data_3SNK # _entry.id 3SNK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.365 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3SNK pdb_00003snk 10.2210/pdb3snk/pdb RCSB RCSB066422 ? ? WWPDB D_1000066422 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 423092 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.SG_entry Y _pdbx_database_status.entry_id 3SNK _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-06-29 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Crystal structure of a Response regulator CheY-like protein (mll6475) from MESORHIZOBIUM LOTI at 2.02 A resolution' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Joint Center for Structural Genomics (JCSG)' 1 ? primary 'Shapiro, L.' 2 ? # _cell.entry_id 3SNK _cell.length_a 64.859 _cell.length_b 64.859 _cell.length_c 69.982 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 6 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3SNK _symmetry.Int_Tables_number 154 _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Response regulator CheY-like protein' 14790.498 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 33 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Pilus assembly protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;G(MSE)NAINTKVTPTKRKQVALFSSDPNFKRDVATRLDALAIYDVRVSETDDFLKGPPADTRPGIVILDLGGGDLLGKP GIVEARALWATVPLIAVSDELTSEQTRVLVR(MSE)NASDWLHKPLDGKELLNAVTFHDTGNQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GMNAINTKVTPTKRKQVALFSSDPNFKRDVATRLDALAIYDVRVSETDDFLKGPPADTRPGIVILDLGGGDLLGKPGIVE ARALWATVPLIAVSDELTSEQTRVLVRMNASDWLHKPLDGKELLNAVTFHDTGNQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 423092 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MSE n 1 3 ASN n 1 4 ALA n 1 5 ILE n 1 6 ASN n 1 7 THR n 1 8 LYS n 1 9 VAL n 1 10 THR n 1 11 PRO n 1 12 THR n 1 13 LYS n 1 14 ARG n 1 15 LYS n 1 16 GLN n 1 17 VAL n 1 18 ALA n 1 19 LEU n 1 20 PHE n 1 21 SER n 1 22 SER n 1 23 ASP n 1 24 PRO n 1 25 ASN n 1 26 PHE n 1 27 LYS n 1 28 ARG n 1 29 ASP n 1 30 VAL n 1 31 ALA n 1 32 THR n 1 33 ARG n 1 34 LEU n 1 35 ASP n 1 36 ALA n 1 37 LEU n 1 38 ALA n 1 39 ILE n 1 40 TYR n 1 41 ASP n 1 42 VAL n 1 43 ARG n 1 44 VAL n 1 45 SER n 1 46 GLU n 1 47 THR n 1 48 ASP n 1 49 ASP n 1 50 PHE n 1 51 LEU n 1 52 LYS n 1 53 GLY n 1 54 PRO n 1 55 PRO n 1 56 ALA n 1 57 ASP n 1 58 THR n 1 59 ARG n 1 60 PRO n 1 61 GLY n 1 62 ILE n 1 63 VAL n 1 64 ILE n 1 65 LEU n 1 66 ASP n 1 67 LEU n 1 68 GLY n 1 69 GLY n 1 70 GLY n 1 71 ASP n 1 72 LEU n 1 73 LEU n 1 74 GLY n 1 75 LYS n 1 76 PRO n 1 77 GLY n 1 78 ILE n 1 79 VAL n 1 80 GLU n 1 81 ALA n 1 82 ARG n 1 83 ALA n 1 84 LEU n 1 85 TRP n 1 86 ALA n 1 87 THR n 1 88 VAL n 1 89 PRO n 1 90 LEU n 1 91 ILE n 1 92 ALA n 1 93 VAL n 1 94 SER n 1 95 ASP n 1 96 GLU n 1 97 LEU n 1 98 THR n 1 99 SER n 1 100 GLU n 1 101 GLN n 1 102 THR n 1 103 ARG n 1 104 VAL n 1 105 LEU n 1 106 VAL n 1 107 ARG n 1 108 MSE n 1 109 ASN n 1 110 ALA n 1 111 SER n 1 112 ASP n 1 113 TRP n 1 114 LEU n 1 115 HIS n 1 116 LYS n 1 117 PRO n 1 118 LEU n 1 119 ASP n 1 120 GLY n 1 121 LYS n 1 122 GLU n 1 123 LEU n 1 124 LEU n 1 125 ASN n 1 126 ALA n 1 127 VAL n 1 128 THR n 1 129 PHE n 1 130 HIS n 1 131 ASP n 1 132 THR n 1 133 GLY n 1 134 ASN n 1 135 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene mll6475 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mesorhizobium loti' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 381 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia Coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HK100 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q989D4_RHILO _struct_ref.pdbx_db_accession Q989D4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNAINTKVTPTKRKQVALFSSDPNFKRDVATRLDALAIYDVRVSETDDFLKGPPADTRPGIVILDLGGGDLLGKPGIVEA RALWATVPLIAVSDELTSEQTRVLVRMNASDWLHKPLDGKELLNAVTFHDTGNQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3SNK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 135 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q989D4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3SNK _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q989D4 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 3SNK # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.87 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 57.19 _exptl_crystal.description 'DATA WERE SCALED USING XSCALE WITH FRIEDEL PAIRS KEPT AS SEPARATE WHEN COMPUTING R MERGE, COMPLETENESS AND ' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details '2.0% polyethylene glycol 400, 2.0M ammonium sulfate, 0.1M HEPES pH 7.5, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.details 'Rhodium-coated vertical and horizontal focusing mirrors; liquid-nitrogen cooled double crystal Si(111) monochromator' _diffrn_detector.pdbx_collection_date 2011-06-21 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.pdbx_wavelength 0.9791 _diffrn_source.pdbx_wavelength_list ? _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.entry_id 3SNK _reflns.d_resolution_high 2.02 _reflns.d_resolution_low 43.805 _reflns.number_obs 11550 _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_netI_over_sigmaI 18.050 _reflns.percent_possible_obs 99.700 _reflns.B_iso_Wilson_estimate 44.186 _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.020 2.090 21507 ? 2063 0.969 2.7 ? ? ? ? ? 98.800 1 1 2.090 2.180 26243 ? 2309 0.644 4.4 ? ? ? ? ? 99.700 2 1 2.180 2.270 21991 ? 1959 0.464 6.3 ? ? ? ? ? 99.300 3 1 2.270 2.390 27209 ? 2185 0.390 8.4 ? ? ? ? ? 99.800 4 1 2.390 2.540 30209 ? 2152 0.227 13.0 ? ? ? ? ? 99.700 5 1 2.540 2.740 31728 ? 2207 0.161 17.1 ? ? ? ? ? 99.900 6 1 2.740 3.020 30708 ? 2187 0.116 22.4 ? ? ? ? ? 99.700 7 1 3.020 3.450 26614 ? 2132 0.082 29.2 ? ? ? ? ? 100.000 8 1 3.450 4.340 29119 ? 2177 0.064 36.7 ? ? ? ? ? 100.000 9 1 4.340 ? 28813 ? 2186 0.056 39.2 ? ? ? ? ? 99.900 10 1 # _refine.entry_id 3SNK _refine.ls_d_res_high 2.0200 _refine.ls_d_res_low 43.805 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs ? _refine.ls_number_reflns_obs 11480 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;1. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 2. SULFATE (SO4) MODELED ARE PRESENT IN CRYO CONDITION. 3. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS. ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1988 _refine.ls_R_factor_R_work 0.1977 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2221 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.8200 _refine.ls_number_reflns_R_free 553 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 63.9552 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 5.9033 _refine.aniso_B[2][2] 5.9033 _refine.aniso_B[3][3] -11.8066 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9542 _refine.correlation_coeff_Fo_to_Fc_free 0.9504 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 133.620 _refine.B_iso_min 21.960 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.500 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 902 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 940 _refine_hist.d_res_high 2.0200 _refine_hist.d_res_low 43.805 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id t_dihedral_angle_d 429 ? ? 