data_3SC1 # _entry.id 3SC1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3SC1 RCSB RCSB066019 WWPDB D_1000066019 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3RWP 'Discovery of a Novel, Potent and Selective Inhibitor of 3-Phosphoinositide Dependent Kinase (PDK1)' unspecified PDB 3RWQ 'Discovery of a Novel, Potent and Selective Inhibitor of 3-Phosphoinositide Dependent Kinase (PDK1)' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3SC1 _pdbx_database_status.recvd_initial_deposition_date 2011-06-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Greasley, S.E.' 1 'Ferre, R.-A.' 2 'Krauss, M.' 3 'Cronin, C.' 4 # _citation.id primary _citation.title 'Novel isoquinolone PDK1 inhibitors discovered through fragment-based lead discovery.' _citation.journal_abbrev 'J Comput Aided Mol Des' _citation.journal_volume 25 _citation.page_first 689 _citation.page_last 698 _citation.year 2011 _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21779981 _citation.pdbx_database_id_DOI 10.1007/s10822-011-9456-7 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Johnson, M.C.' 1 primary 'Hu, Q.' 2 primary 'Lingardo, L.' 3 primary 'Ferre, R.A.' 4 primary 'Greasley, S.' 5 primary 'Yan, J.' 6 primary 'Kath, J.' 7 primary 'Chen, P.' 8 primary 'Ermolieff, J.' 9 primary 'Alton, G.' 10 # _cell.entry_id 3SC1 _cell.length_a 123.707 _cell.length_b 123.707 _cell.length_c 47.295 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3SC1 _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-phosphoinositide-dependent protein kinase 1' 35555.738 1 2.7.11.1 ? 'Protein kinase domain, residues 50-359' ? 2 non-polymer syn '6-[2-(hydroxymethyl)phenyl]isoquinolin-1(2H)-one' 251.280 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 5 water nat water 18.015 31 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hPDK1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GAMDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVT RERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKP ENILLNEDMHIQITDFGTAKVLSPESKQARAN(SEP)FVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRA GNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVT RERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKP ENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEY LIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ASP n 1 5 GLY n 1 6 THR n 1 7 ALA n 1 8 ALA n 1 9 GLU n 1 10 PRO n 1 11 ARG n 1 12 PRO n 1 13 GLY n 1 14 ALA n 1 15 GLY n 1 16 SER n 1 17 LEU n 1 18 GLN n 1 19 HIS n 1 20 ALA n 1 21 GLN n 1 22 PRO n 1 23 PRO n 1 24 PRO n 1 25 GLN n 1 26 PRO n 1 27 ARG n 1 28 LYS n 1 29 LYS n 1 30 ARG n 1 31 PRO n 1 32 GLU n 1 33 ASP n 1 34 PHE n 1 35 LYS n 1 36 PHE n 1 37 GLY n 1 38 LYS n 1 39 ILE n 1 40 LEU n 1 41 GLY n 1 42 GLU n 1 43 GLY n 1 44 SER n 1 45 PHE n 1 46 SER n 1 47 THR n 1 48 VAL n 1 49 VAL n 1 50 LEU n 1 51 ALA n 1 52 ARG n 1 53 GLU n 1 54 LEU n 1 55 ALA n 1 56 THR n 1 57 SER n 1 58 ARG n 1 59 GLU n 1 60 TYR n 1 61 ALA n 1 62 ILE n 1 63 LYS n 1 64 ILE n 1 65 LEU n 1 66 GLU n 1 67 LYS n 1 68 ARG n 1 69 HIS n 1 70 ILE n 1 71 ILE n 1 72 LYS n 1 73 GLU n 1 74 ASN n 1 75 LYS n 1 76 VAL n 1 77 PRO n 1 78 TYR n 1 79 VAL n 1 80 THR n 1 81 ARG n 1 82 GLU n 1 83 ARG n 1 84 ASP n 1 85 VAL n 1 86 MET n 1 87 SER n 1 88 ARG n 1 89 LEU n 1 90 ASP n 1 91 HIS n 1 92 PRO n 1 93 PHE n 1 94 PHE n 1 95 VAL n 1 96 LYS n 1 97 LEU n 1 98 TYR n 1 99 PHE n 1 100 THR n 1 101 PHE n 1 102 GLN n 1 103 ASP n 1 104 ASP n 1 105 GLU n 1 106 LYS n 1 107 LEU n 1 108 TYR n 1 109 PHE n 1 110 GLY n 1 111 LEU n 1 112 SER n 1 113 TYR n 1 114 ALA n 1 115 LYS n 1 116 ASN n 1 117 GLY n 1 118 GLU n 1 119 LEU n 1 120 LEU n 1 121 LYS n 1 122 TYR n 1 123 ILE n 1 124 