data_3SP5 # _entry.id 3SP5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3SP5 pdb_00003sp5 10.2210/pdb3sp5/pdb RCSB RCSB066478 ? ? WWPDB D_1000066478 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2O98 'Structure of the 14-3-3 / H+-ATPase plant complex' unspecified PDB 3LW1 'Binary complex of 14-3-3 sigma and p53 pT387-peptide' unspecified PDB 3IQU 'Crystal Structure of human 14-3-3 sigma in Complex with Raf1 peptide (6mer)' unspecified # _pdbx_database_status.entry_id 3SP5 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-07-01 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Anders, C.' 1 'Schumacher, B.' 2 'Ottmann, C.' 3 # _citation.id primary _citation.title ;A semisynthetic fusicoccane stabilizes a protein-protein interaction and enhances the expression of K+ channels at the cell surface. ; _citation.journal_abbrev Chem.Biol. _citation.journal_volume 20 _citation.page_first 583 _citation.page_last 593 _citation.year 2013 _citation.journal_id_ASTM CBOLE2 _citation.country UK _citation.journal_id_ISSN 1074-5521 _citation.journal_id_CSD 2050 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23601647 _citation.pdbx_database_id_DOI 10.1016/j.chembiol.2013.03.015 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Anders, C.' 1 ? primary 'Higuchi, Y.' 2 ? primary 'Koschinsky, K.' 3 ? primary 'Bartel, M.' 4 ? primary 'Schumacher, B.' 5 ? primary 'Thiel, P.' 6 ? primary 'Nitta, H.' 7 ? primary 'Preisig-Muller, R.' 8 ? primary 'Schlichthorl, G.' 9 ? primary 'Renigunta, V.' 10 ? primary 'Ohkanda, J.' 11 ? primary 'Daut, J.' 12 ? primary 'Kato, N.' 13 ? primary 'Ottmann, C.' 14 ? # _cell.entry_id 3SP5 _cell.length_a 81.800 _cell.length_b 111.560 _cell.length_c 62.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3SP5 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein sigma' 26505.896 1 ? 'C38V N166H' ? ? 2 polymer syn 'TASK-3 peptide' 856.950 1 ? ? ? ? 3 non-polymer syn Cotylenol 350.492 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 5 water nat water 18.015 305 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Epithelial cell marker protein 1, Stratifin' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;AMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSVEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEE KGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMD ISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; ;AMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSVEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEE KGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMD ISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; A ? 2 'polypeptide(L)' no yes 'KRRK(SEP)V' KRRKSV P ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 GLU n 1 7 ARG n 1 8 ALA n 1 9 SER n 1 10 LEU n 1 11 ILE n 1 12 GLN n 1 13 LYS n 1 14 ALA n 1 15 LYS n 1 16 LEU n 1 17 ALA n 1 18 GLU n 1 19 GLN n 1 20 ALA n 1 21 GLU n 1 22 ARG n 1 23 TYR n 1 24 GLU n 1 25 ASP n 1 26 MET n 1 27 ALA n 1 28 ALA n 1 29 PHE n 1 30 MET n 1 31 LYS n 1 32 GLY n 1 33 ALA n 1 34 VAL n 1 35 GLU n 1 36 LYS n 1 37 GLY n 1 38 GLU n 1 39 GLU n 1 40 LEU n 1 41 SER n 1 42 VAL n 1 43 GLU n 1 44 GLU n 1 45 ARG n 1 46 ASN n 1 47 LEU n 1 48 LEU n 1 49 SER n 1 50 VAL n 1 51 ALA n 1 52 TYR n 1 53 LYS n 1 54 ASN n 1 55 VAL n 1 56 VAL n 1 57 GLY n 1 58 GLY n 1 59 GLN n 1 60 ARG n 1 61 ALA n 1 62 ALA n 1 63 TRP n 1 64 ARG n 1 65 VAL n 1 66 LEU n 1 67 SER n 1 68 SER n 1 69 ILE n 1 70 GLU n 1 71 GLN n 1 72 LYS n 1 73 SER n 1 74 ASN n 1 75 GLU n 1 76 GLU n 1 77 GLY n 1 78 SER n 1 79 GLU n 1 80 GLU n 1 81 LYS n 1 82 GLY n 1 83 PRO n 1 84 GLU n 1 85 VAL n 1 86 ARG n 1 87 GLU n 1 88 TYR n 1 89 ARG n 1 90 GLU n 1 91 LYS n 1 92 VAL n 1 93 GLU n 1 94 THR n 1 95 GLU n 1 96 LEU n 1 97 GLN n 1 98 GLY n 1 99 VAL n 1 100 CYS n 1 101 ASP n 1 102 THR n 1 103 VAL n 1 104 LEU n 1 105 GLY n 1 106 LEU n 1 107 LEU n 1 108 ASP n 1 109 SER n 1 110 HIS n 1 111 LEU n 1 112 ILE n 1 113 LYS n 1 114 GLU n 1 115 ALA n 1 116 GLY n 1 117 ASP n 1 118 ALA n 1 119 GLU n 1 120 SER n 1 121 ARG n 1 122 VAL n 1 123 PHE n 1 124 TYR n 1 125 LEU n 1 126 LYS n 1 127 MET n 1 128 LYS n 1 129 GLY n 1 130 ASP n 1 131 TYR n 1 132 TYR n 1 133 ARG n 1 134 TYR n 1 135 LEU n 1 136 ALA n 1 137 GLU n 1 138 VAL n 1 139 ALA n 1 140 THR n 1 141 GLY n 1 142 ASP n 1 143 ASP n 1 144 LYS n 1 145 LYS n 1 146 ARG n 1 147 ILE n 1 148 ILE n 1 149 ASP n 1 150 SER n 1 151 ALA n 1 152 ARG n 1 153 SER n 1 154 ALA n 1 155 TYR n 1 156 GLN n 1 157 GLU n 1 158 ALA n 1 159 MET n 1 160 ASP n 1 161 ILE n 1 162 SER n 1 163 LYS n 1 164 LYS n 1 165 GLU n 1 166 MET n 1 167 PRO n 1 168 PRO n 1 169 THR n 1 170 HIS n 1 171 PRO n 1 172 ILE n 1 173 ARG n 1 174 LEU n 1 175 GLY n 1 176 LEU n 1 177 ALA n 1 178 LEU n 1 179 ASN n 1 180 PHE n 1 181 SER n 1 182 VAL n 1 183 PHE n 1 184 HIS n 1 185 TYR n 1 186 GLU n 1 187 ILE n 1 188 ALA n 1 189 ASN n 1 190 SER n 1 191 PRO n 1 192 GLU n 1 193 GLU n 1 194 ALA n 1 195 ILE n 1 196 SER n 1 197 LEU n 1 198 ALA n 1 199 LYS n 1 200 THR n 1 201 THR n 1 202 PHE n 1 203 ASP n 1 204 GLU n 1 205 ALA n 1 206 MET n 1 207 ALA n 1 208 ASP n 1 209 LEU n 1 210 HIS n 1 211 THR n 1 212 LEU n 1 213 SER n 1 214 GLU n 1 215 ASP n 1 216 SER n 1 217 TYR n 1 218 LYS n 1 219 ASP n 1 220 SER n 1 221 THR n 1 222 LEU n 1 223 ILE n 1 224 MET n 1 225 GLN n 1 226 LEU n 1 227 LEU n 1 228 ARG n 1 229 ASP n 1 230 ASN n 1 231 LEU n 1 232 THR n 1 233 LEU n 1 234 TRP n 1 235 THR n 2 1 LYS n 2 2 ARG n 2 3 ARG n 2 4 LYS n 2 5 SEP n 2 6 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HME1, SFN' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pPROEX HTB' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details 'This sequence occurs naturally in humans' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP 1433S_HUMAN P31947 1 ;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; 1 ? 2 PDB 3SP5 3SP5 2 KRRKSV 369 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3SP5 A 5 ? 235 ? P31947 1 ? 231 ? 1 231 2 2 3SP5 P 1 ? 6 ? 3SP5 369 ? 374 ? 369 374 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3SP5 ALA A 1 ? UNP P31947 ? ? 'expression tag' -3 1 1 3SP5 MET A 2 ? UNP P31947 ? ? 'expression tag' -2 2 1 3SP5 GLY A 3 ? UNP P31947 ? ? 'expression tag' -1 3 1 3SP5 SER A 4 ? UNP P31947 ? ? 'expression tag' 0 4 1 3SP5 VAL A 42 ? UNP P31947 CYS 38 'engineered mutation' 38 5 1 3SP5 HIS A 170 ? UNP P31947 ASN 166 'engineered mutation' 166 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CX7 non-polymer . Cotylenol ;(1R,3aS,4R,5R,6R,9aR,10E)-1-(methoxymethyl)-4,9a-dimethyl-7-(propan-2-yl)-1,2,3,3a,4,5,6,8,9,9a-decahydrodicyclopenta[a ,d][8]annulene-1,5,6-triol ; 'C21 H34 O4' 350.492 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3SP5 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.60 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 52.