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' t_trig_c_planes 22 ? ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_gen_planes 137 ? ? 5.000 HARMONIC 'X-RAY DIFFRACTION' t_it 932 ? ? 20.000 HARMONIC 'X-RAY DIFFRACTION' t_nbd ? ? ? ? ? 'X-RAY DIFFRACTION' t_improper_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_pseud_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_chiral_improper_torsion 124 ? ? 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_sum_occupancies ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_distance ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_ideal_dist_contact 1059 ? ? 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_bond_d 932 0.010 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_angle_deg 1273 1.040 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_omega_torsion ? 3.270 ? ? ? 'X-RAY DIFFRACTION' t_other_torsion ? 2.920 ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.0200 _refine_ls_shell.d_res_low 2.2100 _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.number_reflns_R_work 2555 _refine_ls_shell.R_factor_all 0.2529 _refine_ls_shell.R_factor_R_work 0.2528 _refine_ls_shell.R_factor_R_free 0.2556 _refine_ls_shell.percent_reflns_R_free 4.5600 _refine_ls_shell.number_reflns_R_free 122 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2677 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3SNK _struct.title 'Crystal structure of a Response regulator CheY-like protein (mll6475) from MESORHIZOBIUM LOTI at 2.02 A resolution' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;P-loop containing nucleoside triphosphate hydrolases, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SIGNALING PROTEIN ; _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.entry_id 3SNK # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 23 ? LEU A 37 ? ASP A 22 LEU A 36 1 ? 15 HELX_P HELX_P2 2 GLU A 46 ? GLY A 53 ? GLU A 45 GLY A 52 5 ? 8 HELX_P HELX_P3 3 GLY A 70 ? LYS A 75 ? GLY A 69 LYS A 74 5 ? 6 HELX_P HELX_P4 4 GLY A 77 ? ALA A 83 ? GLY A 76 ALA A 82 1 ? 7 HELX_P HELX_P5 5 LEU A 84 ? ALA A 86 ? LEU A 83 ALA A 85 5 ? 3 HELX_P HELX_P6 6 THR A 98 ? MSE A 108 ? THR A 97 MSE A 107 1 ? 11 HELX_P HELX_P7 7 ASP A 119 ? HIS A 130 ? ASP A 118 HIS A 129 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ARG 107 C ? ? ? 1_555 A MSE 108 N ? ? A ARG 106 A MSE 107 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale2 covale both ? A MSE 108 C ? ? ? 1_555 A ASN 109 N ? ? A MSE 107 A ASN 108 1_555 ? ? ? ? ? ? ? 1.335 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 116 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 115 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 117 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 116 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.28 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 40 ? SER A 45 ? TYR A 39 SER A 44 A 2 LYS A 15 ? PHE A 20 ? LYS A 14 PHE A 19 A 3 ILE A 62 ? GLY A 68 ? ILE A 61 GLY A 67 A 4 LEU A 90 ? SER A 94 ? LEU A 89 SER A 93 A 5 ASP A 112 ? HIS A 115 ? ASP A 111 HIS A 114 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 43 ? O ARG A 42 N VAL A 17 ? N VAL A 16 A 2 3 N PHE A 20 ? N PHE A 19 O ASP A 66 ? O ASP A 65 A 3 4 N LEU A 67 ? N LEU A 66 O VAL A 93 ? O VAL A 92 A 4 5 N ALA A 92 ? N ALA A 91 O LEU A 114 ? O LEU A 113 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 135 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 135' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ARG A 14 ? ARG A 13 . ? 