ARG n 1 125 LYS n 1 126 ILE n 1 127 GLY n 1 128 SER n 1 129 PHE n 1 130 ASP n 1 131 GLU n 1 132 THR n 1 133 CYS n 1 134 THR n 1 135 ARG n 1 136 PHE n 1 137 TYR n 1 138 THR n 1 139 ALA n 1 140 GLU n 1 141 ILE n 1 142 VAL n 1 143 SER n 1 144 ALA n 1 145 LEU n 1 146 GLU n 1 147 TYR n 1 148 LEU n 1 149 HIS n 1 150 GLY n 1 151 LYS n 1 152 GLY n 1 153 ILE n 1 154 ILE n 1 155 HIS n 1 156 ARG n 1 157 ASP n 1 158 LEU n 1 159 LYS n 1 160 PRO n 1 161 GLU n 1 162 ASN n 1 163 ILE n 1 164 LEU n 1 165 LEU n 1 166 ASN n 1 167 GLU n 1 168 ASP n 1 169 MET n 1 170 HIS n 1 171 ILE n 1 172 GLN n 1 173 ILE n 1 174 THR n 1 175 ASP n 1 176 PHE n 1 177 GLY n 1 178 THR n 1 179 ALA n 1 180 LYS n 1 181 VAL n 1 182 LEU n 1 183 SER n 1 184 PRO n 1 185 GLU n 1 186 SER n 1 187 LYS n 1 188 GLN n 1 189 ALA n 1 190 ARG n 1 191 ALA n 1 192 ASN n 1 193 SEP n 1 194 PHE n 1 195 VAL n 1 196 GLY n 1 197 THR n 1 198 ALA n 1 199 GLN n 1 200 TYR n 1 201 VAL n 1 202 SER n 1 203 PRO n 1 204 GLU n 1 205 LEU n 1 206 LEU n 1 207 THR n 1 208 GLU n 1 209 LYS n 1 210 SER n 1 211 ALA n 1 212 CYS n 1 213 LYS n 1 214 SER n 1 215 SER n 1 216 ASP n 1 217 LEU n 1 218 TRP n 1 219 ALA n 1 220 LEU n 1 221 GLY n 1 222 CYS n 1 223 ILE n 1 224 ILE n 1 225 TYR n 1 226 GLN n 1 227 LEU n 1 228 VAL n 1 229 ALA n 1 230 GLY n 1 231 LEU n 1 232 PRO n 1 233 PRO n 1 234 PHE n 1 235 ARG n 1 236 ALA n 1 237 GLY n 1 238 ASN n 1 239 GLU n 1 240 TYR n 1 241 LEU n 1 242 ILE n 1 243 PHE n 1 244 GLN n 1 245 LYS n 1 246 ILE n 1 247 ILE n 1 248 LYS n 1 249 LEU n 1 250 GLU n 1 251 TYR n 1 252 ASP n 1 253 PHE n 1 254 PRO n 1 255 GLU n 1 256 LYS n 1 257 PHE n 1 258 PHE n 1 259 PRO n 1 260 LYS n 1 261 ALA n 1 262 ARG n 1 263 ASP n 1 264 LEU n 1 265 VAL n 1 266 GLU n 1 267 LYS n 1 268 LEU n 1 269 LEU n 1 270 VAL n 1 271 LEU n 1 272 ASP n 1 273 ALA n 1 274 THR n 1 275 LYS n 1 276 ARG n 1 277 LEU n 1 278 GLY n 1 279 CYS n 1 280 GLU n 1 281 GLU n 1 282 MET n 1 283 GLU n 1 284 GLY n 1 285 TYR n 1 286 GLY n 1 287 PRO n 1 288 LEU n 1 289 LYS n 1 290 ALA n 1 291 HIS n 1 292 PRO n 1 293 PHE n 1 294 PHE n 1 295 GLU n 1 296 SER n 1 297 VAL n 1 298 THR n 1 299 TRP n 1 300 GLU n 1 301 ASN n 1 302 LEU n 1 303 HIS n 1 304 GLN n 1 305 GLN n 1 306 THR n 1 307 PRO n 1 308 PRO n 1 309 LYS n 1 310 LEU n 1 311 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PDPK1, PDK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PDPK1_HUMAN _struct_ref.pdbx_db_accession O15530 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AMDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTR ERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPE NILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYL IFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT ; _struct_ref.pdbx_align_begin 50 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3SC1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 311 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15530 _struct_ref_seq.db_align_beg 50 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 359 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3SC1 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O15530 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'EXPRESSION TAG' _struct_ref_seq_dif.pdbx_auth_seq_num 49 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 3S1 non-polymer . '6-[2-(hydroxymethyl)phenyl]isoquinolin-1(2H)-one' ? 'C16 H13 N O2' 251.280 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3SC1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.94 _exptl_crystal.density_percent_sol 58.