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.095M HEPES Na-Salt pH7.4, 25.6% PEG 400, 0.19M CaCl2, 5% Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.pdbx_collection_date 2010-08-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'BRUKER AXS MICROSTAR' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 3SP5 _reflns.d_resolution_high 1.800 _reflns.number_obs 26606 _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_netI_over_sigmaI 24.520 _reflns.percent_possible_obs 99.100 _reflns.B_iso_Wilson_estimate 13.522 _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F -3.0 _reflns.d_resolution_low 19.5 _reflns.number_all 26853 _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy 3.92 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.800 1.900 15176 ? 3883 0.210 8.120 ? ? ? ? ? 97.800 1 1 1.900 2.000 12297 ? 3156 0.113 11.510 ? ? ? ? ? 98.700 2 1 2.000 2.250 22406 ? 5711 0.070 17.990 ? ? ? ? ? 99.000 3 1 2.250 2.500 14629 ? 3702 0.046 25.130 ? ? ? ? ? 99.700 4 1 2.500 3.000 16802 ? 4221 0.036 29.970 ? ? ? ? ? 99.900 5 1 3.000 4.000 13402 ? 3383 0.026 41.120 ? ? ? ? ? 99.900 6 1 4.000 6.000 6864 ? 1775 0.024 47.820 ? ? ? ? ? 99.800 7 1 6.000 10.000 2292 ? 616 0.023 49.260 ? ? ? ? ? 99.200 8 1 10.000 19.489 508 ? 159 0.021 50.390 ? ? ? ? ? 82.800 9 1 # _refine.entry_id 3SP5 _refine.ls_d_res_high 1.8000 _refine.ls_d_res_low 19.4900 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 100.0000 _refine.ls_number_reflns_obs 26606 _refine.ls_number_reflns_all 25275 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1643 _refine.ls_R_factor_R_work 0.1619 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2112 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_number_reflns_R_free 1331 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 13.522 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.3300 _refine.aniso_B[2][2] -0.2200 _refine.aniso_B[3][3] -0.1100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9530 _refine.correlation_coeff_Fo_to_Fc_free 0.9240 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R_Free 0.1190 _refine.overall_SU_ML 0.0670 _refine.overall_SU_B 2.0600 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 'PDB Entry 3LW1' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 54.130 _refine.B_iso_min 2.000 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.100 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R 0.116 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1890 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 305 _refine_hist.number_atoms_total 2222 _refine_hist.d_res_high 1.8000 _refine_hist.d_res_low 19.4900 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 2154 0.022 0.022 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2961 2.049 2.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 300 4.825 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 100 31.887 24.400 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 419 13.937 15.036 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 17 14.033 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 337 0.197 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 1636 0.009 0.020 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 1311 1.205 1.500 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 2135 1.965 2.000 ? ? 'X-RAY DIFFRACTION' r_scbond_it 843 3.309 3.000 ? ? 'X-RAY DIFFRACTION' r_scangle_it 794 5.265 4.500 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 1.8000 _refine_ls_shell.d_res_low 1.8460 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.number_reflns_R_work 1794 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2210 _refine_ls_shell.R_factor_R_free 0.2800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 95 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1889 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3SP5 _struct.title 'Crystal structure of human 14-3-3 sigma C38V/N166H in complex with TASK-3 peptide and stabilizer Cotylenol' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3SP5 _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' _struct_keywords.text 'Helical protein, Phosphoprotein, Adapter protein, Peptide binding protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? G N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 6 ? ALA A 20 ? GLU A 2 ALA A 16 1 ? 15 HELX_P HELX_P2 2 ARG A 22 ? LYS A 36 ? ARG A 18 LYS A 32 1 ? 15 HELX_P HELX_P3 3 SER A 41 ? ASN A 74 ? SER A 37 ASN A 70 1 ? 34 HELX_P HELX_P4 4 PRO A 83 ? SER A 109 ? PRO A 79 SER A 105 1 ? 27 HELX_P HELX_P5 5 HIS A 110 ? ALA A 115 ? HIS A 106 ALA A 111 1 ? 6 HELX_P HELX_P6 6 ASP A 117 ? ALA A 139 ? ASP A 113 ALA A 135 1 ? 23 HELX_P HELX_P7 7 ASP A 143 ? MET A 166 ? ASP A 139 MET A 162 1 ? 24 HELX_P HELX_P8 8 HIS A 170 ? ILE A 187 ? HIS A 166 ILE A 183 1 ? 18 HELX_P HELX_P9 9 SER A 190 ? LEU A 209 ? SER A 186 LEU A 205 1 ? 20 HELX_P HELX_P10 10 HIS A 210 ? LEU A 212 ? HIS A 206 LEU A 208 5 ? 3 HELX_P HELX_P11 11 SER A 213 ? THR A 235 ? SER A 209 THR A 231 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B LYS 4 C ? ? ? 1_555 B SEP 5 N ? ? P LYS 372 P SEP 373 1_555 ? ? ? ? ? ? ? 1.345 ? ? covale2 covale both ? B SEP 5 C ? ? ? 1_555 B VAL 6 N ? ? P SEP 373 P VAL 374 1_555 ? ? ? ? ? ? ? 1.332 ? ? metalc1 metalc ? ? A GLU 39 OE2 ? ? ? 1_555 D MG . MG ? ? A GLU 35 A MG 233 1_555 ? ? ? ? ? ? ? 2.549 ? ? metalc2 metalc ? ? A GLU 39 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 35 A MG 233 1_555 ? ? ? ? ? ? ? 2.603 ? ? metalc3 metalc ? ? A GLU 79 OE1 ? ? ? 1_555 E MG . MG ? ? A GLU 75 A MG 234 1_555 ? ? ? ? ? ? ? 2.203 ? ? metalc4 metalc ? ? A GLU 114 O ? ? ? 1_555 D MG . MG ? ? A GLU 110 A MG 233 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc5 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 233 A HOH 255 1_555 ? ? ? ? ? ? ? 2.268 ? ? metalc6 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 233 A HOH 305 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc7 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 233 A HOH 458 1_555 ? ? ? ? ? ? ? 2.282 ? ? metalc8 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 234 A HOH 306 1_555 ? ? ? ? ? ? ? 2.536 ? ? metalc9 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 234 A HOH 308 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc10 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 234 A HOH 313 1_555 ? ? ? ? ? ? ? 2.323 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 109 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 110 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 10.74 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CX7 232 ? 12 'BINDING SITE FOR RESIDUE CX7 A 232' AC2 Software A MG 233 ? 6 'BINDING SITE FOR RESIDUE MG A 233' AC3 Software A MG 234 ? 7 'BINDING SITE FOR RESIDUE MG A 234' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 ASN A 46 ? ASN A 42 . ? 1_555 ? 2 AC1 12 PHE A 123 ? PHE A 119 . ? 1_555 ? 3 AC1 12 LYS A 126 ? LYS A 122 . ? 1_555 ? 4 AC1 12 MET A 127 ? MET A 123 . ? 1_555 ? 5 AC1 12 PRO A 171 ? PRO A 167 . ? 1_555 ? 6 AC1 12 ILE A 172 ? ILE A 168 . ? 1_555 ? 