1_555 ? 2 AC1 2 GLU A 100 ? GLU A 99 . ? 2_654 ? # _atom_sites.entry_id 3SNK _atom_sites.fract_transf_matrix[1][1] 0.015418 _atom_sites.fract_transf_matrix[1][2] 0.008902 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017803 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014289 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MSE 2 1 ? ? ? A . n A 1 3 ASN 3 2 ? ? ? A . n A 1 4 ALA 4 3 ? ? ? A . n A 1 5 ILE 5 4 ? ? ? A . n A 1 6 ASN 6 5 ? ? ? A . n A 1 7 THR 7 6 ? ? ? A . n A 1 8 LYS 8 7 ? ? ? A . n A 1 9 VAL 9 8 ? ? ? A . n A 1 10 THR 10 9 ? ? ? A . n A 1 11 PRO 11 10 ? ? ? A . n A 1 12 THR 12 11 ? ? ? A . n A 1 13 LYS 13 12 12 LYS LYS A . n A 1 14 ARG 14 13 13 ARG ARG A . n A 1 15 LYS 15 14 14 LYS LYS A . n A 1 16 GLN 16 15 15 GLN GLN A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 ALA 18 17 17 ALA ALA A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 PHE 20 19 19 PHE PHE A . n A 1 21 SER 21 20 20 SER SER A . n A 1 22 SER 22 21 21 SER SER A . n A 1 23 ASP 23 22 22 ASP ASP A . n A 1 24 PRO 24 23 23 PRO PRO A . n A 1 25 ASN 25 24 24 ASN ASN A . n A 1 26 PHE 26 25 25 PHE PHE A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 ARG 28 27 27 ARG ARG A . n A 1 29 ASP 29 28 28 ASP ASP A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 THR 32 31 31 THR THR A . n A 1 33 ARG 33 32 32 ARG ARG A . n A 1 34 LEU 34 33 33 LEU LEU A . n A 1 35 ASP 35 34 34 ASP ASP A . n A 1 36 ALA 36 35 35 ALA ALA A . n A 1 37 LEU 37 36 36 LEU LEU A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 ILE 39 38 38 ILE ILE A . n A 1 40 TYR 40 39 39 TYR TYR A . n A 1 41 ASP 41 40 40 ASP ASP A . n A 1 42 VAL 42 41 41 VAL VAL A . n A 1 43 ARG 43 42 42 ARG ARG A . n A 1 44 VAL 44 43 43 VAL VAL A . n A 1 45 SER 45 44 44 SER SER A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 ASP 48 47 47 ASP ASP A . n A 1 49 ASP 49 48 48 ASP ASP A . n A 1 50 PHE 50 49 49 PHE PHE A . n A 1 51 LEU 51 50 50 LEU LEU A . n A 1 52 LYS 52 51 51 LYS LYS A . n A 1 53 GLY 53 52 52 GLY GLY A . n A 1 54 PRO 54 53 53 PRO PRO A . n A 1 55 PRO 55 54 54 PRO PRO A . n A 1 56 ALA 56 55 55 ALA ALA A . n A 1 57 ASP 57 56 56 ASP ASP A . n A 1 58 THR 58 57 57 THR THR A . n A 1 59 ARG 59 58 58 ARG ARG A . n A 1 60 PRO 60 59 59 PRO PRO A . n A 1 61 GLY 61 60 60 GLY GLY A . n A 1 62 ILE 62 61 61 ILE ILE A . n A 1 63 VAL 63 62 62 VAL VAL A . n A 1 64 ILE 64 63 63 ILE ILE A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 LEU 67 66 66 LEU LEU A . n A 1 68 GLY 68 67 67 GLY GLY A . n A 1 69 GLY 69 68 68 GLY GLY A . n A 1 70 GLY 70 69 69 GLY GLY A . n A 1 71 ASP 71 70 70 ASP ASP A . n A 1 72 LEU 72 71 71 LEU LEU A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 LYS 75 74 74 LYS LYS A . n A 1 76 PRO 76 75 75 PRO PRO A . n A 1 77 GLY 77 76 76 GLY GLY A . n A 1 78 ILE 78 77 77 ILE ILE A . n A 1 79 VAL 79 78 78 VAL VAL A . n A 1 80 GLU 80 79 79 GLU GLU A . n A 1 81 ALA 81 80 80 ALA ALA A . n A 1 82 ARG 82 81 81 ARG ARG A . n A 1 83 ALA 83 82 82 ALA ALA A . n A 1 84 LEU 84 83 83 LEU LEU