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '2.2M AMMONIUM SULFATE, 10MM EDTA, 5-% GLYCEROL, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2008-06-25 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DOUBLE-CRYSTAL, SI(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.99 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.99 # _reflns.entry_id 3SC1 _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F 1.0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.65 _reflns.number_obs 12487 _reflns.number_all 12487 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.146 _reflns.pdbx_netI_over_sigmaI 11.9 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.13 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low 2.7 _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.88 _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 609 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3SC1 _refine.ls_number_reflns_obs 10432 _refine.ls_number_reflns_all 10969 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50 _refine.ls_d_res_high 2.7 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1999 _refine.ls_R_factor_all 0.1999 _refine.ls_R_factor_R_work 0.1999 _refine.ls_R_factor_R_free 0.2371 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 537 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2285 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 51 _refine_hist.number_atoms_solvent 31 _refine_hist.number_atoms_total 2367 _refine_hist.d_res_high 2.7 _refine_hist.d_res_low 50 # _struct.entry_id 3SC1 _struct.title 'Novel Isoquinolone PDK1 Inhibitors Discovered through Fragment-Based Lead Discovery' _struct.pdbx_descriptor '3-phosphoinositide-dependent protein kinase 1 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3SC1 _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text 'KINASE DOMAIN, PHOSPHOSERINE, SEP, TRANSFERASE-TRANSFERASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 4 ? I N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 30 ? GLU A 32 ? ARG A 78 GLU A 80 5 ? 3 HELX_P HELX_P2 2 LYS A 67 ? GLU A 73 ? LYS A 115 GLU A 121 1 ? 7 HELX_P HELX_P3 3 LYS A 75 ? LEU A 89 ? LYS A 123 LEU A 137 1 ? 15 HELX_P HELX_P4 4 GLU A 118 ? GLY A 127 ? GLU A 166 GLY A 175 1 ? 10 HELX_P HELX_P5 5 ASP A 130 ? LYS A 151 ? ASP A 178 LYS A 199 1 ? 22 HELX_P HELX_P6 6 THR A 197 ? VAL A 201 ? THR A 245 VAL A 249 5 ? 5 HELX_P HELX_P7 7 SER A 202 ? LYS A 209 ? SER A 250 LYS A 257 1 ? 8 HELX_P HELX_P8 8 CYS A 212 ? GLY A 230 ? CYS A 260 GLY A 278 1 ? 19 HELX_P HELX_P9 9 ASN A 238 ? LEU A 249 ? ASN A 286 LEU A 297 1 ? 12 HELX_P HELX_P10 10 PHE A 258 ? LYS A 267 ? PHE A 306 LYS A 315 1 ? 10 HELX_P HELX_P11 11 ASP A 272 ? ARG A 276 ? ASP A 320 ARG A 324 5 ? 5 HELX_P HELX_P12 12 CYS A 279 ? GLU A 283 ? CYS A 327 GLU A 331 5 ? 5 HELX_P HELX_P13 13 GLY A 284 ? HIS A 291 ? GLY A 332 HIS A 339 1 ? 8 HELX_P HELX_P14 14 PRO A 292 ? GLU A 295 ? PRO A 340 GLU A 343 5 ? 4 HELX_P HELX_P15 15 THR A 298 ? LEU A 302 ? THR A 346 LEU A 350 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ASN 192 C ? ? ? 1_555 A SEP 193 N ? ? A ASN 240 A SEP 241 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? A SEP 193 C ? ? ? 1_555 A PHE 194 N ? ? A SEP 241 A PHE 242 1_555 ? ? ? ? ? ? ? 1.332 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 310 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 358 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 THR _struct_mon_prot_cis.pdbx_label_seq_id_2 311 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 THR _struct_mon_prot_cis.pdbx_auth_seq_id_2 359 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 13.89 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 34 ? GLU A 42 ? PHE A 82 GLU A 90 A 2 SER A 46 ? GLU A 53 ? SER A 94 GLU A 101 A 3 GLU A 59 ? GLU A 66 ? GLU A 107 GLU A 114 A 