7 AC1 12 HOH F . ? HOH A 262 . ? 1_555 ? 8 AC1 12 HOH F . ? HOH A 319 . ? 1_555 ? 9 AC1 12 HOH F . ? HOH A 353 . ? 1_555 ? 10 AC1 12 HOH F . ? HOH A 374 . ? 1_555 ? 11 AC1 12 HOH F . ? HOH A 375 . ? 1_555 ? 12 AC1 12 VAL B 6 ? VAL P 374 . ? 1_555 ? 13 AC2 6 GLU A 39 ? GLU A 35 . ? 1_555 ? 14 AC2 6 GLU A 114 ? GLU A 110 . ? 1_555 ? 15 AC2 6 GLU A 192 ? GLU A 188 . ? 6_444 ? 16 AC2 6 HOH F . ? HOH A 255 . ? 1_555 ? 17 AC2 6 HOH F . ? HOH A 305 . ? 1_555 ? 18 AC2 6 HOH F . ? HOH A 458 . ? 1_555 ? 19 AC3 7 GLU A 79 ? GLU A 75 . ? 1_555 ? 20 AC3 7 GLU A 165 ? GLU A 161 . ? 7_455 ? 21 AC3 7 HOH F . ? HOH A 263 . ? 1_555 ? 22 AC3 7 HOH F . ? HOH A 306 . ? 1_555 ? 23 AC3 7 HOH F . ? HOH A 308 . ? 1_555 ? 24 AC3 7 HOH F . ? HOH A 313 . ? 1_555 ? 25 AC3 7 HOH F . ? HOH A 461 . ? 7_455 ? # _atom_sites.entry_id 3SP5 _atom_sites.fract_transf_matrix[1][1] 0.012225 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008964 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016026 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -3 -3 ALA ALA A . n A 1 2 MET 2 -2 -2 MET MET A . n A 1 3 GLY 3 -1 -1 GLY GLY A . n A 1 4 SER 4 0 0 SER SER A . n A 1 5 MET 5 1 1 MET MET A . n A 1 6 GLU 6 2 2 GLU GLU A . n A 1 7 ARG 7 3 3 ARG ARG A . n A 1 8 ALA 8 4 4 ALA ALA A . n A 1 9 SER 9 5 5 SER SER A . n A 1 10 LEU 10 6 6 LEU LEU A . n A 1 11 ILE 11 7 7 ILE ILE A . n A 1 12 GLN 12 8 8 GLN GLN A . n A 1 13 LYS 13 9 9 LYS LYS A . n A 1 14 ALA 14 10 10 ALA ALA A . n A 1 15 LYS 15 11 11 LYS LYS A . n A 1 16 LEU 16 12 12 LEU LEU A . n A 1 17 ALA 17 13 13 ALA ALA A . n A 1 18 GLU 18 14 14 GLU GLU A . n A 1 19 GLN 19 15 15 GLN GLN A . n A 1 20 ALA 20 16 16 ALA ALA A . n A 1 21 GLU 21 17 17 GLU GLU A . n A 1 22 ARG 22 18 18 ARG ARG A . n A 1 23 TYR 23 19 19 TYR TYR A . n A 1 24 GLU 24 20 20 GLU GLU A . n A 1 25 ASP 25 21 21 ASP ASP A . n A 1 26 MET 26 22 22 MET MET A . n A 1 27 ALA 27 23 23 ALA ALA A . n A 1 28 ALA 28 24 24 ALA ALA A . n A 1 29 PHE 29 25 25 PHE PHE A . n A 1 30 MET 30 26 26 MET MET A . n A 1 31 LYS 31 27 27 LYS LYS A . n A 1 32 GLY 32 28 28 GLY GLY A . n A 1 33 ALA 33 29 29 ALA ALA A . n A 1 34 VAL 34 30 30 VAL VAL A . n A 1 35 GLU 35 31 31 GLU GLU A . n A 1 36 LYS 36 32 32 LYS LYS A . n A 1 37 GLY 37 33 33 GLY GLY A . n A 1 38 GLU 38 34 34 GLU GLU A . n A 1 39 GLU 39 35 35 GLU GLU A . n A 1 40 LEU 40 36 36 LEU LEU A . n A 1 41 SER 41 37 37 SER SER A . n A 1 42 VAL 42 38 38 VAL VAL A . n A 1 43 GLU 43 39 39 GLU GLU A . n A 1 44 GLU 44 40 40 GLU GLU A . n A 1 45 ARG 45 41 41 ARG ARG A . n A 1 46 ASN 46 42 42 ASN ASN A . n A 1 47 LEU 47 43 43 LEU LEU A . n A 1 48 LEU 48 44 44 LEU LEU A . n A 1 49 SER 49 45 45 SER SER A . n A 1 50 VAL 50 46 46 VAL VAL A . n A 1 51 ALA 51 47 47 ALA ALA A . n A 1 52 TYR 52 48 48 TYR TYR A . n A 1 53 LYS 53 49 49 LYS LYS A . n A 1 54 ASN 54 50 50 ASN ASN A . n A 1 55 VAL 55 51 51 VAL VAL A . n A 1 56 VAL 56 52 52 VAL VAL A . n A 1 57 GLY 57 53 53 GLY GLY A . n A 1 58 GLY 58 54 54 GLY GLY A . n A 1 59 GLN 59 55 55 GLN GLN A . n A 1 60 ARG 60 56 56 ARG ARG A . n A 1 61 ALA 61 57 57 ALA ALA A . n A 1 62 ALA 62 58 58 ALA ALA A . n A 1 63 TRP 63 59 59 TRP TRP A . n A 1 64 ARG 64 60 60 ARG ARG A . n A 1 65 VAL 65 61 61 VAL VAL A . n A 1 66 LEU 66 62 62 LEU LEU A . n A 1 67 SER 67 63 63 SER SER A . n A 1 68 SER 68 64 64 SER SER A . n A 1 69 ILE 69 65 65 ILE ILE A . n A 1 70 GLU 70 66 66 GLU GLU A . n A 1 71 GLN 71 67 67 GLN GLN A . n A 1 72 LYS 72 68 68 LYS LYS A . n A 1 73 SER 73 69 69 SER SER A . n A 1 74 ASN 74 70 70 ASN ASN A . n A 1 75 GLU 75 71 71 GLU GLU A . n A 1 76 GLU 76 72 72 GLU GLU A . n A 1 77 GLY 77 73 73 GLY GLY A . n A 1 78 SER 78 74 74 SER SER A . n A 1 79 GLU 79 75 75 GLU GLU A . n A 1 80 GLU 80 76 76 GLU GLU A . n A 1 81 LYS 81 77 77 LYS LYS A . n A 1 82 GLY 82 78 78 GLY GLY A . n A 1 83 PRO 83 79 79 PRO PRO A . n A 1 84 GLU 84 80 80 GLU GLU A . n A 1 85 VAL 85 81 81 VAL VAL A . n A 1 86 ARG 86 82 82 ARG ARG A . n A 1 87 GLU 87 83 83 GLU GLU A . n A 1 88 TYR 88 84 84 TYR TYR A . n A 1 89 ARG 89 85 85 ARG ARG A . n A 1 90 GLU 90 86 86 GLU GLU A . n A 1 91 LYS 91 87 87 LYS LYS A . n A 1 92 VAL 92 88 88 VAL VAL A . n A 1 93 GLU 93 89 89 GLU GLU A . n A 1 94 THR 94 90 90 THR THR A . n A 1 95 GLU 95 91 91 GLU GLU A . n A 1 96 LEU 96 92 92 LEU LEU A . n A 1 97 GLN 97 93 93 GLN GLN A . n A 1 98 GLY 98 94 94 GLY GLY A . n A 1 99 VAL 99 95 95 VAL VAL A . n A 1 100 CYS 100 96 96 CYS CYS A . n A 1 101 ASP 101 97 97 ASP ASP A . n A 1 102 THR 102 98 98 THR THR A . n A 1 103 VAL 103 99 99 VAL VAL A . n A 1 104 LEU 104 100 100 LEU LEU A . n A 1 105 GLY 105 101 101 GLY GLY A . n A 1 106 LEU 106 102 102 LEU LEU A . n A 1 107 LEU 107 103 103 LEU LEU A . n A 1 108 ASP 108 104 104 ASP ASP A . n A 1 109 SER 109 105 105 SER SER A . n A 1 110 HIS 110 106 106 HIS HIS A . n A 1 111 LEU 111 107 107 LEU LEU A . n A 1 112 ILE 112 108 108 ILE ILE A . n A 1 113 LYS 113 109 109 LYS LYS A . n A 1 114 GLU 114 110 110 GLU GLU A . n A 1 115 ALA 115 111 111 ALA ALA A . n A 1 116 GLY 116 112 112 GLY GLY A . n A 1 117 ASP 117 113 113 ASP ASP A . n A 1 118 ALA 118 114 114 ALA ALA A . n A 1 119 GLU 119 115 115 GLU GLU A . n A 1 120 SER 120 116 116 SER SER A . n A 1 121 ARG 121 117 117 ARG ARG A . n A 1 122 VAL 122 118 118 VAL VAL A . n A 1 123 PHE 123 119 119 PHE PHE A . n A 1 124 TYR 124 120 120 TYR TYR A . n A 1 125 LEU 125 121 121 LEU LEU A . n A 1 126 LYS 126 122 122 LYS LYS A . n A 1 127 MET 127 123 123 MET MET A . n A 1 128 LYS 128 124 124 LYS LYS A . n A 1 129 GLY 129 125 125 GLY GLY A . n A 1 130 ASP 130 126 126 ASP ASP A . n A 1 131 TYR 131 127 127 TYR TYR A . n A 1 132 TYR 132 128 128 TYR TYR A . n A 1 133 ARG 133 129 129 ARG ARG A . n A 1 134 TYR 134 130 130 TYR TYR A . n A 1 135 LEU 135 131 131 LEU LEU A . n A 1 136 ALA 136 132 132 ALA ALA A . n A 1 137 GLU 137 133 133 GLU GLU A . n A 1 138 VAL 138 134 134 VAL VAL A . n A 1 139 ALA 139 135 135 ALA ALA A . n A 1 140 THR 140 136 136 THR THR A . n A 1 141 GLY 141 137 137 GLY GLY A . n A 1 142 ASP 142 138 138 ASP ASP A . n A 1 143 ASP 143 139 139 ASP ASP A . n A 1 144 LYS 144 140 140 LYS LYS A . n A 1 145 LYS 145 141 141 LYS LYS A . n A 1 146 ARG 146 142 142 ARG ARG A . n A 1 147 ILE 147 143 143 ILE ILE A . n A 1 148 ILE 148 144 144 ILE ILE A . n A 1 149 ASP 149 145 145 ASP ASP A . n A 1 150 SER 150 146 146 SER SER A . n A 1 151 ALA 151 147 147 ALA ALA A . n A 1 152 ARG 152 148 148 ARG ARG A . n A 1 153 SER 153 149 149 SER SER A . n A 1 154 ALA 154 150 150 ALA ALA A . n A 1 155 TYR 155 151 151 TYR TYR A . n A 1 156 GLN 156 152 152 GLN GLN A . n A 1 157 GLU 157 153 153 GLU GLU A . n A 1 158 ALA 158 154 154 ALA ALA A . n A 1 159 MET 159 155 155 MET MET A . n A 1 160 ASP 160 156 156 ASP ASP A . n A 1 161 ILE 161 157 157 ILE ILE A . n A 1 162 SER 162 158 158 SER SER A . n A 1 163 LYS 163 159 159 LYS LYS A . n A 1 164 LYS 164 160 160 LYS LYS A . n A 1 165 GLU 165 161 161 GLU GLU A . n A 1 166 MET 166 162 162 MET MET A . n A 1 167 PRO 167 163 163 PRO PRO A . n A 1 168 PRO 168 164 164 PRO PRO A . n