A . n A 1 85 TRP 85 84 84 TRP TRP A . n A 1 86 ALA 86 85 85 ALA ALA A . n A 1 87 THR 87 86 86 THR THR A . n A 1 88 VAL 88 87 87 VAL VAL A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 ILE 91 90 90 ILE ILE A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 VAL 93 92 92 VAL VAL A . n A 1 94 SER 94 93 93 SER SER A . n A 1 95 ASP 95 94 94 ASP ASP A . n A 1 96 GLU 96 95 95 GLU GLU A . n A 1 97 LEU 97 96 96 LEU LEU A . n A 1 98 THR 98 97 97 THR THR A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 GLU 100 99 99 GLU GLU A . n A 1 101 GLN 101 100 100 GLN GLN A . n A 1 102 THR 102 101 101 THR THR A . n A 1 103 ARG 103 102 102 ARG ARG A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 VAL 106 105 105 VAL VAL A . n A 1 107 ARG 107 106 106 ARG ARG A . n A 1 108 MSE 108 107 107 MSE MSE A . n A 1 109 ASN 109 108 108 ASN ASN A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 SER 111 110 110 SER SER A . n A 1 112 ASP 112 111 111 ASP ASP A . n A 1 113 TRP 113 112 112 TRP TRP A . n A 1 114 LEU 114 113 113 LEU LEU A . n A 1 115 HIS 115 114 114 HIS HIS A . n A 1 116 LYS 116 115 115 LYS LYS A . n A 1 117 PRO 117 116 116 PRO PRO A . n A 1 118 LEU 118 117 117 LEU LEU A . n A 1 119 ASP 119 118 118 ASP ASP A . n A 1 120 GLY 120 119 119 GLY GLY A . n A 1 121 LYS 121 120 120 LYS LYS A . n A 1 122 GLU 122 121 121 GLU GLU A . n A 1 123 LEU 123 122 122 LEU LEU A . n A 1 124 LEU 124 123 123 LEU LEU A . n A 1 125 ASN 125 124 124 ASN ASN A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 VAL 127 126 126 VAL VAL A . n A 1 128 THR 128 127 127 THR THR A . n A 1 129 PHE 129 128 128 PHE PHE A . n A 1 130 HIS 130 129 129 HIS HIS A . n A 1 131 ASP 131 130 130 ASP ASP A . n A 1 132 THR 132 131 ? ? ? A . n A 1 133 GLY 133 132 ? ? ? A . n A 1 134 ASN 134 133 ? ? ? A . n A 1 135 GLN 135 134 ? ? ? A . n # _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 135 1 SO4 SO4 A . C 3 HOH 1 136 2 HOH HOH A . C 3 HOH 2 137 3 HOH HOH A . C 3 HOH 3 138 4 HOH HOH A . C 3 HOH 4 139 5 HOH HOH A . C 3 HOH 5 140 6 HOH HOH A . C 3 HOH 6 141 7 HOH HOH A . C 3 HOH 7 142 8 HOH HOH A . C 3 HOH 8 143 9 HOH HOH A . C 3 HOH 9 144 10 HOH HOH A . C 3 HOH 10 145 11 HOH HOH A . C 3 HOH 11 146 12 HOH HOH A . C 3 HOH 12 147 13 HOH HOH A . C 3 HOH 13 148 14 HOH HOH A . C 3 HOH 14 149 15 HOH HOH A . C 3 HOH 15 150 16 HOH HOH A . C 3 HOH 16 151 17 HOH HOH A . C 3 HOH 17 152 18 HOH HOH A . C 3 HOH 18 153 19 HOH HOH A . C 3 HOH 19 154 20 HOH HOH A . C 3 HOH 20 155 21 HOH HOH A . C 3 HOH 21 156 22 HOH HOH A . C 3 HOH 22 157 23 HOH HOH A . C 3 HOH 23 158 24 HOH HOH A . C 3 HOH 24 159 25 HOH HOH A . C 3 HOH 25 160 26 HOH HOH A . C 3 HOH 26 161 27 HOH HOH A . C 3 HOH 27 162 28 HOH HOH A . C 3 HOH 28 163 29 HOH HOH A . C 3 HOH 29 164 30 HOH HOH A . C 3 HOH 30 165 31 HOH HOH A . C 3 HOH 31 166 32 HOH HOH A . C 3 HOH 32 167 33 HOH HOH A . C 3 HOH 33 168 34 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 108 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 107 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 138 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-07-20 2 'Structure model' 1 1 2012-03-21 3 'Structure model' 1 2 2017-11-08 4 'Structure model' 1 3 2018-01-24 5 'Structure model' 1 4 2023-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' citation_author 3 5 'Structure model' database_2 4 5 'Structure model' struct_conn 5 5 