4 LYS A 106 ? SER A 112 ? LYS A 154 SER A 160 A 5 LEU A 97 ? GLN A 102 ? LEU A 145 GLN A 150 B 1 ILE A 153 ? ILE A 154 ? ILE A 201 ILE A 202 B 2 LYS A 180 ? VAL A 181 ? LYS A 228 VAL A 229 C 1 ILE A 163 ? LEU A 165 ? ILE A 211 LEU A 213 C 2 ILE A 171 ? ILE A 173 ? ILE A 219 ILE A 221 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 41 ? N GLY A 89 O VAL A 48 ? O VAL A 96 A 2 3 N THR A 47 ? N THR A 95 O ILE A 64 ? O ILE A 112 A 3 4 N LEU A 65 ? N LEU A 113 O LEU A 107 ? O LEU A 155 A 4 5 O GLY A 110 ? O GLY A 158 N TYR A 98 ? N TYR A 146 B 1 2 N ILE A 154 ? N ILE A 202 O LYS A 180 ? O LYS A 228 C 1 2 N LEU A 164 ? N LEU A 212 O GLN A 172 ? O GLN A 220 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 3S1 A 900' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 901' AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 902' AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 903' AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 904' AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 905' AC7 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL A 906' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 GLY A 41 ? GLY A 89 . ? 1_555 ? 2 AC1 10 GLU A 42 ? GLU A 90 . ? 1_555 ? 3 AC1 10 GLY A 43 ? GLY A 91 . ? 1_555 ? 4 AC1 10 ALA A 61 ? ALA A 109 . ? 1_555 ? 5 AC1 10 SER A 112 ? SER A 160 . ? 1_555 ? 6 AC1 10 TYR A 113 ? TYR A 161 . ? 1_555 ? 7 AC1 10 ALA A 114 ? ALA A 162 . ? 1_555 ? 8 AC1 10 GLU A 118 ? GLU A 166 . ? 1_555 ? 9 AC1 10 LEU A 164 ? LEU A 212 . ? 1_555 ? 10 AC1 10 THR A 174 ? THR A 222 . ? 1_555 ? 11 AC2 6 HOH I . ? HOH A 1 . ? 1_555 ? 12 AC2 6 ARG A 58 ? ARG A 106 . ? 1_555 ? 13 AC2 6 PRO A 92 ? PRO A 140 . ? 4_556 ? 14 AC2 6 HIS A 303 ? HIS A 351 . ? 4_556 ? 15 AC2 6 SO4 E . ? SO4 A 903 . ? 1_555 ? 16 AC2 6 GOL G . ? GOL A 905 . ? 1_555 ? 17 AC3 5 LYS A 28 ? LYS A 76 . ? 1_555 ? 18 AC3 5 ARG A 83 ? ARG A 131 . ? 1_555 ? 19 AC3 5 THR A 100 ? THR A 148 . ? 1_555 ? 20 AC3 5 PHE A 101 ? PHE A 149 . ? 1_555 ? 21 AC3 5 GLN A 102 ? GLN A 150 . ? 1_555 ? 22 AC4 6 LYS A 96 ? LYS A 144 . ? 4_556 ? 23 AC4 6 LYS A 96 ? LYS A 144 . ? 1_555 ? 24 AC4 6 TYR A 98 ? TYR A 146 . ? 4_556 ? 25 AC4 6 TYR A 98 ? TYR A 146 . ? 1_555 ? 26 AC4 6 SO4 C . ? SO4 A 901 . ? 1_555 ? 27 AC4 6 GOL G . ? GOL A 905 . ? 1_555 ? 28 AC5 7 HOH I . ? HOH A 24 . ? 1_555 ? 29 AC5 7 HOH I . ? HOH A 25 . ? 1_555 ? 30 AC5 7 HOH I . ? HOH A 26 . ? 1_555 ? 31 AC5 7 GLY A 43 ? GLY A 91 . ? 1_555 ? 32 AC5 7 SER A 44 ? SER A 92 . ? 1_555 ? 33 AC5 7 PHE A 45 ? PHE A 93 . ? 1_555 ? 34 AC5 7 SER A 46 ? SER A 94 . ? 1_555 ? 35 AC6 6 GLU A 59 ? GLU A 107 . ? 1_555 ? 36 AC6 6 TYR A 98 ? TYR A 146 . ? 1_555 ? 37 AC6 6 SER A 112 ? SER A 160 . ? 1_555 ? 38 AC6 6 TYR A 113 ? TYR A 161 . ? 1_555 ? 39 AC6 6 SO4 C . ? SO4 A 901 . ? 1_555 ? 40 AC6 6 SO4 E . ? SO4 A 903 . ? 1_555 ? 41 AC7 9 ALA A 55 ? ALA A 103 . ? 4_556 ? 42 AC7 9 THR A 56 ? THR A 104 . ? 4_556 ? 43 AC7 9 SER A 57 ? SER A 105 . ? 4_556 ? 44 AC7 9 HIS A 91 ? HIS A 139 . ? 1_555 ? 45 AC7 9 SER A 143 ? SER A 191 . ? 1_555 ? 46 AC7 9 TRP A 299 ? TRP A 347 . ? 1_555 ? 47 AC7 9 ASN A 301 ? ASN A 349 . ? 1_555 ? 48 AC7 9 LEU A 302 ? LEU A 350 . ? 1_555 ? 49 AC7 9 HIS A 303 ? HIS A 351 . ? 