A 1 169 THR 169 165 165 THR THR A . n A 1 170 HIS 170 166 166 HIS HIS A . n A 1 171 PRO 171 167 167 PRO PRO A . n A 1 172 ILE 172 168 168 ILE ILE A . n A 1 173 ARG 173 169 169 ARG ARG A . n A 1 174 LEU 174 170 170 LEU LEU A . n A 1 175 GLY 175 171 171 GLY GLY A . n A 1 176 LEU 176 172 172 LEU LEU A . n A 1 177 ALA 177 173 173 ALA ALA A . n A 1 178 LEU 178 174 174 LEU LEU A . n A 1 179 ASN 179 175 175 ASN ASN A . n A 1 180 PHE 180 176 176 PHE PHE A . n A 1 181 SER 181 177 177 SER SER A . n A 1 182 VAL 182 178 178 VAL VAL A . n A 1 183 PHE 183 179 179 PHE PHE A . n A 1 184 HIS 184 180 180 HIS HIS A . n A 1 185 TYR 185 181 181 TYR TYR A . n A 1 186 GLU 186 182 182 GLU GLU A . n A 1 187 ILE 187 183 183 ILE ILE A . n A 1 188 ALA 188 184 184 ALA ALA A . n A 1 189 ASN 189 185 185 ASN ASN A . n A 1 190 SER 190 186 186 SER SER A . n A 1 191 PRO 191 187 187 PRO PRO A . n A 1 192 GLU 192 188 188 GLU GLU A . n A 1 193 GLU 193 189 189 GLU GLU A . n A 1 194 ALA 194 190 190 ALA ALA A . n A 1 195 ILE 195 191 191 ILE ILE A . n A 1 196 SER 196 192 192 SER SER A . n A 1 197 LEU 197 193 193 LEU LEU A . n A 1 198 ALA 198 194 194 ALA ALA A . n A 1 199 LYS 199 195 195 LYS LYS A . n A 1 200 THR 200 196 196 THR THR A . n A 1 201 THR 201 197 197 THR THR A . n A 1 202 PHE 202 198 198 PHE PHE A . n A 1 203 ASP 203 199 199 ASP ASP A . n A 1 204 GLU 204 200 200 GLU GLU A . n A 1 205 ALA 205 201 201 ALA ALA A . n A 1 206 MET 206 202 202 MET MET A . n A 1 207 ALA 207 203 203 ALA ALA A . n A 1 208 ASP 208 204 204 ASP ASP A . n A 1 209 LEU 209 205 205 LEU LEU A . n A 1 210 HIS 210 206 206 HIS HIS A . n A 1 211 THR 211 207 207 THR THR A . n A 1 212 LEU 212 208 208 LEU LEU A . n A 1 213 SER 213 209 209 SER SER A . n A 1 214 GLU 214 210 210 GLU GLU A . n A 1 215 ASP 215 211 211 ASP ASP A . n A 1 216 SER 216 212 212 SER SER A . n A 1 217 TYR 217 213 213 TYR TYR A . n A 1 218 LYS 218 214 214 LYS LYS A . n A 1 219 ASP 219 215 215 ASP ASP A . n A 1 220 SER 220 216 216 SER SER A . n A 1 221 THR 221 217 217 THR THR A . n A 1 222 LEU 222 218 218 LEU LEU A . n A 1 223 ILE 223 219 219 ILE ILE A . n A 1 224 MET 224 220 220 MET MET A . n A 1 225 GLN 225 221 221 GLN GLN A . n A 1 226 LEU 226 222 222 LEU LEU A . n A 1 227 LEU 227 223 223 LEU LEU A . n A 1 228 ARG 228 224 224 ARG ARG A . n A 1 229 ASP 229 225 225 ASP ASP A . n A 1 230 ASN 230 226 226 ASN ASN A . n A 1 231 LEU 231 227 227 LEU LEU A . n A 1 232 THR 232 228 228 THR THR A . n A 1 233 LEU 233 229 229 LEU LEU A . n A 1 234 TRP 234 230 230 TRP TRP A . n A 1 235 THR 235 231 231 THR THR A . n B 2 1 LYS 1 369 369 LYS LYS P . n B 2 2 ARG 2 370 370 ARG ARG P . n B 2 3 ARG 3 371 371 ARG ARG P . n B 2 4 LYS 4 372 372 LYS LYS P . n B 2 5 SEP 5 373 373 SEP SEP P . n B 2 6 VAL 6 374 374 VAL VAL P . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CX7 1 232 232 CX7 CX7 A . D 4 MG 1 233 233 MG MG A . E 4 MG 1 234 234 MG MG A . F 5 HOH 1 235 235 HOH HOH A . F 5 HOH 2 236 236 HOH HOH A . F 5 HOH 3 237 237 HOH HOH A . F 5 HOH 4 238 238 HOH HOH A . F 5 HOH 5 239 239 HOH HOH A . F 5 HOH 6 240 240 HOH HOH A . F 5 HOH 7 241 241 HOH HOH A . F 5 HOH 8 242 242 HOH HOH A . F 5 HOH 9 243 243 HOH HOH A . F 5 HOH 10 244 244 HOH HOH A . F 5 HOH 11 245 245 HOH HOH A . F 5 HOH 12 246 246 HOH HOH A . F 5 HOH 13 247 247 HOH HOH A . F 5 HOH 14 248 248 HOH HOH A . F 5 HOH 15 249 249 HOH HOH A . F 5 HOH 16 250 250 HOH HOH A . F 5 HOH 17 251 251 HOH HOH A . F 5 HOH 18 252 252 HOH HOH A . F 5 HOH 19 253 253 HOH HOH A . F 5 HOH 20 254 254 HOH HOH A . F 5 HOH 21 255 255 HOH HOH A . F 5 HOH 22 256 256 HOH HOH A . F 5 HOH 23 257 257 HOH HOH A . F 5 HOH 24 258 258 HOH HOH A . F 5 HOH 25 259 259 HOH HOH A . F 5 HOH 26 260 260 HOH HOH A . F 5 HOH 27 261 261 HOH HOH A . F 5 HOH 28 262 262 HOH HOH A . F 5 HOH 29 263 263 HOH HOH A . F 5 HOH 30 264 264 HOH HOH A . F 5 HOH 31 265 265 HOH HOH A . F 5 HOH 32 266 266 HOH HOH A . F 5 HOH 33 267 267 HOH HOH A . F 5 HOH 34 268 268 HOH HOH A . F 5 HOH 35 269 269 HOH HOH A . F 5 HOH 36 270 270 HOH HOH A . F 5 HOH 37 271 271 HOH HOH A . F 5 HOH 38 272 272 HOH HOH A . F 5 HOH 39 273 273 HOH HOH A . F 5 HOH 40 274 274 HOH HOH A . F 5 HOH 41 275 275 HOH HOH A . F 5 HOH 42 276 276 HOH HOH A . F 5 HOH 43 277 277 HOH HOH A . F 5 HOH 44 279 279 HOH HOH A . F 5 HOH 45 280 280 HOH HOH A . F 5 HOH 46 281 281 HOH HOH A . F 5 HOH 47 282 282 HOH HOH A . F 5 HOH 48 283 283 HOH HOH A . F 5 HOH 49 284 284 HOH HOH A . F 5 HOH 50 285 285 HOH HOH A . F 5 HOH 51 286 286 HOH HOH A . F 5 HOH 52 287 287 HOH HOH A . F 5 HOH 53 288 288 HOH HOH A . F 5 HOH 54 289 289 HOH HOH A . F 5 HOH 55 290 290 HOH HOH A . F 5 HOH 56 291 291 HOH HOH A . F 5 HOH 57 292 292 HOH HOH A . F 5 HOH 58 293 293 HOH HOH A . F 5 HOH 59 294 294 HOH HOH A . F 5 HOH 60 295 295 HOH HOH A . F 5 HOH 61 296 296 HOH HOH A . F 5 HOH 62 297 297 HOH HOH A . F 5 HOH 63 298 298 HOH HOH A . F 5 HOH 64 299 299 HOH HOH A . F 5 HOH 65 300 300 HOH HOH A . F 5 HOH 66 301 301 HOH HOH A . F 5 HOH 67 302 302 HOH HOH A . F 5 HOH 68 303 303 HOH HOH A . F 5 HOH 69 305 305 HOH HOH A . F 5 HOH 70 306 306 HOH HOH A . F 5 HOH 71 308 308 HOH HOH A . F 5 HOH 72 310 310 HOH HOH A . F 5 HOH 73 311 311 HOH HOH A . F 5 HOH 74 312 312 HOH HOH A . F 5 HOH 75 313 313 HOH HOH A . F 5 HOH 76 314 314 HOH HOH A . F 5 HOH 77 315 315 HOH HOH A . F 5 HOH 78 316 316 HOH HOH A . F 5 HOH 79 317 317 HOH HOH A . F 5 HOH 80 318 318 HOH HOH A . F 5 HOH 81 319 319 HOH HOH A . F 5 HOH 82 320 320 HOH HOH A . F 5 HOH 83 321 321 HOH HOH A . F 5 HOH 84 322 322 HOH HOH A . F 5 HOH 85 323 323 HOH HOH A . F 5 HOH 86 324 324 HOH HOH A . F 5 HOH 87 325 325 HOH HOH A . F 5 HOH 88 326 326 HOH HOH A . F 5 HOH 89 327 327 HOH HOH A . F 5 HOH 90 328 328 HOH HOH A . F 5 HOH 91 329 329 HOH HOH A . F 5 HOH 92 330 330 HOH HOH A . F 5 HOH 93 331 331 HOH HOH A . F 5 HOH 94 332 332 HOH HOH A . F 5 HOH 95 333 333 HOH HOH A . F 5 HOH 96 334 334 HOH HOH A . F 5 HOH 97 335 335 HOH HOH A . F 5 HOH 98 336 336 HOH HOH A . F 5 HOH 99 337 337 HOH HOH A . F 5 HOH 100 338 338 HOH HOH A . F 5 HOH 101 339 339 HOH HOH A . F 5 HOH 102 340 340 HOH HOH A . F 5 HOH 103 341 341 HOH HOH A . F 5 HOH 104 342 342 HOH HOH A . F 5 HOH 105 343 343 HOH HOH A . F 5 HOH 106 344 344 HOH HOH A . F 5 HOH 107 345 345 HOH HOH A . F 5 HOH 108 346 346 HOH HOH A . F 5 HOH 109 347 347 HOH HOH A . F 5 HOH 110 348 348 HOH HOH A . F 5 HOH 111 349 349 HOH HOH A . F 5 HOH 112 350 350 HOH HOH A . F 5 HOH 113 351 351 HOH HOH A . F 5 HOH 114 352 352 HOH HOH A . F 5 HOH 115 353 353 HOH HOH A . F 5 HOH 116 354 354 HOH HOH A . F 5 HOH 117 355 355 HOH HOH A . F 5 HOH 118 356 356 HOH HOH A . F 5 HOH 119 357 357 HOH HOH A . F 5 HOH 120 358 358 HOH HOH A . F 5 HOH 121 359 359 HOH HOH A . F 5 HOH 122 360 360 HOH HOH A . F 5 HOH 123 361 361 HOH HOH A . F 5 HOH 124 362 362 HOH HOH A . F 5 HOH 125 363 363 HOH HOH A . F 5 HOH 126 364 364 HOH HOH A . F 5 HOH 127 365 365 HOH HOH A . F 5 HOH 128 366 366 HOH HOH A . F 5 HOH 129 367 367 HOH HOH A . F 5 HOH 130 368 368 HOH HOH A . F 5 HOH 131 369 369 HOH