2 'Structure model' 1 1 2011-12-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 REFMAC refinement . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 REFMAC phasing . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 15 ? ? O A HOH 384 ? ? 2.12 2 1 O A PHE 93 ? ? O A HOH 23 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 204 ? ? 81.80 -9.17 2 1 ASP A 205 ? ? -149.32 44.82 3 1 LYS A 207 ? ? 179.34 162.30 4 1 ASP A 223 ? ? 68.52 70.31 5 1 SER A 231 ? ? -127.12 -105.86 6 1 ALA A 239 ? ? -168.48 -156.08 7 1 ASN A 240 ? ? 162.89 -15.04 8 1 LYS A 257 ? ? 1.52 57.07 9 1 PHE A 305 ? ? -6.21 119.41 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 238 ? CG ? A ARG 190 CG 2 1 Y 1 A ARG 238 ? CD ? A ARG 190 CD 3 1 Y 1 A ARG 238 ? NE ? A ARG 190 NE 4 1 Y 1 A ARG 238 ? CZ ? A ARG 190 CZ 5 1 Y 1 A ARG 238 ? NH1 ? A ARG 190 NH1 6 1 Y 1 A ARG 238 ? NH2 ? A ARG 190 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 49 ? A GLY 1 2 1 Y 1 A ALA 50 ? A ALA 2 3 1 Y 1 A MET 51 ? A MET 3 4 1 Y 1 A ASP 52 ? A ASP 4 5 1 Y 1 A GLY 53 ? A GLY 5 6 1 Y 1 A THR 54 ? A THR 6 7 1 Y 1 A ALA 55 ? A ALA 7 8 1 Y 1 A ALA 56 ? A ALA 8 9 1 Y 1 A GLU 57 ? A GLU 9 10 1 Y 1 A PRO 58 ? A PRO 10 11 1 Y 1 A ARG 59 ? A ARG 11 12 1 Y 1 A PRO 60 ? A PRO 12 13 1 Y 1 A GLY 61 ? A GLY 13 14 1 Y 1 A ALA 62 ? A ALA 14 15 1 Y 1 A GLY 63 ? A GLY 15 16 1 Y 1 A SER 64 ? A SER 16 17 1 Y 1 A LEU 65 ? A LEU 17 18 1 Y 1 A GLN 66 ? A GLN 18 19 1 Y 1 A HIS 67 ? A HIS 19 20 1 Y 1 A ALA 68 ? A ALA 20 21 1 Y 1 A GLN 69 ? A GLN 21 22 1 Y 1 A PRO 70 ? A PRO 22 23 1 Y 1 A PRO 71 ? A PRO 23 24 1 Y 1 A GLU 233 ? A GLU 185 25 1 Y 1 A SER 234 ? A SER 186 26 1 Y 1 A LYS 235 ? A LYS 187 27 1 Y 1 A GLN 236 ? A GLN 188 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[4-amino-7-(propan-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl](6-{[2-(pyridin-3-yl)ethyl]amino}pyrazin-2-yl)methanone' 3RW 3 GLYCEROL GOL 4 'SULFATE ION' SO4 5 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 3RW 1 1 1 3RW 3RW A . C 3 GOL 1 9001 9001 GOL GOL A . D 3 GOL 1 9002 9002 GOL GOL A . E 3 GOL 1 9003 9003 GOL GOL A . F 4 SO4 1 9004 9004 SO4 SO4 A . G 4 SO4 1 9005 9005 SO4 SO4 A . H 4 SO4 1 9006 9006 SO4 SO4 A . I 4 SO4 1 9007 9007 SO4 SO4 A . J 4 SO4 1 9008 9008 SO4 SO4 A . K 4 SO4 1 9009 9009 SO4 SO4 A . L 4 SO4 1 9010 9010 SO4 SO4 A . M 5 HOH 1 2 2 HOH HOH A . M 5 HOH 2 3 3 HOH HOH A . M 5 HOH 3 4 4 HOH HOH A . M 5 HOH 4 5 5 HOH HOH A . M 5 HOH 5 6 6 HOH HOH A . M 5 HOH 6 7 7 HOH HOH A . M 5 HOH 7 8 8 HOH HOH A . M 5 HOH 8 9 9 HOH HOH A . M 5 HOH 9 10 10 HOH HOH A . M 5 HOH 10 11 11 HOH HOH A . M 5 HOH 11 12 12 HOH HOH A . M 5 HOH 12 13 13 HOH HOH A . M 5 HOH 13 14 14 HOH HOH A . M 5 HOH 14 15 15 HOH HOH A . M 5 HOH 15 16 16 HOH HOH A . M 5 HOH 16 17 17 HOH HOH A . M 5 HOH 17 18 18 HOH HOH A . M 5 HOH 18 19 19 HOH HOH A . M 5 HOH 19 20 20 HOH HOH A . M 5 HOH 20 21 21 HOH HOH A . M 5 HOH 21 22 22 HOH HOH A . M 5 HOH 22 23 23 HOH HOH A . M 5 HOH 23 24 24 HOH HOH A . M 5 HOH 24 25 25 HOH HOH A . M 5 HOH 25 26 26 HOH HOH A . M 5 HOH 26 27 27 HOH HOH A . M 5 HOH 27 28 28 HOH HOH A . M 5 HOH 28 29 29 HOH HOH A . M 5 HOH 29 30 30 HOH HOH A . M 5 HOH 30 31 31 HOH HOH A . M 5 HOH 31 32 32 HOH HOH A . M 5 HOH 32 33 33 HOH HOH A . M 5 HOH 33 34 34 HOH HOH A . M 5 HOH 34 35 35 HOH HOH A . M 5 HOH 35 37 37 HOH HOH A . M 5 HOH 36 38 38 HOH HOH A . M 5 HOH 37 39 39 HOH HOH A . M 5 HOH 38 40 40 HOH HOH A . M 5 HOH 39 41 41 HOH HOH A . M 5 HOH 40 42 42 HOH HOH A . M 5 HOH 41 43 43 HOH HOH A . M 5 HOH 42 44 44 HOH HOH A . M 5 HOH 43 45 45 HOH HOH A . M 5 HOH 44 46 46 HOH HOH A . M 5 HOH 45 47 47 HOH HOH A . M 5 HOH 46 48 48 HOH HOH A . M 5 HOH 47 360 49 HOH HOH A . M 5 HOH 48 361 50 HOH HOH A . M 5 HOH 49 362 51 HOH HOH A . M 5 HOH 50 363 52 HOH HOH A . M 5 HOH 51 364 53 HOH HOH A . M 5 HOH 52 365 54 HOH HOH A . M 5 HOH 53 366 55 HOH HOH A . M 5 HOH 54 367 56 HOH HOH A . M 5 HOH 55 368 57 HOH HOH A . M 5 HOH 56 369 58 HOH HOH A . M 5 HOH 57 370 60 HOH HOH A . M 5 HOH 58 371 61 HOH HOH A . M 5 HOH 59 372 62 HOH HOH A . M 5 HOH 60 373 63 HOH HOH A . M 5 HOH 61 374 64 HOH HOH A . M 5 HOH 62 375 65 HOH HOH A . M 5 HOH 63 376 66 HOH HOH A . M 5 HOH 64 377 67 HOH HOH A . M 5 HOH 65 378 68 HOH HOH A . M 5 HOH 66 379 69 HOH HOH A . M 5 HOH 67 380 70 HOH HOH A . M 5 HOH 68 381 71 HOH HOH A . M 5 HOH 69 382 72 HOH HOH A . M 5 HOH 70 383 73 HOH HOH A . M 5 HOH 71 384 74 HOH HOH A . #