1_555 ? # _database_PDB_matrix.entry_id 3SC1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3SC1 _atom_sites.fract_transf_matrix[1][1] 0.008084 _atom_sites.fract_transf_matrix[1][2] 0.004667 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009334 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021144 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 49 ? ? ? A . n A 1 2 ALA 2 50 ? ? ? A . n A 1 3 MET 3 51 ? ? ? A . n A 1 4 ASP 4 52 ? ? ? A . n A 1 5 GLY 5 53 ? ? ? A . n A 1 6 THR 6 54 ? ? ? A . n A 1 7 ALA 7 55 ? ? ? A . n A 1 8 ALA 8 56 ? ? ? A . n A 1 9 GLU 9 57 ? ? ? A . n A 1 10 PRO 10 58 ? ? ? A . n A 1 11 ARG 11 59 ? ? ? A . n A 1 12 PRO 12 60 ? ? ? A . n A 1 13 GLY 13 61 ? ? ? A . n A 1 14 ALA 14 62 ? ? ? A . n A 1 15 GLY 15 63 ? ? ? A . n A 1 16 SER 16 64 ? ? ? A . n A 1 17 LEU 17 65 ? ? ? A . n A 1 18 GLN 18 66 ? ? ? A . n A 1 19 HIS 19 67 ? ? ? A . n A 1 20 ALA 20 68 ? ? ? A . n A 1 21 GLN 21 69 ? ? ? A . n A 1 22 PRO 22 70 ? ? ? A . n A 1 23 PRO 23 71 ? ? ? A . n A 1 24 PRO 24 72 ? ? ? A . n A 1 25 GLN 25 73 73 GLN GLN A . n A 1 26 PRO 26 74 74 PRO PRO A . n A 1 27 ARG 27 75 75 ARG ARG A . n A 1 28 LYS 28 76 76 LYS LYS A . n A 1 29 LYS 29 77 77 LYS LYS A . n A 1 30 ARG 30 78 78 ARG ARG A . n A 1 31 PRO 31 79 79 PRO PRO A . n A 1 32 GLU 32 80 80 GLU GLU A . n A 1 33 ASP 33 81 81 ASP ASP A . n A 1 34 PHE 34 82 82 PHE PHE A . n A 1 35 LYS 35 83 83 LYS LYS A . n A 1 36 PHE 36 84 84 PHE PHE A . n A 1 37 GLY 37 85 85 GLY GLY A . n A 1 38 LYS 38 86 86 LYS LYS A . n A 1 39 ILE 39 87 87 ILE ILE A . n A 1 40 LEU 40 88 88 LEU LEU A . n A 1 41 GLY 41 89 89 GLY GLY A . n A 1 42 GLU 42 90 90 GLU GLU A . n A 1 43 GLY 43 91 91 GLY GLY A . n A 1 44 SER 44 92 92 SER SER A . n A 1 45 PHE 45 93 93 PHE PHE A . n A 1 46 SER 46 94 94 SER SER A . n A 1 47 THR 47 95 95 THR THR A . n A 1 48 VAL 48 96 96 VAL VAL A . n A 1 49 VAL 49 97 97 VAL VAL A . n A 1 50 LEU 50 98 98 LEU LEU A . n A 1 51 ALA 51 99 99 ALA ALA A . n A 1 52 ARG 52 100 100 ARG ARG A . n A 1 53 GLU 53 101 101 GLU GLU A . n A 1 54 LEU 54 102 102 LEU LEU A . n A 1 55 ALA 55 103 103 ALA ALA A . n A 1 56 THR 56 104 104 THR THR A . n A 1 57 SER 57 105 105 SER SER A . n A 1 58 ARG 58 106 106 ARG ARG A . n A 1 59 GLU 59 107 107 GLU GLU A . n A 1 60 TYR 60 108 108 TYR TYR A . n A 1 61 ALA 61 109 109 ALA ALA A . n A 1 62 ILE 62 110 110 ILE ILE A . n A 1 63 LYS 63 111 111 LYS LYS A . n A 1 64 ILE 64 112 112 ILE ILE A . n A 1 65 LEU 65 113 113 LEU LEU A . n A 1 66 GLU 66 114 114 GLU GLU A . n A 1 67 LYS 67 115 115 LYS LYS A . n A 1 68 ARG 68 116 116 ARG ARG A . n A 1 69 HIS 69 117 117 HIS HIS A . n A 1 70 ILE 70 118 118 ILE ILE A . n A 1 71 ILE 71 119 119 ILE ILE A . n A 1 72 LYS 72 120 120 LYS LYS A . n A 1 73 GLU 73 121 121 GLU GLU A . n A 1 74 ASN 74 122 122 ASN ASN A . n A 1 75 LYS 75 123 123 LYS LYS A . n A 1 76 VAL 76 124 124 VAL VAL A . n A 1 77 PRO 77 125 125 PRO PRO A . n A 1 78 TYR 78 126 126 TYR TYR A . n A 1 79 VAL 79 127 127 VAL VAL A . n A 1 80 THR 80 128 128 THR THR A . n A 1 81 ARG 81 129 129 ARG ARG A . n A 1 82 GLU 82 130 130 GLU GLU A . n A 1 83 ARG 83 131 131 ARG ARG A . n A 1 84 ASP 84 132 132 ASP ASP A . n A 1 85 VAL 85 133 133 VAL VAL A . n A 1 86 MET 86 134 134 MET MET A . n A 1 87 SER 87 135 135 SER SER A . n A 1 88 ARG 88 136 136 ARG ARG A . n A 1 89 LEU 89 137 137 LEU LEU A . n A 1 90 ASP 90 138 138 ASP ASP A . n A 1 91 HIS 91 139 139 HIS HIS A . n A 1 92 PRO 92 140 140 PRO PRO A . n A 1 93 PHE 93 141 141 PHE PHE A . n A 1 94 PHE 94 142 142 PHE PHE A . n A 1 95 VAL 95 143 143 VAL VAL A . n A 1 96 LYS 96 144 144 LYS LYS A . n A 1 97 LEU 97 145 145 LEU LEU A . n A 1 98 TYR 98 146 146 TYR TYR A . n A 1 99 PHE 99 147 147 PHE PHE A . n A 1 100 THR 100 148 148 THR THR A . n A 1 101 PHE 101 149 149 PHE PHE A . n A 1 102 GLN 102 150 150 GLN GLN A . n A 1 103 ASP 103 151 151 ASP ASP A . n A 1 104 ASP 104 152 152 ASP ASP A . n A 1 105 GLU 105 153 153 GLU GLU A . n A 1 106 LYS 106 154 154 LYS LYS A . n A 1 107 LEU 107 155 155 LEU LEU A . n A 1 108 TYR 108 156 156 TYR TYR A . n A 1 109 PHE 109 157 157 PHE PHE A . n A 1 110 GLY 110 158 158 GLY GLY A . n A 1 111 LEU 111 159 159 LEU LEU A . n A 1 112 SER 112 160 160 SER SER A . n A 1 113 TYR 113 161 161 TYR TYR A . n A 1 114 ALA 114 162 162 ALA ALA A . n A 1 115 LYS 115 163 163 LYS LYS A . n A 1 116 ASN 116 164 164 ASN ASN A . n A 1 117 GLY 117 165 165 GLY GLY A . n A 1 118 GLU 118 166 166 GLU GLU A . n A 1 119 LEU 119 167 167 LEU LEU A . n A 1 120 LEU 120 168 168 LEU LEU A . n A 1 121 LYS 121 169 169 LYS LYS A . n A 1 122 TYR 122 170 170 TYR TYR A . n A 1 123 ILE 123 171 171 ILE ILE A . n A 1 124 ARG 124 172 172 ARG ARG A . n A 1 125 LYS 125 173 173 LYS LYS A . n A 1 126 ILE 126 174 174 ILE ILE A . n A 1 127 GLY 127 175 175 GLY GLY A . n A 1 128 SER 128 176 176 SER SER A . n A 1 129 PHE 129 177 177 PHE PHE A . n A 1 130 ASP 130 178 178 ASP ASP A . n A 1 131 GLU 131 179 179 GLU GLU A . n A 1 132 THR 132 180 180 THR THR A . n A 1 133 CYS 133 181 181 CYS CYS A . n A 1 134 THR 134 182 182 THR THR A . n A 1 135 ARG 135 183 183 ARG ARG A . n A 1 136 PHE 136 184 184 PHE PHE A . n A 1 137 TYR 137 185 185 TYR TYR A . n A 1 138 THR 138 186 186 THR THR A . n A 1 139 ALA 139 187 187 ALA ALA A . n A 1 140 GLU 140 188 188 GLU GLU A . n A 1 141 ILE 141 189 189 ILE ILE A . n A 1 142 VAL 142 190 190 VAL VAL A . n A 1 143 SER 143 191 191 SER SER A . n A 1 144 ALA 144 192 192 ALA ALA A . n A 1 145 LEU 145 193 193 LEU LEU A . n A 1 146 GLU 146 194 194 GLU GLU A . n A 1 147 TYR 147 195 195 TYR TYR A . n A 1 148 LEU 148 196 196 LEU LEU A . n A 1 149 HIS 149 197 197 HIS HIS A . n A 1 150 GLY 150 198 198 GLY GLY A . n A 1 151 LYS 151 199 199 LYS LYS A . n A 1 152 GLY 152 200 200 GLY GLY A . n A 1 153 ILE 153 201 201 ILE ILE A . n A 1 154 ILE 154 202 202 ILE ILE A . n A 1 155 HIS 155 203 203 HIS HIS A . n A 1 156 ARG 156 204 204 ARG ARG A . n A 1 157 ASP 157 205 205 ASP ASP A . n A 1 158 LEU 158 206 206 LEU LEU A . n A 1 159 LYS 159 207 207 LYS LYS A . n A 1 160 PRO 160 208 208 PRO PRO A . n A 1 161 GLU 161 209 209 GLU GLU A . n A 1 162 ASN 162 210 210 ASN ASN A . n A 1 163 ILE 163 211 211 ILE ILE A . n A 1 164 LEU 164 212 212 LEU LEU A . n A 1 165 LEU 165 213 213 LEU LEU A . n A 1 166 ASN 166 214 214 ASN ASN A . n A 1 167 GLU 167 215 215 GLU GLU A . n A 1 168 ASP 168 216 216 ASP ASP A . n A 1 169 MET 169 217 217 MET MET A . n A 1 170 HIS 170 218 218 HIS HIS A . n A 1 171 ILE 171 219 219 ILE ILE A . n A 1 172 GLN 172 220 220 GLN GLN A . n A 1 173 ILE 173 221 221 ILE ILE A . n A 1 174 THR 174 222 222 THR THR A . n A 1 175 ASP 175 223 223 ASP ASP A . n A 1 176 PHE 176 224 224 PHE PHE A . n A 1 177 GLY 177 225 225 GLY GLY A . n A 1 178 THR 178 226 226 THR THR A . n A 1 179 ALA 179 227 227 ALA ALA A . n A 1 180 LYS 180 228 228 LYS LYS A . n A 1 181 VAL 181 229 229 VAL VAL A . n A 1 182 LEU 182 230 230 LEU LEU A . n A 1 183 SER 183 231 231 SER SER A . n A 1 184 PRO 184 232 ? ? ? A . n A 1 185 GLU 185 233 ? ? ? A . n A 1 186 SER 186 234 ? ? ? A . n A 1 187 LYS 187 235 ? ? ? A . n A 1 188 GLN 188 236 ? ? ? A . n A 1 189 ALA 189 237 ? ? ? A . n A 1 190 ARG 190 238 ? ? ? A . n A 1 191 ALA 191 239 ? ? ? A . n A 1 192 ASN 192 240 240 ASN ASN A . n A 1 193 SEP 193 241 241 SEP SEP A . n A 1 194 PHE 194 242 242 PHE PHE A . n A 1 195 VAL 195 243 243 VAL VAL A . n A 1 196 GLY 196 244 244 GLY GLY A . n A 1 197 THR 197 245 245 THR THR A . n A 1 198 ALA 198 246 246 ALA ALA A . n A 1 199 GLN 199 247 247 GLN GLN A . n A 1 200 TYR 200 248 248 TYR TYR A . n A 1 201 VAL 201 249 249 VAL VAL A . n A 1 202 SER 202 250 250 SER SER A . n A 1 203 PRO 203 251 251 PRO PRO A . n A 1 204 GLU 204 252 252 GLU GLU A . n A 1 205 LEU 205 253 253 LEU LEU A . n A 1 206 LEU 206 254 254 LEU LEU A . n A 1 207 THR 207 255 255 THR THR A . n A 1 208 GLU 208 256 256 GLU GLU A . n A 1 209 LYS 209 257 257 LYS LYS A . n A 1 210 SER 210 258 258 SER SER A . n A 1 211 ALA 211 259 259 ALA ALA A . n A 1 212 CYS 212 260 260 CYS CYS A . n A 1 213 LYS 213 261 261 LYS LYS A . n A 1 214 SER 214 262 262 SER SER A . n A 1 215 SER 215 263 263 SER SER A . n A 1 216 ASP 216 264 264 ASP ASP A . n A 1 217 LEU 217 265 265 LEU LEU A . n A 1 218 TRP 218 266 266 TRP TRP A . n A 1 219 ALA 219 267 267 ALA ALA A . n A 1 220 LEU 220 268 268 LEU LEU A . n A 1 221 GLY 221 269 269 GLY GLY A . n A 1 222 CYS 222 270 270 CYS CYS A . n A 1 223 ILE 223 271 271 ILE ILE A . n A 1 224 ILE 224 272 272 ILE ILE A . n A 1 225 TYR 225 273 273 TYR TYR A . n A 1 226 GLN 226 274 274 GLN GLN A . n A 1 227 LEU 227 275 275 LEU LEU A . n A 1 228 VAL 228 276 276 VAL VAL A . n A 1 229 ALA 229 277 277 ALA ALA A . n A 1 230 GLY 230 278 278 GLY GLY A . n A 1 231 LEU 231 279 279 LEU LEU A . n A 1 232 PRO 232 280 280 PRO PRO A . n A 1 233 PRO 233 281 281 PRO PRO A . n A 1 234 PHE 234 282 282 PHE PHE A . n A 1 235 ARG 235 283 283 ARG ARG A . n A 1 236 ALA 236 284 284 ALA ALA A . n A 1 237 GLY 237 285 285 GLY GLY A . n A 1 238 ASN 238 286 286 ASN ASN A . n A 1 239 GLU 239 287 287 GLU GLU A . n A 1 240 TYR 240 288 288 TYR TYR A . n A 1 241 LEU 241 289 289 LEU LEU A . n A 1 242 ILE 242 290 290 ILE ILE A . n A 1 243 PHE 243 291 291 PHE PHE A . n A 1 244 GLN 244 292 292 GLN GLN A . n A 1 245 LYS 245 293 293 LYS LYS A . n A 1 246 ILE 246 294 294 ILE ILE A . n A 1 247 ILE 247 295 295 ILE ILE A . n A 1 248 LYS 248 296 296 LYS LYS A . n A 1 249 LEU 249 297 297 LEU LEU A . n A 1 250 GLU 250 298 298 GLU GLU A . n A 1 251 TYR 251 299 299 TYR TYR A . n A 1 252 ASP 252 300 300 ASP ASP A . n A 1 253 PHE 253 301 301 PHE PHE A . n A 1 254 PRO 254 302 302 PRO PRO A . n A 1 255 GLU 255 303 303 GLU GLU A . n A 1 256 LYS 256 304 304 LYS LYS A . n A 1 257 PHE 257 305 305 PHE PHE A . n A 1 258 PHE 258 306 306 PHE PHE A . n A 1 259 PRO 259 307 307 PRO PRO A . n A 1 260 LYS 260 308 308 LYS LYS A . n A 1 261 ALA 261 309 309 ALA ALA A . n A 1 262 ARG 262 310 310 ARG ARG A . n A 1 263 ASP 263 311 311 ASP ASP A . n A 1 264 LEU 264 312 312 LEU LEU A . n A 1 265 VAL 265 313 313 VAL VAL A . n A 1 266 GLU 266 314 314 GLU GLU A . n A 1 267 LYS 267 315 315 LYS LYS A . n A 1 268 LEU 268 316 316 LEU LEU A . n A 1 269 LEU 269 317 317 LEU LEU A . n A 1 270 VAL 270 318 318 VAL VAL A . n A 1 271 LEU 271 319 319 LEU LEU A . n A 1 272 ASP 272 320 320 ASP ASP A . n A 1 273 ALA 273 321 321 ALA ALA A . n A 1 274 THR 274 322 322 THR THR A . n A 1 275 LYS 275 323 323 LYS LYS A . n A 1 276 ARG 276 324 324 ARG ARG A . n A 1 277 LEU 277 325 325 LEU LEU A . n A 1 278 GLY 278 326 326 GLY GLY A . n A 1 279 CYS 279 327 327 CYS CYS A . n A 1 280 GLU 280 328 328 GLU GLU A . n A 1 281 GLU 281 329 329 GLU GLU A . n A 1 282 MET 282 330 330 MET MET A . n A 1 283 GLU 283 331 331 GLU GLU A . n A 1 284 GLY 284 332 332 GLY GLY A . n A 1 285 TYR 285 333 333 TYR TYR A . n A 1 286 GLY 286 334 334 GLY GLY A . n A 1 287 PRO 287 335 335 PRO PRO A . n A 1 288 LEU 288 336 336 LEU LEU A . n A 1 289 LYS 289 337 337 LYS LYS A . n A 1 290 ALA 290 338 338 ALA ALA A . n A 1 291 HIS 291 339 339 HIS HIS A . n A 1 292 PRO 292 340 340 PRO PRO A . n A 1 293 PHE 293 341 341 PHE PHE A . n A 1 294 PHE 294 342 342 PHE PHE A . n A 1 295 GLU 295 343 343 GLU GLU A . n A 1 296 SER 296 344 344 SER SER A . n A 1 297 VAL 297 345 345 VAL VAL A . n A 1 298 THR 298 346 346 THR THR A . n A 1 299 TRP 299 347 347 TRP TRP A . n A 1 300 GLU 300 348 348 GLU GLU A . n A 1 301 ASN 301 349 349 ASN ASN A . n A 1 302 LEU 302 350 350 LEU LEU A . n A 1 303 HIS 303 351 351 HIS HIS A . n A 1 304 GLN 304 352 352 GLN GLN A . n A 1 305 GLN 305 353 353 GLN GLN A . n A 1 306 THR 306 354 354 THR THR A . n A 1 307 PRO 307 355 355 PRO PRO A . n A 1 308 PRO 308 356 356 PRO PRO A . n A 1 309 LYS 309 357 357 LYS LYS A . n A 1 310 LEU 310 358 358 LEU LEU A . n A 1 311 THR 311 359 359 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 3S1 1 900 900 3S1 3S1 A . C 3 SO4 1 901 901 SO4 SO4 A . D 3 SO4 1 902 902 SO4 SO4 A . E 3 SO4 1 903 903 SO4 SO4 A . F 3 SO4 1 904 904 SO4 SO4 A . G 4 GOL 1 905 905 GOL GOL A . H 4 GOL 1 906 906 GOL GOL A . I 5 HOH 1 1 1 HOH HOH A . I 5 HOH 2 2 2 HOH HOH A . I 5 HOH 3 3 3 HOH HOH A . I 5 HOH 4 4 4 HOH HOH A . I 5 HOH 5 5 5 HOH HOH A . I 5 HOH 6 6 6 HOH HOH A . I 5 HOH 7 7 7 HOH HOH A . I 5 HOH 8 8 8 HOH HOH A . I 5 HOH 9 9 9 HOH HOH A . I 5 HOH 10 10 10 HOH HOH A . I 5 HOH 11 11 11 HOH HOH A . I 5 HOH 12 12 12 HOH HOH A . I 5 HOH 13 13 13 HOH HOH A . I 5 HOH 14 14 14 HOH HOH A . I 5 HOH 15 15 15 HOH HOH A . I 5 HOH 16 16 16 HOH HOH A . I 5 HOH 17 17 17 HOH HOH A . I 5 HOH 18 18 18 HOH HOH A . I 5 HOH 19 19 19 HOH HOH A . I 5 HOH 20 20 20 HOH HOH A . I 5 HOH 21 21 21 HOH HOH A . I 5 HOH 22 22 22 HOH HOH A . I 5 HOH 23 23 23 HOH HOH A . I 5 HOH 24 24 24 HOH HOH A . I 5 HOH 25 25 25 HOH HOH A . I 5 HOH 26 26 26 HOH HOH A . I 5 HOH 27 27 27 HOH HOH A . I 5 HOH 28 28 28 HOH HOH A . I 5 HOH 29 29 29 HOH HOH A . I 5 HOH 30 30 30 HOH HOH A . I 5 HOH 31 31 31 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 193 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 241 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details PHOSPHOSERINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G,H,I 2 1,2 A,B,C,D,E,F,G,H,I # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 4840 ? 2 MORE -142 ? 2 'SSA (A^2)' 24540 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 47.2950000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-10-26 2 'Structure model' 1 1 2017-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 REFMAC refinement . ? 2 ARP 'model building' . ? 3 WARP 'model building' . ? 4 CNS refinement . ? 5 HKL-2000 'data reduction' . ? 6 HKL-2000 'data scaling' . ? 7 REFMAC phasing . ? 8 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 303 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 303 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 1.94 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 86 ? ? -18.03 132.06 2 1 ASP A 151 ? ? -104.99 -157.22 3 1 SER A 176 ? ? 177.23 162.88 4 1 ARG A 204 ? ? 80.48 -8.67 5 1 ASP A 205 ? ? -149.42 43.99 6 1 ASP A 223 ? ? 82.13 80.63 7 1 PHE A 242 ? ? 77.00 47.69 8 1 LYS A 257 ? ? 53.90 16.71 9 1 GLU A 331 ? ? 82.35 14.74 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 49 ? A GLY 1 2 1 Y 1 A ALA 50 ? A ALA 2 3 1 Y 1 A MET 51 ? A MET 3 4 1 Y 1 A ASP 52 ? A ASP 4 5 1 Y 1 A GLY 53 ? A GLY 5 6 1 Y 1 A THR 54 ? A THR 6 7 1 Y 1 A ALA 55 ? A ALA 7 8 1 Y 1 A ALA 56 ? A ALA 8 9 1 Y 1 A GLU 57 ? A GLU 9 10 1 Y 1 A PRO 58 ? A PRO 10 11 1 Y 1 A ARG 59 ? A ARG 11 12 1 Y 1 A PRO 60 ? A PRO 12 13 1 Y 1 A GLY 61 ? A GLY 13 14 1 Y 1 A ALA 62 ? A ALA 14 15 1 Y 1 A GLY 63 ? A GLY 15 16 1 Y 1 A SER 64 ? A SER 16 17 1 Y 1 A LEU 65 ? A LEU 17 18 1 Y 1 A GLN 66 ? A GLN 18 19 1 Y 1 A HIS 67 ? A HIS 19 20 1 Y 1 A ALA 68 ? A ALA 20 21 1 Y 1 A GLN 69 ? A GLN 21 22 1 Y 1 A PRO 70 ? A PRO 22 23 1 Y 1 A PRO 71 ? A PRO 23 24 1 Y 1 A PRO 72 ? A PRO 24 25 1 Y 1 A PRO 232 ? A PRO 184 26 1 Y 1 A GLU 233 ? A GLU 185 27 1 Y 1 A SER 234 ? A SER 186 28 1 Y 1 A LYS 235 ? A LYS 187 29 1 Y 1 A GLN 236 ? A GLN 188 30 1 Y 1 A ALA 237 ? A ALA 189 31 1 Y 1 A ARG 238 ? A ARG 190 32 1 Y 1 A ALA 239 ? A ALA 191 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '6-[2-(hydroxymethyl)phenyl]isoquinolin-1(2H)-one' 3S1 3 'SULFATE ION' SO4 4 GLYCEROL GOL 5 water HOH #