HOH A . F 5 HOH 132 370 370 HOH HOH A . F 5 HOH 133 371 371 HOH HOH A . F 5 HOH 134 372 372 HOH HOH A . F 5 HOH 135 373 373 HOH HOH A . F 5 HOH 136 374 374 HOH HOH A . F 5 HOH 137 375 375 HOH HOH A . F 5 HOH 138 376 376 HOH HOH A . F 5 HOH 139 377 377 HOH HOH A . F 5 HOH 140 378 378 HOH HOH A . F 5 HOH 141 379 379 HOH HOH A . F 5 HOH 142 380 380 HOH HOH A . F 5 HOH 143 381 381 HOH HOH A . F 5 HOH 144 382 382 HOH HOH A . F 5 HOH 145 383 383 HOH HOH A . F 5 HOH 146 384 384 HOH HOH A . F 5 HOH 147 385 385 HOH HOH A . F 5 HOH 148 386 386 HOH HOH A . F 5 HOH 149 387 387 HOH HOH A . F 5 HOH 150 388 388 HOH HOH A . F 5 HOH 151 389 389 HOH HOH A . F 5 HOH 152 390 390 HOH HOH A . F 5 HOH 153 391 391 HOH HOH A . F 5 HOH 154 392 392 HOH HOH A . F 5 HOH 155 393 393 HOH HOH A . F 5 HOH 156 394 394 HOH HOH A . F 5 HOH 157 395 395 HOH HOH A . F 5 HOH 158 396 396 HOH HOH A . F 5 HOH 159 397 397 HOH HOH A . F 5 HOH 160 398 398 HOH HOH A . F 5 HOH 161 399 399 HOH HOH A . F 5 HOH 162 400 400 HOH HOH A . F 5 HOH 163 401 401 HOH HOH A . F 5 HOH 164 402 402 HOH HOH A . F 5 HOH 165 403 403 HOH HOH A . F 5 HOH 166 404 404 HOH HOH A . F 5 HOH 167 405 405 HOH HOH A . F 5 HOH 168 406 406 HOH HOH A . F 5 HOH 169 407 407 HOH HOH A . F 5 HOH 170 408 408 HOH HOH A . F 5 HOH 171 409 409 HOH HOH A . F 5 HOH 172 410 410 HOH HOH A . F 5 HOH 173 411 411 HOH HOH A . F 5 HOH 174 412 412 HOH HOH A . F 5 HOH 175 413 413 HOH HOH A . F 5 HOH 176 414 414 HOH HOH A . F 5 HOH 177 415 415 HOH HOH A . F 5 HOH 178 416 416 HOH HOH A . F 5 HOH 179 417 417 HOH HOH A . F 5 HOH 180 418 418 HOH HOH A . F 5 HOH 181 419 419 HOH HOH A . F 5 HOH 182 420 420 HOH HOH A . F 5 HOH 183 421 421 HOH HOH A . F 5 HOH 184 422 422 HOH HOH A . F 5 HOH 185 423 423 HOH HOH A . F 5 HOH 186 424 424 HOH HOH A . F 5 HOH 187 425 425 HOH HOH A . F 5 HOH 188 426 426 HOH HOH A . F 5 HOH 189 427 427 HOH HOH A . F 5 HOH 190 428 428 HOH HOH A . F 5 HOH 191 429 429 HOH HOH A . F 5 HOH 192 430 430 HOH HOH A . F 5 HOH 193 431 431 HOH HOH A . F 5 HOH 194 432 432 HOH HOH A . F 5 HOH 195 433 433 HOH HOH A . F 5 HOH 196 434 434 HOH HOH A . F 5 HOH 197 435 435 HOH HOH A . F 5 HOH 198 436 436 HOH HOH A . F 5 HOH 199 437 437 HOH HOH A . F 5 HOH 200 438 438 HOH HOH A . F 5 HOH 201 439 439 HOH HOH A . F 5 HOH 202 440 440 HOH HOH A . F 5 HOH 203 441 441 HOH HOH A . F 5 HOH 204 442 442 HOH HOH A . F 5 HOH 205 443 443 HOH HOH A . F 5 HOH 206 444 444 HOH HOH A . F 5 HOH 207 445 445 HOH HOH A . F 5 HOH 208 446 446 HOH HOH A . F 5 HOH 209 447 447 HOH HOH A . F 5 HOH 210 448 448 HOH HOH A . F 5 HOH 211 449 449 HOH HOH A . F 5 HOH 212 450 450 HOH HOH A . F 5 HOH 213 451 451 HOH HOH A . F 5 HOH 214 452 452 HOH HOH A . F 5 HOH 215 453 453 HOH HOH A . F 5 HOH 216 454 454 HOH HOH A . F 5 HOH 217 455 455 HOH HOH A . F 5 HOH 218 456 456 HOH HOH A . F 5 HOH 219 457 457 HOH HOH A . F 5 HOH 220 458 458 HOH HOH A . F 5 HOH 221 459 459 HOH HOH A . F 5 HOH 222 460 460 HOH HOH A . F 5 HOH 223 461 461 HOH HOH A . F 5 HOH 224 462 462 HOH HOH A . F 5 HOH 225 463 463 HOH HOH A . F 5 HOH 226 464 464 HOH HOH A . F 5 HOH 227 465 465 HOH HOH A . F 5 HOH 228 466 466 HOH HOH A . F 5 HOH 229 467 467 HOH HOH A . F 5 HOH 230 468 468 HOH HOH A . F 5 HOH 231 469 469 HOH HOH A . F 5 HOH 232 470 470 HOH HOH A . F 5 HOH 233 471 471 HOH HOH A . F 5 HOH 234 472 472 HOH HOH A . F 5 HOH 235 473 473 HOH HOH A . F 5 HOH 236 474 474 HOH HOH A . F 5 HOH 237 475 475 HOH HOH A . F 5 HOH 238 476 476 HOH HOH A . F 5 HOH 239 477 477 HOH HOH A . F 5 HOH 240 478 478 HOH HOH A . F 5 HOH 241 479 479 HOH HOH A . F 5 HOH 242 480 480 HOH HOH A . F 5 HOH 243 481 481 HOH HOH A . F 5 HOH 244 482 482 HOH HOH A . F 5 HOH 245 483 483 HOH HOH A . F 5 HOH 246 484 484 HOH HOH A . F 5 HOH 247 485 485 HOH HOH A . F 5 HOH 248 486 486 HOH HOH A . F 5 HOH 249 487 487 HOH HOH A . F 5 HOH 250 488 488 HOH HOH A . F 5 HOH 251 489 489 HOH HOH A . F 5 HOH 252 490 490 HOH HOH A . F 5 HOH 253 491 491 HOH HOH A . F 5 HOH 254 492 492 HOH HOH A . F 5 HOH 255 493 493 HOH HOH A . F 5 HOH 256 494 494 HOH HOH A . F 5 HOH 257 495 495 HOH HOH A . F 5 HOH 258 496 496 HOH HOH A . F 5 HOH 259 497 497 HOH HOH A . F 5 HOH 260 498 498 HOH HOH A . F 5 HOH 261 499 499 HOH HOH A . F 5 HOH 262 500 500 HOH HOH A . F 5 HOH 263 501 501 HOH HOH A . F 5 HOH 264 502 502 HOH HOH A . F 5 HOH 265 503 503 HOH HOH A . F 5 HOH 266 504 504 HOH HOH A . F 5 HOH 267 505 505 HOH HOH A . F 5 HOH 268 506 506 HOH HOH A . F 5 HOH 269 507 507 HOH HOH A . F 5 HOH 270 508 508 HOH HOH A . F 5 HOH 271 509 509 HOH HOH A . F 5 HOH 272 510 510 HOH HOH A . F 5 HOH 273 511 511 HOH HOH A . F 5 HOH 274 512 512 HOH HOH A . F 5 HOH 275 513 513 HOH HOH A . F 5 HOH 276 514 514 HOH HOH A . F 5 HOH 277 515 515 HOH HOH A . F 5 HOH 278 516 516 HOH HOH A . F 5 HOH 279 517 517 HOH HOH A . F 5 HOH 280 518 518 HOH HOH A . F 5 HOH 281 519 519 HOH HOH A . F 5 HOH 282 520 520 HOH HOH A . F 5 HOH 283 521 521 HOH HOH A . F 5 HOH 284 522 522 HOH HOH A . F 5 HOH 285 523 523 HOH HOH A . F 5 HOH 286 524 524 HOH HOH A . F 5 HOH 287 525 525 HOH HOH A . G 5 HOH 1 12 12 HOH HOH P . G 5 HOH 2 36 36 HOH HOH P . G 5 HOH 3 44 44 HOH HOH P . G 5 HOH 4 54 54 HOH HOH P . G 5 HOH 5 74 74 HOH HOH P . G 5 HOH 6 92 92 HOH HOH P . G 5 HOH 7 122 122 HOH HOH P . G 5 HOH 8 134 134 HOH HOH P . G 5 HOH 9 140 140 HOH HOH P . G 5 HOH 10 172 172 HOH HOH P . G 5 HOH 11 183 183 HOH HOH P . G 5 HOH 12 188 188 HOH HOH P . G 5 HOH 13 202 202 HOH HOH P . G 5 HOH 14 217 217 HOH HOH P . G 5 HOH 15 229 229 HOH HOH P . G 5 HOH 16 242 242 HOH HOH P . G 5 HOH 17 255 255 HOH HOH P . G 5 HOH 18 289 289 HOH HOH P . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 5 _pdbx_struct_mod_residue.auth_asym_id P _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 373 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details PHOSPHOSERINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA tetrameric 4 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C,D,E,F,G 2 1 A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4480 ? 1 MORE -35 ? 1 'SSA (A^2)' 23260 ? 2 'ABSA (A^2)' 1210 ? 2 MORE -14 ? 2 'SSA (A^2)' 12660 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 289 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 39 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 OE1 ? A GLU 39 ? A GLU 35 ? 1_555 49.0 ? 2 OE2 ? A GLU 39 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? A GLU 114 ? A GLU 110 ? 1_555 85.8 ? 3 OE1 ? A GLU 39 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? A GLU 114 ? A GLU 110 ? 1_555 82.9 ? 4 OE2 ? A GLU 39 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 255 ? 1_555 156.3 ? 5 OE1 ? A GLU 39 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 255 ? 1_555 150.0 ? 6 O ? A GLU 114 ? A GLU 110 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 255 ? 1_555 107.3 ? 7 OE2 ? A GLU 39 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 305 ? 1_555 83.6 ? 8 OE1 ? A GLU 39 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 305 ? 1_555 89.2 ? 9 O ? A GLU 114 ? A GLU 110 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 305 ? 1_555 169.3 ? 10 O ? F HOH . ? A HOH 255 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 305 ? 1_555 83.1 ? 11 OE2 ? A GLU 39 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 458 ? 1_555 77.0 ? 12 OE1 ? A GLU 39 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 458 ? 1_555 125.5 ? 13 O ? A GLU 114 ? A GLU 110 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 458 ? 1_555 86.6 ? 14 O ? F HOH . ? A HOH 255 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 458 ? 1_555 83.9 ? 15 O ? F HOH . ? A HOH 305 ? 1_555 MG ? D MG . ? A MG 233 ? 1_555 O ? F HOH . ? A HOH 458 ? 1_555 92.2 ? 16 OE1 ? A GLU 79 ? A GLU 75 ? 1_555 MG ? E MG . ? A MG 234 ? 1_555 O ? F HOH . ? A HOH 306 ? 1_555 114.7 ? 17 OE1 ? A GLU 79 ? A GLU 75 ? 1_555 MG ? E MG . ? A MG 234 ? 1_555 O ? F HOH . ? A HOH 308 ? 1_555 99.4 ? 18 O ? F HOH . ? A HOH 306 ? 1_555 MG ? E MG . ? A MG 234 ? 1_555 O ? F HOH . ? A HOH 308 ? 1_555 106.7 ? 19 OE1 ? A GLU 79 ? A GLU 75 ? 1_555 MG ? E MG . ? A MG 234 ? 1_555 O ? F HOH . ? A HOH 313 ? 1_555 167.6 ? 20 O ? F HOH . ? A HOH 306 ? 1_555 MG ? E MG . ? A MG 234 ? 1_555 O ? F HOH . ? A HOH 313 ? 1_555 75.2 ? 21 O ? F HOH . ? A HOH 308 ? 1_555 MG ? E MG . ? A MG 234 ? 1_555 O ? F HOH . ? A HOH 313 ? 1_555 83.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-05-04 2 'Structure model' 1 1 2017-11-08 3 'Structure model' 1 2 2023-09-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' chem_comp 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn 9 3 'Structure model' struct_ref_seq_dif 10 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.name' 2 3 'Structure model' '_chem_comp.pdbx_synonyms' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.value' 20 3 'Structure model' '_struct_conn.pdbx_dist_value' 21 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 22 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 3 'Structure model' '_struct_ref_seq_dif.details' 34 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 35 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 36 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 XSCALE . ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 2 REFMAC 5.5.0102 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 3 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 MAR345 software ? ? ? ? 'data collection' ? ? ? 5 XDS . ? ? ? ? 'data reduction' ? ? ? 6 PHASER . ? ? ? ? phasing ? ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 420 ? ? O A HOH 439 ? ? 2.12 2 1 O A HOH 447 ? ? O A HOH 523 ? ? 2.15 3 1 OG A SER 177 ? B O A HOH 328 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE2 A GLU 110 ? ? 1_555 OH A TYR 213 ? B 8_445 1.75 2 1 OE2 A GLU 110 ? ? 1_555 OH A TYR 213 ? A 8_445 1.99 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CE1 _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 PHE _pdbx_validate_rmsd_bond.auth_seq_id_1 119 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CZ _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 PHE _pdbx_validate_rmsd_bond.auth_seq_id_2 119 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.487 _pdbx_validate_rmsd_bond.bond_target_value 1.369 _pdbx_validate_rmsd_bond.bond_deviation 0.118 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH1 A ARG 41 ? ? 125.48 120.30 5.18 0.50 N 2 1 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 116.04 120.30 -4.26 0.50 N 3 1 CD P LYS 372 ? ? CE P LYS 372 ? ? NZ P LYS 372 ? ? 97.00 111.70 -14.70 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -101.71 76.73 2 1 HIS A 106 ? ? -145.30 35.75 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 71 ? CG ? A GLU 75 CG 2 1 Y 1 A GLU 71 ? CD ? A GLU 75 CD 3 1 Y 1 A GLU 71 ? OE1 ? A GLU 75 OE1 4 1 Y 1 A GLU 71 ? OE2 ? A GLU 75 OE2 5 1 Y 1 A GLU 72 ? CG ? A GLU 76 CG 6 1 Y 1 A GLU 72 ? CD ? A GLU 76 CD 7 1 Y 1 A GLU 72 ? OE1 ? A GLU 76 OE1 8 1 Y 1 A GLU 72 ? OE2 ? A GLU 76 OE2 9 1 Y 1 A SER 74 ? OG ? A SER 78 OG 10 1 Y 1 A GLU 76 ? CG ? A GLU 80 CG 11 1 Y 1 A GLU 76 ? CD ? A GLU 80 CD 12 1 Y 1 A GLU 76 ? OE1 ? A GLU 80 OE1 13 1 Y 1 A GLU 76 ? OE2 ? A GLU 80 OE2 14 1 Y 1 A LYS 77 ? CG ? A LYS 81 CG 15 1 Y 1 A LYS 77 ? CD ? A LYS 81 CD 16 1 Y 1 A LYS 77 ? CE ? A LYS 81 CE 17 1 Y 1 A LYS 77 ? NZ ? A LYS 81 NZ 18 1 Y 1 A LYS 214 ? CD ? A LYS 218 CD 19 1 Y 1 A LYS 214 ? CE ? A LYS 218 CE 20 1 Y 1 A LYS 214 ? NZ ? A LYS 218 NZ 21 1 Y 1 P LYS 369 ? CG ? B LYS 1 CG 22 1 Y 1 P LYS 369 ? CD ? B LYS 1 CD 23 1 Y 1 P LYS 369 ? CE ? B LYS 1 CE 24 1 Y 1 P LYS 369 ? NZ ? B LYS 1 NZ # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CX7 CAA C N R 74 CX7 CAB C N S 75 CX7 CAC C N N 76 CX7 CAD C N N 77 CX7 CAE C N R 78 CX7 CAF C N N 79 CX7 CAG C N R 80 CX7 CAH C N R 81 CX7 CAI C N N 82 CX7 CAJ C N N 83 CX7 CAK C N R 84 CX7 CAL C N N 85 CX7 CAM C N N 86 CX7 CAN C N N 87 CX7 CAO C N N 88 CX7 CAP C N N 89 CX7 CAQ C N N 90 CX7 OAR O N N 91 CX7 OAS O N N 92 CX7 OAT O N N 93 CX7 OAU O N N 94 CX7 CAV C N N 95 CX7 CAW C N N 96 CX7 CAX C N N 97 CX7 CAY C N N 98 CX7 HAA H N N 99 CX7 HAB H N N 100 CX7 HAD H N N 101 CX7 HAG H N N 102 CX7 HAH H N N 103 CX7 HAI H N N 104 CX7 HAIA H N N 105 CX7 HAJ H N N 106 CX7 HAJA H N N 107 CX7 HAL H N N 108 CX7 HALA H N N 109 CX7 HAM H N N 110 CX7 HAMA H N N 111 CX7 HAO H N N 112 CX7 HAOA H N N 113 CX7 HAOB H N N 114 CX7 HAP H N N 115 CX7 HAPA H N N 116 CX7 HAQ H N N 117 CX7 HAQA H N N 118 CX7 HAQB H N N 119 CX7 HOAR H N N 120 CX7 HOAS H N N 121 CX7 HOAT H N N 122 CX7 H25 H N N 123 CX7 HAW H N N 124 CX7 HAWA H N N 125 CX7 HAWB H N N 126 CX7 HAX H N N 127 CX7 HAXA H N N 128 CX7 H31 H N N 129 CX7 HAY H N N 130 CX7 HAYA H N N 131 CX7 HAYB H N N 132 CYS N N N N 133 CYS CA C N R 134 CYS C C N N 135 CYS O O N N 136 CYS CB C N N 137 CYS SG S N N 138 CYS OXT O N N 139 CYS H H N N 140 CYS H2 H N N 141 CYS HA H N N 142 CYS HB2 H N N 143 CYS HB3 H N N 144 CYS HG H N N 145 CYS HXT H N N 146 GLN N N N N 147 GLN CA C N S 148 GLN C C N N 149 GLN O O N N 150 GLN CB C N N 151 GLN CG C N N 152 GLN CD C N N 153 GLN OE1 O N N 154 GLN NE2 N N N 155 GLN OXT O N N 156 GLN H H N N 157 GLN H2 H N N 158 GLN HA H N N 159 GLN HB2 H N N 160 GLN HB3 H N N 161 GLN HG2 H N N 162 GLN HG3 H N N 163 GLN HE21 H N N 164 GLN HE22 H N N 165 GLN HXT H N N 166 GLU N N N N 167 GLU CA C N S 168 GLU C C N N 169 GLU O O N N 170 GLU CB C N N 171 GLU CG C N N 172 GLU CD C N N 173 GLU OE1 O N N 174 GLU OE2 O N N 175 GLU OXT O N N 176 GLU H H N N 177 GLU H2 H N N 178 GLU HA H N N 179 GLU HB2 H N N 180 GLU HB3 H N N 181 GLU HG2 H N N 182 GLU HG3 H N N 183 GLU HE2 H N N 184 GLU HXT H N N 185 GLY N N N N 186 GLY CA C N N 187 GLY C C N N 188 GLY O O N N 189 GLY OXT O N N 190 GLY H H N N 191 GLY H2 H N N 192 GLY HA2 H N N 193 GLY HA3 H N N 194 GLY HXT H N N 195 HIS N N N N 196 HIS CA C N S 197 HIS C C N N 198 HIS O O N N 199 HIS CB C N N 200 HIS CG C Y N 201 HIS ND1 N Y N 202 HIS CD2 C Y N 203 HIS CE1 C Y N 204 HIS NE2 N Y N 205 HIS OXT O N N 206 HIS H H N N 207 HIS H2 H N N 208 HIS HA H N N 209 HIS HB2 H N N 210 HIS HB3 H N N 211 HIS HD1 H N N 212 HIS HD2 H N N 213 HIS HE1 H N N 214 HIS HE2 H N N 215 HIS HXT H N N 216 HOH O O N N 217 HOH H1 H N N 218 HOH H2 H N N 219 ILE N N N N 220 ILE CA C N S 221 ILE C C N N 222 ILE O O N N 223 ILE CB C N S 224 ILE CG1 C N N 225 ILE CG2 C N N 226 ILE CD1 C N N 227 ILE OXT O N N 228 ILE H H N N 229 ILE H2 H N N 230 ILE HA H N N 231 ILE HB H N N 232 ILE HG12 H N N 233 ILE HG13 H N N 234 ILE HG21 H N N 235 ILE HG22 H N N 236 ILE HG23 H N N 237 ILE HD11 H N N 238 ILE HD12 H N N 239 ILE HD13 H N N 240 ILE HXT H N N 241 LEU N N N N 242 LEU CA C N S 243 LEU C C N N 244 LEU O O N N 245 LEU CB C N N 246 LEU CG C N N 247 LEU CD1 C N N 248 LEU CD2 C N N 249 LEU OXT O N N 250 LEU H H N N 251 LEU H2 H N N 252 LEU HA H N N 253 LEU HB2 H N N 254 LEU HB3 H N N 255 LEU HG H N N 256 LEU HD11 H N N 257 LEU HD12 H N N 258 LEU HD13 H N N 259 LEU HD21 H N N 260 LEU HD22 H N N 261 LEU HD23 H N N 262 LEU HXT H N N 263 LYS N N N N 264 LYS CA C N S 265 LYS C C N N 266 LYS O O N N 267 LYS CB C N N 268 LYS CG C N N 269 LYS CD C N N 270 LYS CE C N N 271 LYS NZ N N N 272 LYS OXT O N N 273 LYS H H N N 274 LYS H2 H N N 275 LYS HA H N N 276 LYS HB2 H N N 277 LYS HB3 H N N 278 LYS HG2 H N N 279 LYS HG3 H N N 280 LYS HD2 H N N 281 LYS HD3 H N N 282 LYS HE2 H N N 283 LYS HE3 H N N 284 LYS HZ1 H N N 285 LYS HZ2 H N N 286 LYS HZ3 H N N 287 LYS HXT H N N 288 MET N N N N 289 MET CA C N S 290 MET C C N N 291 MET O O N N 292 MET CB C N N 293 MET CG C N N 294 MET SD S N N 295 MET CE C N N 296 MET OXT O N N 297 MET H H N N 298 MET H2 H N N 299 MET HA H N N 300 MET HB2 H N N 301 MET HB3 H N N 302 MET HG2 H N N 303 MET HG3 H N N 304 MET HE1 H N N 305 MET HE2 H N N 306 MET HE3 H N N 307 MET HXT H N N 308 MG MG MG N N 309 PHE N N N N 310 PHE CA C N S 311 PHE C C N N 312 PHE O O N N 313 PHE CB C N N 314 PHE CG C Y N 315 PHE CD1 C Y N 316 PHE CD2 C Y N 317 PHE CE1 C Y N 318 PHE CE2 C Y N 319 PHE CZ C Y N 320 PHE OXT O N N 321 PHE H H N N 322 PHE H2 H N N 323 PHE HA H N N 324 PHE HB2 H N N 325 PHE HB3 H N N 326 PHE HD1 H N N 327 PHE HD2 H N N 328 PHE HE1 H N N 329 PHE HE2 H N N 330 PHE HZ H N N 331 PHE HXT H N N 332 PRO N N N N 333 PRO CA C N S 334 PRO C C N N 335 PRO O O N N 336 PRO CB C N N 337 PRO CG C N N 338 PRO CD C N N 339 PRO OXT O N N 340 PRO H H N N 341 PRO HA H N N 342 PRO HB2 H N N 343 PRO HB3 H N N 344 PRO HG2 H N N 345 PRO HG3 H N N 346 PRO HD2 H N N 347 PRO HD3 H N N 348 PRO HXT H N N 349 SEP N N N N 350 SEP CA C N S 351 SEP CB C N N 352 SEP OG O N N 353 SEP C C N N 354 SEP O O N N 355 SEP OXT O N N 356 SEP P P N N 357 SEP O1P O N N 358 SEP O2P O N N 359 SEP O3P O N N 360 SEP H H N N 361 SEP H2 H N N 362 SEP HA H N N 363 SEP HB2 H N N 364 SEP HB3 H N N 365 SEP HXT H N N 366 SEP HOP2 H N N 367 SEP HOP3 H N N 368 SER N N N N 369 SER CA C N S 370 SER C C N N 371 SER O O N N 372 SER CB C N N 373 SER OG O N N 374 SER OXT O N N 375 SER H H N N 376 SER H2 H N N 377 SER HA H N N 378 SER HB2 H N N 379 SER HB3 H N N 380 SER HG H N N 381 SER HXT H N N 382 THR N N N N 383 THR CA C N S 384 THR C C N N 385 THR O O N N 386 THR CB C N R 387 THR OG1 O N N 388 THR CG2 C N N 389 THR OXT O N N 390 THR H H N N 391 THR H2 H N N 392 THR HA H N N 393 THR HB H N N 394 THR HG1 H N N 395 THR HG21 H N N 396 THR HG22 H N N 397 THR HG23 H N N 398 THR HXT H N N 399 TRP N N N N 400 TRP CA C N S 401 TRP C C N N 402 TRP O O N N 403 TRP CB C N N 404 TRP CG C Y N 405 TRP CD1 C Y N 406 TRP CD2 C Y N 407 TRP NE1 N Y N 408 TRP CE2 C Y N 409 TRP CE3 C Y N 410 TRP CZ2 C Y N 411 TRP CZ3 C Y N 412 TRP CH2 C Y N 413 TRP OXT O N N 414 TRP H H N N 415 TRP H2 H N N 416 TRP HA H N N 417 TRP HB2 H N N 418 TRP HB3 H N N 419 TRP HD1 H N N 420 TRP HE1 H N N 421 TRP HE3 H N N 422 TRP HZ2 H N N 423 TRP HZ3 H N N 424 TRP HH2 H N N 425 TRP HXT H N N 426 TYR N N N N 427 TYR CA C N S 428 TYR C C N N 429 TYR O O N N 430 TYR CB C N N 431 TYR CG C Y N 432 TYR CD1 C Y N 433 TYR CD2 C Y N 434 TYR CE1 C Y N 435 TYR CE2 C Y N 436 TYR CZ C Y N 437 TYR OH O N N 438 TYR OXT O N N 439 TYR H H N N 440 TYR H2 H N N 441 TYR HA H N N 442 TYR HB2 H N N 443 TYR HB3 H N N 444 TYR HD1 H N N 445 TYR HD2 H N N 446 TYR HE1 H N N 447 TYR HE2 H N N 448 TYR HH H N N 449 TYR HXT H N N 450 VAL N N N N 451 VAL CA C N S 452 VAL C C N N 453 VAL O O N N 454 VAL CB C N N 455 VAL CG1 C N N 456 VAL CG2 C N N 457 VAL OXT O N N 458 VAL H H N N 459 VAL H2 H N N 460 VAL HA H N N 461 VAL HB H N N 462 VAL HG11 H N N 463 VAL HG12 H N N 464 VAL HG13 H N N 465 VAL HG21 H N N 466 VAL HG22 H N N 467 VAL HG23 H N N 468 VAL HXT H N N 469 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CX7 CAA CAB sing N N 70 CX7 CAB CAC sing N N 71 CX7 CAB CAI sing N N 72 CX7 CAC CAK sing N N 73 CX7 CAD CAC doub N E 74 CX7 CAE CAD sing N N 75 CX7 CAE CAL sing N N 76 CX7 CAF CAE sing N N 77 CX7 CAF CAN doub N N 78 CX7 CAG CAF sing N N 79 CX7 CAG CAH sing N N 80 CX7 CAH CAA sing N N 81 CX7 CAI CAJ sing N N 82 CX7 CAK CAJ sing N N 83 CX7 CAK OAT sing N N 84 CX7 CAL CAM sing N N 85 CX7 CAN CAM sing N N 86 CX7 CAO CAE sing N N 87 CX7 CAP CAK sing N N 88 CX7 CAP OAU sing N N 89 CX7 CAQ CAA sing N N 90 CX7 OAR CAH sing N N 91 CX7 OAS CAG sing N N 92 CX7 CAV CAN sing N N 93 CX7 CAV CAX sing N N 94 CX7 CAW CAV sing N N 95 CX7 CAY OAU sing N N 96 CX7 CAA HAA sing N N 97 CX7 CAB HAB sing N N 98 CX7 CAD HAD sing N N 99 CX7 CAG HAG sing N N 100 CX7 CAH HAH sing N N 101 CX7 CAI HAI sing N N 102 CX7 CAI HAIA sing N N 103 CX7 CAJ HAJ sing N N 104 CX7 CAJ HAJA sing N N 105 CX7 CAL HAL sing N N 106 CX7 CAL HALA sing N N 107 CX7 CAM HAM sing N N 108 CX7 CAM HAMA sing N N 109 CX7 CAO HAO sing N N 110 CX7 CAO HAOA sing N N 111 CX7 CAO HAOB sing N N 112 CX7 CAP HAP sing N N 113 CX7 CAP HAPA sing N N 114 CX7 CAQ HAQ sing N N 115 CX7 CAQ HAQA sing N N 116 CX7 CAQ HAQB sing N N 117 CX7 OAR HOAR sing N N 118 CX7 OAS HOAS sing N N 119 CX7 OAT HOAT sing N N 120 CX7 CAV H25 sing N N 121 CX7 CAW HAW sing N N 122 CX7 CAW HAWA sing N N 123 CX7 CAW HAWB sing N N 124 CX7 CAX HAX sing N N 125 CX7 CAX HAXA sing N N 126 CX7 CAX H31 sing N N 127 CX7 CAY HAY sing N N 128 CX7 CAY HAYA sing N N 129 CX7 CAY HAYB sing N N 130 CYS N CA sing N N 131 CYS N H sing N N 132 CYS N H2 sing N N 133 CYS CA C sing N N 134 CYS CA CB sing N N 135 CYS CA HA sing N N 136 CYS C O doub N N 137 CYS C OXT sing N N 138 CYS CB SG sing N N 139 CYS CB HB2 sing N N 140 CYS CB HB3 sing N N 141 CYS SG HG sing N N 142 CYS OXT HXT sing N N 143 GLN N CA sing N N 144 GLN N H sing N N 145 GLN N H2 sing N N 146 GLN CA C sing N N 147 GLN CA CB sing N N 148 GLN CA HA sing N N 149 GLN C O doub N N 150 GLN C OXT sing N N 151 GLN CB CG sing N N 152 GLN CB HB2 sing N N 153 GLN CB HB3 sing N N 154 GLN CG CD sing N N 155 GLN CG HG2 sing N N 156 GLN CG HG3 sing N N 157 GLN CD OE1 doub N N 158 GLN CD NE2 sing N N 159 GLN NE2 HE21 sing N N 160 GLN NE2 HE22 sing N N 161 GLN OXT HXT sing N N 162 GLU N CA sing N N 163 GLU N H sing N N 164 GLU N H2 sing N N 165 GLU CA C sing N N 166 GLU CA CB sing N N 167 GLU CA HA sing N N 168 GLU C O doub N N 169 GLU C OXT sing N N 170 GLU CB CG sing N N 171 GLU CB HB2 sing N N 172 GLU CB HB3 sing N N 173 GLU CG CD sing N N 174 GLU CG HG2 sing N N 175 GLU CG HG3 sing N N 176 GLU CD OE1 doub N N 177 GLU CD OE2 sing N N 178 GLU OE2 HE2 sing N N 179 GLU OXT HXT sing N N 180 GLY N CA sing N N 181 GLY N H sing N N 182 GLY N H2 sing N N 183 GLY CA C sing N N 184 GLY CA HA2 sing N N 185 GLY CA HA3 sing N N 186 GLY C O doub N N 187 GLY C OXT sing N N 188 GLY OXT HXT sing N N 189 HIS N CA sing N N 190 HIS N H sing N N 191 HIS N H2 sing N N 192 HIS CA C sing N N 193 HIS CA CB sing N N 194 HIS CA HA sing N N 195 HIS C O doub N N 196 HIS C OXT sing N N 197 HIS CB CG sing N N 198 HIS CB HB2 sing N N 199 HIS CB HB3 sing N N 200 HIS CG ND1 sing Y N 201 HIS CG CD2 doub Y N 202 HIS ND1 CE1 doub Y N 203 HIS ND1 HD1 sing N N 204 HIS CD2 NE2 sing Y N 205 HIS CD2 HD2 sing N N 206 HIS CE1 NE2 sing Y N 207 HIS CE1 HE1 sing N N 208 HIS NE2 HE2 sing N N 209 HIS OXT HXT sing N N 210 HOH O H1 sing N N 211 HOH O H2 sing N N 212 ILE N CA sing N N 213 ILE N H sing N N 214 ILE N H2 sing N N 215 ILE CA C sing N N 216 ILE CA CB sing N N 217 ILE CA HA sing N N 218 ILE C O doub N N 219 ILE C OXT sing N N 220 ILE CB CG1 sing N N 221 ILE CB CG2 sing N N 222 ILE CB HB sing N N 223 ILE CG1 CD1 sing N N 224 ILE CG1 HG12 sing N N 225 ILE CG1 HG13 sing N N 226 ILE CG2 HG21 sing N N 227 ILE CG2 HG22 sing N N 228 ILE CG2 HG23 sing N N 229 ILE CD1 HD11 sing N N 230 ILE CD1 HD12 sing N N 231 ILE CD1 HD13 sing N N 232 ILE OXT HXT sing N N 233 LEU N CA sing N N 234 LEU N H sing N N 235 LEU N H2 sing N N 236 LEU CA C sing N N 237 LEU CA CB sing N N 238 LEU CA HA sing N N 239 LEU C O doub N N 240 LEU C OXT sing N N 241 LEU CB CG sing N N 242 LEU CB HB2 sing N N 243 LEU CB HB3 sing N N 244 LEU CG CD1 sing N N 245 LEU CG CD2 sing N N 246 LEU CG HG sing N N 247 LEU CD1 HD11 sing N N 248 LEU CD1 HD12 sing N N 249 LEU CD1 HD13 sing N N 250 LEU CD2 HD21 sing N N 251 LEU CD2 HD22 sing N N 252 LEU CD2 HD23 sing N N 253 LEU OXT HXT sing N N 254 LYS N CA sing N N 255 LYS N H sing N N 256 LYS N H2 sing N N 257 LYS CA C sing N N 258 LYS CA CB sing N N 259 LYS CA HA sing N N 260 LYS C O doub N N 261 LYS C OXT sing N N 262 LYS CB CG sing N N 263 LYS CB HB2 sing N N 264 LYS CB HB3 sing N N 265 LYS CG CD sing N N 266 LYS CG HG2 sing N N 267 LYS CG HG3 sing N N 268 LYS CD CE sing N N 269 LYS CD HD2 sing N N 270 LYS CD HD3 sing N N 271 LYS CE NZ sing N N 272 LYS CE HE2 sing N N 273 LYS CE HE3 sing N N 274 LYS NZ HZ1 sing N N 275 LYS NZ HZ2 sing N N 276 LYS NZ HZ3 sing N N 277 LYS OXT HXT sing N N 278 MET N CA sing N N 279 MET N H sing N N 280 MET N H2 sing N N 281 MET CA C sing N N 282 MET CA CB sing N N 283 MET CA HA sing N N 284 MET C O doub N N 285 MET C OXT sing N N 286 MET CB CG sing N N 287 MET CB HB2 sing N N 288 MET CB HB3 sing N N 289 MET CG SD sing N N 290 MET CG HG2 sing N N 291 MET CG HG3 sing N N 292 MET SD CE sing N N 293 MET CE HE1 sing N N 294 MET CE HE2 sing N N 295 MET CE HE3 sing N N 296 MET OXT HXT sing N N 297 PHE N CA sing N N 298 PHE N H sing N N 299 PHE N H2 sing N N 300 PHE CA C sing N N 301 PHE CA CB sing N N 302 PHE CA HA sing N N 303 PHE C O doub N N 304 PHE C OXT sing N N 305 PHE CB CG sing N N 306 PHE CB HB2 sing N N 307 PHE CB HB3 sing N N 308 PHE CG CD1 doub Y N 309 PHE CG CD2 sing Y N 310 PHE CD1 CE1 sing Y N 311 PHE CD1 HD1 sing N N 312 PHE CD2 CE2 doub Y N 313 PHE CD2 HD2 sing N N 314 PHE CE1 CZ doub Y N 315 PHE CE1 HE1 sing N N 316 PHE CE2 CZ sing Y N 317 PHE CE2 HE2 sing N N 318 PHE CZ HZ sing N N 319 PHE OXT HXT sing N N 320 PRO N CA sing N N 321 PRO N CD sing N N 322 PRO N H sing N N 323 PRO CA C sing N N 324 PRO CA CB sing N N 325 PRO CA HA sing N N 326 PRO C O doub N N 327 PRO C OXT sing N N 328 PRO CB CG sing N N 329 PRO CB HB2 sing N N 330 PRO CB HB3 sing N N 331 PRO CG CD sing N N 332 PRO CG HG2 sing N N 333 PRO CG HG3 sing N N 334 PRO CD HD2 sing N N 335 PRO CD HD3 sing N N 336 PRO OXT HXT sing N N 337 SEP N CA sing N N 338 SEP N H sing N N 339 SEP N H2 sing N N 340 SEP CA CB sing N N 341 SEP CA C sing N N 342 SEP CA HA sing N N 343 SEP CB OG sing N N 344 SEP CB HB2 sing N N 345 SEP CB HB3 sing N N 346 SEP OG P sing N N 347 SEP C O doub N N 348 SEP C OXT sing N N 349 SEP OXT HXT sing N N 350 SEP P O1P doub N N 351 SEP P O2P sing N N 352 SEP P O3P sing N N 353 SEP O2P HOP2 sing N N 354 SEP O3P HOP3 sing N N 355 SER N CA sing N N 356 SER N H sing N N 357 SER N H2 sing N N 358 SER CA C sing N N 359 SER CA CB sing N N 360 SER CA HA sing N N 361 SER C O doub N N 362 SER C OXT sing N N 363 SER CB OG sing N N 364 SER CB HB2 sing N N 365 SER CB HB3 sing N N 366 SER OG HG sing N N 367 SER OXT HXT sing N N 368 THR N CA sing N N 369 THR N H sing N N 370 THR N H2 sing N N 371 THR CA C sing N N 372 THR CA CB sing N N 373 THR CA HA sing N N 374 THR C O doub N N 375 THR C OXT sing N N 376 THR CB OG1 sing N N 377 THR CB CG2 sing N N 378 THR CB HB sing N N 379 THR OG1 HG1 sing N N 380 THR CG2 HG21 sing N N 381 THR CG2 HG22 sing N N 382 THR CG2 HG23 sing N N 383 THR OXT HXT sing N N 384 TRP N CA sing N N 385 TRP N H sing N N 386 TRP N H2 sing N N 387 TRP CA C sing N N 388 TRP CA CB sing N N 389 TRP CA HA sing N N 390 TRP C O doub N N 391 TRP C OXT sing N N 392 TRP CB CG sing N N 393 TRP CB HB2 sing N N 394 TRP CB HB3 sing N N 395 TRP CG CD1 doub Y N 396 TRP CG CD2 sing Y N 397 TRP CD1 NE1 sing Y N 398 TRP CD1 HD1 sing N N 399 TRP CD2 CE2 doub Y N 400 TRP CD2 CE3 sing Y N 401 TRP NE1 CE2 sing Y N 402 TRP NE1 HE1 sing N N 403 TRP CE2 CZ2 sing Y N 404 TRP CE3 CZ3 doub Y N 405 TRP CE3 HE3 sing N N 406 TRP CZ2 CH2 doub Y N 407 TRP CZ2 HZ2 sing N N 408 TRP CZ3 CH2 sing Y N 409 TRP CZ3 HZ3 sing N N 410 TRP CH2 HH2 sing N N 411 TRP OXT HXT sing N N 412 TYR N CA sing N N 413 TYR N H sing N N 414 TYR N H2 sing N N 415 TYR CA C sing N N 416 TYR CA CB sing N N 417 TYR CA HA sing N N 418 TYR C O doub N N 419 TYR C OXT sing N N 420 TYR CB CG sing N N 421 TYR CB HB2 sing N N 422 TYR CB HB3 sing N N 423 TYR CG CD1 doub Y N 424 TYR CG CD2 sing Y N 425 TYR CD1 CE1 sing Y N 426 TYR CD1 HD1 sing N N 427 TYR CD2 CE2 doub Y N 428 TYR CD2 HD2 sing N N 429 TYR CE1 CZ doub Y N 430 TYR CE1 HE1 sing N N 431 TYR CE2 CZ sing Y N 432 TYR CE2 HE2 sing N N 433 TYR CZ OH sing N N 434 TYR OH HH sing N N 435 TYR OXT HXT sing N N 436 VAL N CA sing N N 437 VAL N H sing N N 438 VAL N H2 sing N N 439 VAL CA C sing N N 440 VAL CA CB sing N N 441 VAL CA HA sing N N 442 VAL C O doub N N 443 VAL C OXT sing N N 444 VAL CB CG1 sing N N 445 VAL CB CG2 sing N N 446 VAL CB HB sing N N 447 VAL CG1 HG11 sing N N 448 VAL CG1 HG12 sing N N 449 VAL CG1 HG13 sing N N 450 VAL CG2 HG21 sing N N 451 VAL CG2 HG22 sing N N 452 VAL CG2 HG23 sing N N 453 VAL OXT HXT sing N N 454 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 Cotylenol CX7 4 'MAGNESIUM ION' MG 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3LW1 _pdbx_initial_refinement_model.details 'PDB Entry 3LW1' #