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation_author.name' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 5 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 24.3851 _pdbx_refine_tls.origin_y 21.0972 _pdbx_refine_tls.origin_z 27.0893 _pdbx_refine_tls.T[1][1] -0.0157 _pdbx_refine_tls.T[2][2] -0.0827 _pdbx_refine_tls.T[3][3] -0.1057 _pdbx_refine_tls.T[1][2] 0.1635 _pdbx_refine_tls.T[1][3] 0.1304 _pdbx_refine_tls.T[2][3] 0.1070 _pdbx_refine_tls.L[1][1] 5.1545 _pdbx_refine_tls.L[2][2] 5.5678 _pdbx_refine_tls.L[3][3] 2.7507 _pdbx_refine_tls.L[1][2] -2.5382 _pdbx_refine_tls.L[1][3] -1.0535 _pdbx_refine_tls.L[2][3] 1.7755 _pdbx_refine_tls.S[1][1] 0.0515 _pdbx_refine_tls.S[2][2] -0.2424 _pdbx_refine_tls.S[3][3] 0.1909 _pdbx_refine_tls.S[1][2] 0.0157 _pdbx_refine_tls.S[1][3] 0.0203 _pdbx_refine_tls.S[2][3] -0.3574 _pdbx_refine_tls.S[2][1] -0.5653 _pdbx_refine_tls.S[3][1] 0.1312 _pdbx_refine_tls.S[3][2] 0.3480 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 12 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 130 _pdbx_refine_tls_group.selection_details '{ A|12 - 130 }' _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # _phasing.method SAD # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 MolProbity 3beta29 ? package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building' http://kinemage.biochem.duke.edu/molprobity/ ? ? 2 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 3 SHELX . ? package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de phasing http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 4 SHARP . ? package 'Eric de La Fortelle' sharp-develop@globalphasing.com phasing http://www.globalphasing.com/sharp/ ? ? 5 XSCALE 'December 6, 2010' ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 6 BUSTER-TNT 2.8.0 ? program 'Gerard Bricogne' buster-develop@GlobalPhasing.com refinement http://www.globalphasing.com/buster/ ? ? 7 XDS . ? ? ? ? 'data reduction' ? ? ? 8 SHELXD . ? ? ? ? phasing ? ? ? 9 BUSTER 2.8.0 ? ? ? ? refinement ? ? ? # _pdbx_entry_details.entry_id 3SNK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE CONSTRUCT (RESIDUES 1-134) WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 37 ? ? 61.14 -19.37 2 1 ALA A 85 ? ? 51.83 -135.52 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 12 ? CG ? A LYS 13 CG 2 1 Y 1 A LYS 12 ? CD ? A LYS 13 CD 3 1 Y 1 A LYS 12 ? CE ? A LYS 13 CE 4 1 Y 1 A LYS 12 ? NZ ? A LYS 13 NZ 5 1 Y 1 A GLU 45 ? CG ? A GLU 46 CG 6 1 Y 1 A GLU 45 ? CD ? A GLU 46 CD 7 1 Y 1 A GLU 45 ? OE1 ? A GLU 46 OE1 8 1 Y 1 A GLU 45 ? OE2 ? A GLU 46 OE2 9 1 Y 1 A ARG 58 ? CG ? A ARG 59 CG 10 1 Y 1 A ARG 58 ? CD ? A ARG 59 CD 11 1 Y 1 A ARG 58 ? NE ? A ARG 59 NE 12 1 Y 1 A ARG 58 ? CZ ? A ARG 59 CZ 13 1 Y 1 A ARG 58 ? NH1 ? A ARG 59 NH1 14 1 Y 1 A ARG 58 ? NH2 ? A ARG 59 NH2 15 1 Y 1 A LYS 120 ? CG ? A LYS 121 CG 16 1 Y 1 A LYS 120 ? CD ? A LYS 121 CD 17 1 Y 1 A LYS 120 ? CE ? A LYS 121 CE 18 1 Y 1 A LYS 120 ? NZ ? A LYS 121 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MSE 1 ? A MSE 2 3 1 Y 1 A ASN 2 ? A ASN 3 4 1 Y 1 A ALA 3 ? A ALA 4 5 1 Y 1 A ILE 4 ? A ILE 5 6 1 Y 1 A ASN 5 ? A ASN 6 7 1 Y 1 A THR 6 ? A THR 7 8 1 Y 1 A LYS 7 ? A LYS 8 9 1 Y 1 A VAL 8 ? A VAL 9 10 1 Y 1 A THR 9 ? A THR 10 11 1 Y 1 A PRO 10 ? A PRO 11 12 1 Y 1 A THR 11 ? A THR 12 13 1 Y 1 A THR 131 ? A THR 132 14 1 Y 1 A GLY 132 ? A GLY 133 15 1 Y 1 A ASN 133 ? A ASN 134 16 1 Y 1 A GLN 134 ? A GLN 135 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #