data_3SPX # _entry.id 3SPX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3SPX RCSB RCSB066506 WWPDB D_1000066506 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2PQM 'crystal structure of OASS from E. histolytica' unspecified PDB 1Z7W 'crystal structure of OASS from A. thaliana' unspecified PDB 2Q3C 'crystal structure of OASS from M. tuberculosis' unspecified # _pdbx_database_status.entry_id 3SPX _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-07-04 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Raj, I.' 1 'Gourinath, S.' 2 # _citation.id primary _citation.title ;The narrow active-site cleft of O-acetylserine sulfhydrylase from Leishmania donovani allows complex formation with serine acetyltransferases with a range of C-terminal sequences ; _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 68 _citation.page_first 909 _citation.page_last 919 _citation.year 2012 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22868756 _citation.pdbx_database_id_DOI 10.1107/S0907444912016459 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Raj, I.' 1 primary 'Kumar, S.' 2 primary 'Gourinath, S.' 3 # _cell.length_a 115.266 _cell.length_b 61.974 _cell.length_c 43.427 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3SPX _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.entry_id 3SPX _symmetry.Int_Tables_number 18 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'O-acetyl serine sulfhydrylase' 35907.250 1 2.5.1.47 ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 5 water nat water 18.015 196 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MAAPFDKSKNVAQSIDQLIGQTPALYLNKLNNTKAKVVLKMECENPMASV(LLP)DRLGFAIYDKAEKEGKLIPGKSIVV ESSSGNTGVSLAHLGAIRGYKVIITMPESMSLERRCLLRIFGAEVILTPAALGMKGAVAMAKKIVAANPNAVLADQFATK YNALIHEETTGPEIWEQTNHNVDCFIAGVGTGGTLTGVARALKKMGSHARIVAVEPTESPVLSGGKPGPHKIQGIGPGFV PDVLDRSLIDEVLCVAGDDAIETALKLTRSDGVFCGFSGGANVYAALKIAERPEMEGKTIVTVIPSFGERYLSTTLYRSV RDEVSSLPVALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAAPFDKSKNVAQSIDQLIGQTPALYLNKLNNTKAKVVLKMECENPMASVKDRLGFAIYDKAEKEGKLIPGKSIVVESSS GNTGVSLAHLGAIRGYKVIITMPESMSLERRCLLRIFGAEVILTPAALGMKGAVAMAKKIVAANPNAVLADQFATKYNAL IHEETTGPEIWEQTNHNVDCFIAGVGTGGTLTGVARALKKMGSHARIVAVEPTESPVLSGGKPGPHKIQGIGPGFVPDVL DRSLIDEVLCVAGDDAIETALKLTRSDGVFCGFSGGANVYAALKIAERPEMEGKTIVTVIPSFGERYLSTTLYRSVRDEV SSLPVALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 PRO n 1 5 PHE n 1 6 ASP n 1 7 LYS n 1 8 SER n 1 9 LYS n 1 10 ASN n 1 11 VAL n 1 12 ALA n 1 13 GLN n 1 14 SER n 1 15 ILE n 1 16 ASP n 1 17 GLN n 1 18 LEU n 1 19 ILE n 1 20 GLY n 1 21 GLN n 1 22 THR n 1 23 PRO n 1 24 ALA n 1 25 LEU n 1 26 TYR n 1 27 LEU n 1 28 ASN n 1 29 LYS n 1 30 LEU n 1 31 ASN n 1 32 ASN n 1 33 THR n 1 34 LYS n 1 35 ALA n 1 36 LYS n 1 37 VAL n 1 38 VAL n 1 39 LEU n 1 40 LYS n 1 41 MET n 1 42 GLU n 1 43 CYS n 1 44 GLU n 1 45 ASN n 1 46 PRO n 1 47 MET n 1 48 ALA n 1 49 SER n 1 50 VAL n 1 51 LLP n 1 52 ASP n 1 53 ARG n 1 54 LEU n 1 55 GLY n 1 56 PHE n 1 57 ALA n 1 58 ILE n 1 59 TYR n 1 60 ASP n 1 61 LYS n 1 62 ALA n 1 63 GLU n 1 64 LYS n 1 65 GLU n 1 66 GLY n 1 67 LYS n 1 68 LEU n 1 69 ILE n 1 70 PRO n 1 71 GLY n 1 72 LYS n 1 73 SER n 1 74 ILE n 1 75 VAL n 1 76 VAL n 1 77 GLU n 1 78 SER n 1 79 SER n 1 80 SER n 1 81 GLY n 1 82 ASN n 1 83 THR n 1 84 GLY n 1 85 VAL n 1 86 SER n 1 87 LEU n 1 88 ALA n 1 89 HIS n 1 90 LEU n 1 91 GLY n 1 92 ALA n 1 93 ILE n 1 94 ARG n 1 95 GLY n 1 96 TYR n 1 97 LYS n 1 98 VAL n 1 99 ILE n 1 100 ILE n 1 101 THR n 1 102 MET n 1 103 PRO n 1 104 GLU n 1 105 SER n 1 106 MET n 1 107 SER n 1 108 LEU n 1 109 GLU n 1 110 ARG n 1 111 ARG n 1 112 CYS n 1 113 LEU n 1 114 LEU n 1 115 ARG n 1 116 ILE n 1 117 PHE n 1 118 GLY n 1 119 ALA n 1 120 GLU n 1 121 VAL n 1 122 ILE n 1 123 LEU n 1 124 THR n 1 125 PRO n 1 126 ALA n 1 127 ALA n 1 128 LEU n 1 129 GLY n 1 130 MET n 1 131 LYS n 1 132 GLY n 1 133 ALA n 1 134 VAL n 1 135 ALA n 1 136 MET n 1 137 ALA n 1 138 LYS n 1 139 LYS n 1 140 ILE n 1 141 VAL n 1 142 ALA n 1 143 ALA n 1 144 ASN n 1 145 PRO n 1 146 ASN n 1 147 ALA n 1 148 VAL n 1 149 LEU n 1 150 ALA n 1 151 ASP n 1 152 GLN n 1 153 PHE n 1 154 ALA n 1 155 THR n 1 156 LYS n 1 157 TYR n 1 158 ASN n 1 159 ALA n 1 160 LEU n 1 161 ILE n 1 162 HIS n 1 163 GLU n 1 164 GLU n 1 165 THR n 1 166 THR n 1 167 GLY n 1 168 PRO n 1 169 GLU n 1 170 ILE n 1 171 TRP n 1 172 GLU n 1 173 GLN n 1 174 THR n 1 175 ASN n 1 176 HIS n 1 177 ASN n 1 178 VAL n 1 179 ASP n 1 180 CYS n 1 181 PHE n 1 182 ILE n 1 183 ALA n 1 184 GLY n 1 185 VAL n 1 186 GLY n 1 187 THR n 1 188 GLY n 1 189 GLY n 1 190 THR n 1 191 LEU n 1 192 THR n 1 193 GLY n 1 194 VAL n 1 195 ALA n 1 196 ARG n 1 197 ALA n 1 198 LEU n 1 199 LYS n 1 200 LYS n 1 201 MET n 1 202 GLY n 1 203 SER n 1 204 HIS n 1 205 ALA n 1 206 ARG n 1 207 ILE n 1 208 VAL n 1 209 ALA n 1 210 VAL n 1 211 GLU n 1 212 PRO n 1 213 THR n 1 214 GLU n 1 215 SER n 1 216 PRO n 1 217 VAL n 1 218 LEU n 1 219 SER n 1 220 GLY n 1 221 GLY n 1 222 LYS n 1 223 PRO n 1 224 GLY n 1 225 PRO n 1 226 HIS n 1 227 LYS n 1 228 ILE n 1 229 GLN n 1 230 GLY n 1 231 ILE n 1 232 GLY n 1 233 PRO n 1 234 GLY n 1 235 PHE n 1 236 VAL n 1 237 PRO n 1 238 ASP n 1 239 VAL n 1 240 LEU n 1 241 ASP n 1 242 ARG n 1 243 SER n 1 244 LEU n 1 245 ILE n 1 246 ASP n 1 247 GLU n 1 248 VAL n 1 249 LEU n 1 250 CYS n 1 251 VAL n 1 252 ALA n 1 253 GLY n 1 254 ASP n 1 255 ASP n 1 256 ALA n 1 257 ILE n 1 258 GLU n 1 259 THR n 1 260 ALA n 1 261 LEU n 1 262 LYS n 1 263 LEU n 1 264 THR n 1 265 ARG n 1 266 SER n 1 267 ASP n 1 268 GLY n 1 269 VAL n 1 270 PHE n 1 271 CYS n 1 272 GLY n 1 273 PHE n 1 274 SER n 1 275 GLY n 1 276 GLY n 1 277 ALA n 1 278 ASN n 1 279 VAL n 1 280 TYR n 1 281 ALA n 1 282 ALA n 1 283 LEU n 1 284 LYS n 1 285 ILE n 1 286 ALA n 1 287 GLU n 1 288 ARG n 1 289 PRO n 1 290 GLU n 1 291 MET n 1 292 GLU n 1 293 GLY n 1 294 LYS n 1 295 THR n 1 296 ILE n 1 297 VAL n 1 298 THR n 1 299 VAL n 1 300 ILE n 1 301 PRO n 1 302 SER n 1 303 PHE n 1 304 GLY n 1 305 GLU n 1 306 ARG n 1 307 TYR n 1 308 LEU n 1 309 SER n 1 310 THR n 1 311 THR n 1 312 LEU n 1 313 TYR n 1 314 ARG n 1 315 SER n 1 316 VAL n 1 317 ARG n 1 318 ASP n 1 319 GLU n 1 320 VAL n 1 321 SER n 1 322 SER n 1 323 LEU n 1 324 PRO n 1 325 VAL n 1 326 ALA n 1 327 LEU n 1 328 GLU n 1 329 HIS n 1 330 HIS n 1 331 HIS n 1 332 HIS n 1 333 HIS n 1 334 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene OASS _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MHOM/IM/1983/AG83 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Leishmania donovani' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5661 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21c _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G1C2I2_LEIDO _struct_ref.pdbx_db_accession G1C2I2 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAAPFDKSKNVAQSIDQLIGQTPALYLNKLNNTKAKVVLKMECENPMASVKDRLGFAIYDKAEKEGKLIPGKSIVVESSS GNTGVSLAHLGAIRGYKVIITMPESMSLERRCLLRIFGAEVILTPAALGMKGAVAMAKKIVAANPNAVLADQFATKYNAL IHEETTGPEIWEQTNHNVDCFIAGVGTGGTLTGVARALKKMGSHARIVAVEPTESPVLSGGKPGPHKIQGIGPGFVPDVL DRSLIDEVLCVAGDDAIETALKLTRSDGVFCGFSGGANVYAALKIAERPEMEGKTIVTVIPSFGERYLSTTLYRSVRDEV SSLPV ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3SPX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 325 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G1C2I2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 325 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 325 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3SPX ALA A 326 ? UNP G1C2I2 ? ? 'EXPRESSION TAG' 326 1 1 3SPX LEU A 327 ? UNP G1C2I2 ? ? 'EXPRESSION TAG' 327 2 1 3SPX GLU A 328 ? UNP G1C2I2 ? ? 'EXPRESSION TAG' 328 3 1 3SPX HIS A 329 ? UNP G1C2I2 ? ? 'EXPRESSION TAG' 329 4 1 3SPX HIS A 330 ? UNP G1C2I2 ? ? 'EXPRESSION TAG' 330 5 1 3SPX HIS A 331 ? UNP G1C2I2 ? ? 'EXPRESSION TAG' 331 6 1 3SPX HIS A 332 ? UNP G1C2I2 ? ? 'EXPRESSION TAG' 332 7 1 3SPX HIS A 333 ? UNP G1C2I2 ? ? 'EXPRESSION TAG' 333 8 1 3SPX HIS A 334 ? UNP G1C2I2 ? ? 'EXPRESSION TAG' 334 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LLP 'L-peptide linking' n '(2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid' "N'-PYRIDOXYL-LYSINE-5'-MONOPHOSPHATE" 'C14 H22 N3 O7 P' 375.314 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3SPX _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity 0.418 _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 45.02 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 289 _exptl_crystal_grow.pdbx_details 'KSCN, PEG 3350, Bis-tris propane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2010-05-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_wavelength_list 0.976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 # _reflns.entry_id 3SPX _reflns.d_resolution_high 1.790 _reflns.d_resolution_low 50.000 _reflns.number_obs 29629 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_netI_over_sigmaI 10.900 _reflns.pdbx_chi_squared 0.997 _reflns.pdbx_redundancy 7.800 _reflns.percent_possible_obs 99.300 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all 29852 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.790 1.830 ? ? ? ? 0.386 ? ? 0.752 5.600 ? ? ? 1359 ? ? ? ? 92.100 ? ? 1 1 1.830 1.860 ? ? ? ? 0.415 ? ? 0.741 6.500 ? ? ? 1399 ? ? ? ? 96.900 ? ? 2 1 1.860 1.900 ? ? ? ? 0.354 ? ? 0.752 7.300 ? ? ? 1444 ? ? ? ? 96.800 ? ? 3 1 1.900 1.940 ? ? ? ? 0.301 ? ? 0.747 7.700 ? ? ? 1429 ? ? ? ? 99.500 ? ? 4 1 1.940 1.980 ? ? ? ? 0.259 ? ? 0.748 8.000 ? ? ? 1486 ? ? ? ? 100.000 ? ? 5 1 1.980 2.030 ? ? ? ? 0.212 ? ? 0.764 8.100 ? ? ? 1439 ? ? ? ? 100.000 ? ? 6 1 2.030 2.080 ? ? ? ? 0.188 ? ? 0.783 8.100 ? ? ? 1501 ? ? ? ? 100.000 ? ? 7 1 2.080 2.130 ? ? ? ? 0.157 ? ? 0.800 8.200 ? ? ? 1445 ? ? ? ? 100.000 ? ? 8 1 2.130 2.200 ? ? ? ? 0.132 ? ? 0.813 8.200 ? ? ? 1479 ? ? ? ? 100.000 ? ? 9 1 2.200 2.270 ? ? ? ? 0.115 ? ? 0.816 8.200 ? ? ? 1478 ? ? ? ? 100.000 ? ? 10 1 2.270 2.350 ? ? ? ? 0.093 ? ? 0.821 8.200 ? ? ? 1477 ? ? ? ? 100.000 ? ? 11 1 2.350 2.440 ? ? ? ? 0.085 ? ? 0.797 8.200 ? ? ? 1482 ? ? ? ? 100.000 ? ? 12 1 2.440 2.550 ? ? ? ? 0.074 ? ? 0.809 8.200 ? ? ? 1489 ? ? ? ? 100.000 ? ? 13 1 2.550 2.690 ? ? ? ? 0.065 ? ? 0.840 8.200 ? ? ? 1507 ? ? ? ? 100.000 ? ? 14 1 2.690 2.860 ? ? ? ? 0.056 ? ? 0.918 8.100 ? ? ? 1479 ? ? ? ? 100.000 ? ? 15 1 2.860 3.080 ? ? ? ? 0.053 ? ? 1.151 8.100 ? ? ? 1513 ? ? ? ? 100.000 ? ? 16 1 3.080 3.390 ? ? ? ? 0.055 ? ? 1.740 8.000 ? ? ? 1491 ? ? ? ? 100.000 ? ? 17 1 3.390 3.880 ? ? ? ? 0.056 ? ? 2.494 7.900 ? ? ? 1531 ? ? ? ? 100.000 ? ? 18 1 3.880 4.880 ? ? ? ? 0.035 ? ? 1.495 7.900 ? ? ? 1554 ? ? ? ? 100.000 ? ? 19 1 4.880 50.000 ? ? ? ? 0.024 ? ? 0.918 7.400 ? ? ? 1647 ? ? ? ? 99.900 ? ? 20 1 # _refine.entry_id 3SPX _refine.ls_d_res_high 1.7900 _refine.ls_d_res_low 42.20 _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.4900 _refine.ls_number_reflns_obs 29499 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: REFINED INDIVIDUALLY ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1780 _refine.ls_R_factor_R_work 0.1760 _refine.ls_wR_factor_R_work 0.1670 _refine.ls_R_factor_R_free 0.2163 _refine.ls_wR_factor_R_free 0.2070 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_number_reflns_R_free 1437 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 20.7145 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -1.1300 _refine.aniso_B[2][2] 0.2500 _refine.aniso_B[3][3] 0.8900 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9600 _refine.correlation_coeff_Fo_to_Fc_free 0.9440 _refine.overall_SU_R_Cruickshank_DPI 0.1238 _refine.overall_SU_R_free 0.1207 _refine.pdbx_overall_ESU_R_Free 0.1210 _refine.overall_SU_ML 0.0760 _refine.overall_SU_B 2.4060 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8612 _refine.B_iso_max 58.070 _refine.B_iso_min 3.820 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.500 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2396 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 196 _refine_hist.number_atoms_total 2601 _refine_hist.d_res_high 1.7900 _refine_hist.d_res_low 42.20 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 2441 0.028 0.022 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 3302 2.104 1.992 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 319 6.333 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 87 34.016 24.483 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 426 12.802 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 13 18.419 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 385 0.159 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 1782 0.012 0.021 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 1584 1.397 1.500 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 2547 2.285 2.000 ? ? 'X-RAY DIFFRACTION' r_scbond_it 857 3.877 3.000 ? ? 'X-RAY DIFFRACTION' r_scangle_it 755 6.142 4.500 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 1.7940 _refine_ls_shell.d_res_low 1.8400 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 87.5800 _refine_ls_shell.number_reflns_R_work 1812 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2980 _refine_ls_shell.R_factor_R_free 0.3350 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 84 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1896 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 3SPX _struct.title 'Crystal structure of O-Acetyl Serine Sulfhydrylase from Leishmania donovani' _struct.pdbx_descriptor 'O-Acetyl Serine Sulfhydrylase (E.C.2.5.1.47)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3SPX _struct_keywords.text ;O-Acetyl Serine Sulfhydrylase, Cysteine Synthase, Type II PLP dependent enzyme, Cysteine biocynthesis, Serine Acetyl Transferase, cytosolic, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 14 ? ILE A 19 ? SER A 14 ILE A 19 5 ? 6 HELX_P HELX_P2 2 CYS A 43 ? ASN A 45 ? CYS A 43 ASN A 45 5 ? 3 HELX_P HELX_P3 3 VAL A 50 ? GLU A 65 ? VAL A 50 GLU A 65 1 ? 16 HELX_P HELX_P4 4 GLY A 81 ? GLY A 95 ? GLY A 81 GLY A 95 1 ? 15 HELX_P HELX_P5 5 SER A 107 ? PHE A 117 ? SER A 107 PHE A 117 1 ? 11 HELX_P HELX_P6 6 PRO A 125 ? ALA A 127 ? PRO A 125 ALA A 127 5 ? 3 HELX_P HELX_P7 7 LEU A 128 ? ASN A 144 ? LEU A 128 ASN A 144 1 ? 17 HELX_P HELX_P8 8 LYS A 156 ? THR A 165 ? LYS A 156 THR A 165 1 ? 10 HELX_P HELX_P9 9 THR A 165 ? THR A 174 ? THR A 165 THR A 174 1 ? 10 HELX_P HELX_P10 10 GLY A 188 ? MET A 201 ? GLY A 188 MET A 201 1 ? 14 HELX_P HELX_P11 11 ASP A 241 ? ILE A 245 ? ASP A 241 ILE A 245 5 ? 5 HELX_P HELX_P12 12 ALA A 252 ? ASP A 267 ? ALA A 252 ASP A 267 1 ? 16 HELX_P HELX_P13 13 GLY A 272 ? GLU A 287 ? GLY A 272 GLU A 287 1 ? 16 HELX_P HELX_P14 14 ARG A 288 ? GLU A 292 ? ARG A 288 GLU A 292 5 ? 5 HELX_P HELX_P15 15 PHE A 303 ? LEU A 308 ? PHE A 303 LEU A 308 5 ? 6 HELX_P HELX_P16 16 THR A 310 ? LEU A 312 ? THR A 310 LEU A 312 5 ? 3 HELX_P HELX_P17 17 TYR A 313 ? SER A 321 ? TYR A 313 SER A 321 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A VAL 50 C ? ? ? 1_555 A LLP 51 N ? ? A VAL 50 A LLP 51 1_555 ? ? ? ? ? ? ? 1.345 ? covale2 covale ? ? A LLP 51 C ? ? ? 1_555 A ASP 52 N ? ? A LLP 51 A ASP 52 1_555 ? ? ? ? ? ? ? 1.352 ? metalc1 metalc ? ? A GLU 44 OE1 ? ? ? 1_555 C NA . NA ? ? A GLU 44 A NA 336 1_555 ? ? ? ? ? ? ? 2.928 ? metalc2 metalc ? ? A GLU 44 OE2 ? ? ? 1_555 C NA . NA ? ? A GLU 44 A NA 336 1_555 ? ? ? ? ? ? ? 2.963 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 24 ? TYR A 26 ? ALA A 24 TYR A 26 A 2 LYS A 36 ? MET A 41 ? LYS A 36 MET A 41 A 3 THR A 295 ? ILE A 300 ? THR A 295 ILE A 300 A 4 CYS A 180 ? GLY A 184 ? CYS A 180 GLY A 184 A 5 ARG A 206 ? PRO A 212 ? ARG A 206 PRO A 212 A 6 GLU A 247 ? VAL A 251 ? GLU A 247 VAL A 251 B 1 GLU A 120 ? THR A 124 ? GLU A 120 THR A 124 B 2 LYS A 97 ? PRO A 103 ? LYS A 97 PRO A 103 B 3 ILE A 74 ? SER A 78 ? ILE A 74 SER A 78 B 4 ALA A 147 ? LEU A 149 ? ALA A 147 LEU A 149 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 25 ? N LEU A 25 O LEU A 39 ? O LEU A 39 A 2 3 N VAL A 38 ? N VAL A 38 O ILE A 296 ? O ILE A 296 A 3 4 O VAL A 297 ? O VAL A 297 N CYS A 180 ? N CYS A 180 A 4 5 N PHE A 181 ? N PHE A 181 O VAL A 208 ? O VAL A 208 A 5 6 N ALA A 209 ? N ALA A 209 O LEU A 249 ? O LEU A 249 B 1 2 O GLU A 120 ? O GLU A 120 N VAL A 98 ? N VAL A 98 B 2 3 O ILE A 99 ? O ILE A 99 N VAL A 75 ? N VAL A 75 B 3 4 N ILE A 74 ? N ILE A 74 O VAL A 148 ? O VAL A 148 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL A 335' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 336' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PEG A 337' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLY A 272 ? GLY A 272 . ? 1_555 ? 2 AC1 5 SER A 274 ? SER A 274 . ? 1_555 ? 3 AC1 5 GLY A 275 ? GLY A 275 . ? 1_555 ? 4 AC1 5 PRO A 301 ? PRO A 301 . ? 1_555 ? 5 AC1 5 SER A 302 ? SER A 302 . ? 1_555 ? 6 AC2 5 GLU A 44 ? GLU A 44 . ? 1_555 ? 7 AC2 5 ASN A 45 ? ASN A 45 . ? 2_755 ? 8 AC2 5 PRO A 46 ? PRO A 46 . ? 2_755 ? 9 AC2 5 HOH E . ? HOH A 503 . ? 2_755 ? 10 AC2 5 HOH E . ? HOH A 504 . ? 2_755 ? 11 AC3 6 GLN A 13 ? GLN A 13 . ? 2_755 ? 12 AC3 6 TYR A 26 ? TYR A 26 . ? 1_555 ? 13 AC3 6 ASN A 31 ? ASN A 31 . ? 1_555 ? 14 AC3 6 LYS A 36 ? LYS A 36 . ? 1_555 ? 15 AC3 6 HOH E . ? HOH A 351 . ? 1_555 ? 16 AC3 6 HOH E . ? HOH A 493 . ? 1_555 ? # _atom_sites.entry_id 3SPX _atom_sites.fract_transf_matrix[1][1] 0.008676 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016136 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023027 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N NA O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LLP 51 51 51 LLP LLP A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 CYS 112 112 112 CYS CYS A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 HIS 162 162 162 HIS HIS A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 TRP 171 171 171 TRP TRP A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 CYS 180 180 180 CYS CYS A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 MET 201 201 201 MET MET A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 PRO 212 212 212 PRO PRO A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 LYS 222 222 222 LYS LYS A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 HIS 226 226 226 HIS HIS A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 GLN 229 229 229 GLN GLN A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 PRO 233 233 233 PRO PRO A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 PHE 235 235 235 PHE PHE A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 ARG 242 242 242 ARG ARG A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 CYS 250 250 250 CYS CYS A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 ASP 254 254 254 ASP ASP A . n A 1 255 ASP 255 255 255 ASP ASP A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 GLU 258 258 258 GLU GLU A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 LYS 262 262 262 LYS LYS A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 THR 264 264 264 THR THR A . n A 1 265 ARG 265 265 265 ARG ARG A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 ASP 267 267 267 ASP ASP A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 VAL 269 269 269 VAL VAL A . n A 1 270 PHE 270 270 270 PHE PHE A . n A 1 271 CYS 271 271 271 CYS CYS A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 PHE 273 273 273 PHE PHE A . n A 1 274 SER 274 274 274 SER SER A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 ASN 278 278 278 ASN ASN A . n A 1 279 VAL 279 279 279 VAL VAL A . n A 1 280 TYR 280 280 280 TYR TYR A . n A 1 281 ALA 281 281 281 ALA ALA A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 LYS 284 284 284 LYS LYS A . n A 1 285 ILE 285 285 285 ILE ILE A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 GLU 287 287 287 GLU GLU A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 PRO 289 289 289 PRO PRO A . n A 1 290 GLU 290 290 290 GLU GLU A . n A 1 291 MET 291 291 291 MET MET A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 LYS 294 294 294 LYS LYS A . n A 1 295 THR 295 295 295 THR THR A . n A 1 296 ILE 296 296 296 ILE ILE A . n A 1 297 VAL 297 297 297 VAL VAL A . n A 1 298 THR 298 298 298 THR THR A . n A 1 299 VAL 299 299 299 VAL VAL A . n A 1 300 ILE 300 300 300 ILE ILE A . n A 1 301 PRO 301 301 301 PRO PRO A . n A 1 302 SER 302 302 302 SER SER A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 GLY 304 304 304 GLY GLY A . n A 1 305 GLU 305 305 305 GLU GLU A . n A 1 306 ARG 306 306 306 ARG ARG A . n A 1 307 TYR 307 307 307 TYR TYR A . n A 1 308 LEU 308 308 308 LEU LEU A . n A 1 309 SER 309 309 309 SER SER A . n A 1 310 THR 310 310 310 THR THR A . n A 1 311 THR 311 311 311 THR THR A . n A 1 312 LEU 312 312 312 LEU LEU A . n A 1 313 TYR 313 313 313 TYR TYR A . n A 1 314 ARG 314 314 314 ARG ARG A . n A 1 315 SER 315 315 315 SER SER A . n A 1 316 VAL 316 316 316 VAL VAL A . n A 1 317 ARG 317 317 317 ARG ARG A . n A 1 318 ASP 318 318 318 ASP ASP A . n A 1 319 GLU 319 319 319 GLU GLU A . n A 1 320 VAL 320 320 320 VAL VAL A . n A 1 321 SER 321 321 321 SER SER A . n A 1 322 SER 322 322 ? ? ? A . n A 1 323 LEU 323 323 ? ? ? A . n A 1 324 PRO 324 324 ? ? ? A . n A 1 325 VAL 325 325 ? ? ? A . n A 1 326 ALA 326 326 ? ? ? A . n A 1 327 LEU 327 327 ? ? ? A . n A 1 328 GLU 328 328 ? ? ? A . n A 1 329 HIS 329 329 ? ? ? A . n A 1 330 HIS 330 330 ? ? ? A . n A 1 331 HIS 331 331 ? ? ? A . n A 1 332 HIS 332 332 ? ? ? A . n A 1 333 HIS 333 333 ? ? ? A . n A 1 334 HIS 334 334 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 335 197 CL CL A . C 3 NA 1 336 198 NA NA A . D 4 PEG 1 337 204 PEG PEG A . E 5 HOH 1 338 11 HOH HOH A . E 5 HOH 2 339 12 HOH HOH A . E 5 HOH 3 340 13 HOH HOH A . E 5 HOH 4 341 14 HOH HOH A . E 5 HOH 5 342 15 HOH HOH A . E 5 HOH 6 343 16 HOH HOH A . E 5 HOH 7 344 17 HOH HOH A . E 5 HOH 8 345 18 HOH HOH A . E 5 HOH 9 346 19 HOH HOH A . E 5 HOH 10 347 20 HOH HOH A . E 5 HOH 11 348 21 HOH HOH A . E 5 HOH 12 349 22 HOH HOH A . E 5 HOH 13 350 23 HOH HOH A . E 5 HOH 14 351 24 HOH HOH A . E 5 HOH 15 352 25 HOH HOH A . E 5 HOH 16 353 26 HOH HOH A . E 5 HOH 17 354 27 HOH HOH A . E 5 HOH 18 355 28 HOH HOH A . E 5 HOH 19 356 29 HOH HOH A . E 5 HOH 20 357 30 HOH HOH A . E 5 HOH 21 358 31 HOH HOH A . E 5 HOH 22 359 32 HOH HOH A . E 5 HOH 23 360 33 HOH HOH A . E 5 HOH 24 361 34 HOH HOH A . E 5 HOH 25 362 35 HOH HOH A . E 5 HOH 26 363 36 HOH HOH A . E 5 HOH 27 364 37 HOH HOH A . E 5 HOH 28 365 38 HOH HOH A . E 5 HOH 29 366 39 HOH HOH A . E 5 HOH 30 367 40 HOH HOH A . E 5 HOH 31 368 41 HOH HOH A . E 5 HOH 32 369 42 HOH HOH A . E 5 HOH 33 370 43 HOH HOH A . E 5 HOH 34 371 44 HOH HOH A . E 5 HOH 35 372 45 HOH HOH A . E 5 HOH 36 373 46 HOH HOH A . E 5 HOH 37 374 47 HOH HOH A . E 5 HOH 38 375 48 HOH HOH A . E 5 HOH 39 376 49 HOH HOH A . E 5 HOH 40 377 50 HOH HOH A . E 5 HOH 41 378 51 HOH HOH A . E 5 HOH 42 379 52 HOH HOH A . E 5 HOH 43 380 53 HOH HOH A . E 5 HOH 44 381 54 HOH HOH A . E 5 HOH 45 382 55 HOH HOH A . E 5 HOH 46 383 56 HOH HOH A . E 5 HOH 47 384 57 HOH HOH A . E 5 HOH 48 385 58 HOH HOH A . E 5 HOH 49 386 59 HOH HOH A . E 5 HOH 50 387 60 HOH HOH A . E 5 HOH 51 388 61 HOH HOH A . E 5 HOH 52 389 62 HOH HOH A . E 5 HOH 53 390 63 HOH HOH A . E 5 HOH 54 391 64 HOH HOH A . E 5 HOH 55 392 65 HOH HOH A . E 5 HOH 56 393 66 HOH HOH A . E 5 HOH 57 394 67 HOH HOH A . E 5 HOH 58 395 68 HOH HOH A . E 5 HOH 59 396 69 HOH HOH A . E 5 HOH 60 397 70 HOH HOH A . E 5 HOH 61 398 71 HOH HOH A . E 5 HOH 62 399 72 HOH HOH A . E 5 HOH 63 400 73 HOH HOH A . E 5 HOH 64 401 74 HOH HOH A . E 5 HOH 65 402 75 HOH HOH A . E 5 HOH 66 403 76 HOH HOH A . E 5 HOH 67 404 77 HOH HOH A . E 5 HOH 68 405 78 HOH HOH A . E 5 HOH 69 406 79 HOH HOH A . E 5 HOH 70 407 80 HOH HOH A . E 5 HOH 71 408 81 HOH HOH A . E 5 HOH 72 409 82 HOH HOH A . E 5 HOH 73 410 83 HOH HOH A . E 5 HOH 74 411 84 HOH HOH A . E 5 HOH 75 412 85 HOH HOH A . E 5 HOH 76 413 86 HOH HOH A . E 5 HOH 77 414 87 HOH HOH A . E 5 HOH 78 415 88 HOH HOH A . E 5 HOH 79 416 89 HOH HOH A . E 5 HOH 80 417 90 HOH HOH A . E 5 HOH 81 418 91 HOH HOH A . E 5 HOH 82 419 92 HOH HOH A . E 5 HOH 83 420 93 HOH HOH A . E 5 HOH 84 421 94 HOH HOH A . E 5 HOH 85 422 95 HOH HOH A . E 5 HOH 86 423 96 HOH HOH A . E 5 HOH 87 424 97 HOH HOH A . E 5 HOH 88 425 98 HOH HOH A . E 5 HOH 89 426 99 HOH HOH A . E 5 HOH 90 427 100 HOH HOH A . E 5 HOH 91 428 101 HOH HOH A . E 5 HOH 92 429 102 HOH HOH A . E 5 HOH 93 430 103 HOH HOH A . E 5 HOH 94 431 104 HOH HOH A . E 5 HOH 95 432 105 HOH HOH A . E 5 HOH 96 433 106 HOH HOH A . E 5 HOH 97 434 107 HOH HOH A . E 5 HOH 98 435 108 HOH HOH A . E 5 HOH 99 436 109 HOH HOH A . E 5 HOH 100 437 110 HOH HOH A . E 5 HOH 101 438 111 HOH HOH A . E 5 HOH 102 439 112 HOH HOH A . E 5 HOH 103 440 113 HOH HOH A . E 5 HOH 104 441 114 HOH HOH A . E 5 HOH 105 442 115 HOH HOH A . E 5 HOH 106 443 116 HOH HOH A . E 5 HOH 107 444 117 HOH HOH A . E 5 HOH 108 445 118 HOH HOH A . E 5 HOH 109 446 119 HOH HOH A . E 5 HOH 110 447 120 HOH HOH A . E 5 HOH 111 448 121 HOH HOH A . E 5 HOH 112 449 122 HOH HOH A . E 5 HOH 113 450 123 HOH HOH A . E 5 HOH 114 451 124 HOH HOH A . E 5 HOH 115 452 125 HOH HOH A . E 5 HOH 116 453 126 HOH HOH A . E 5 HOH 117 454 127 HOH HOH A . E 5 HOH 118 455 128 HOH HOH A . E 5 HOH 119 456 129 HOH HOH A . E 5 HOH 120 457 130 HOH HOH A . E 5 HOH 121 458 131 HOH HOH A . E 5 HOH 122 459 132 HOH HOH A . E 5 HOH 123 460 133 HOH HOH A . E 5 HOH 124 461 134 HOH HOH A . E 5 HOH 125 462 135 HOH HOH A . E 5 HOH 126 463 136 HOH HOH A . E 5 HOH 127 464 137 HOH HOH A . E 5 HOH 128 465 138 HOH HOH A . E 5 HOH 129 466 139 HOH HOH A . E 5 HOH 130 467 140 HOH HOH A . E 5 HOH 131 468 141 HOH HOH A . E 5 HOH 132 469 142 HOH HOH A . E 5 HOH 133 470 143 HOH HOH A . E 5 HOH 134 471 144 HOH HOH A . E 5 HOH 135 472 145 HOH HOH A . E 5 HOH 136 473 146 HOH HOH A . E 5 HOH 137 474 147 HOH HOH A . E 5 HOH 138 475 148 HOH HOH A . E 5 HOH 139 476 149 HOH HOH A . E 5 HOH 140 477 150 HOH HOH A . E 5 HOH 141 478 151 HOH HOH A . E 5 HOH 142 479 152 HOH HOH A . E 5 HOH 143 480 153 HOH HOH A . E 5 HOH 144 481 154 HOH HOH A . E 5 HOH 145 482 155 HOH HOH A . E 5 HOH 146 483 156 HOH HOH A . E 5 HOH 147 484 157 HOH HOH A . E 5 HOH 148 485 158 HOH HOH A . E 5 HOH 149 486 159 HOH HOH A . E 5 HOH 150 487 160 HOH HOH A . E 5 HOH 151 488 161 HOH HOH A . E 5 HOH 152 489 162 HOH HOH A . E 5 HOH 153 490 163 HOH HOH A . E 5 HOH 154 491 164 HOH HOH A . E 5 HOH 155 492 165 HOH HOH A . E 5 HOH 156 493 166 HOH HOH A . E 5 HOH 157 494 167 HOH HOH A . E 5 HOH 158 495 168 HOH HOH A . E 5 HOH 159 496 169 HOH HOH A . E 5 HOH 160 497 170 HOH HOH A . E 5 HOH 161 498 171 HOH HOH A . E 5 HOH 162 499 172 HOH HOH A . E 5 HOH 163 500 173 HOH HOH A . E 5 HOH 164 501 174 HOH HOH A . E 5 HOH 165 502 175 HOH HOH A . E 5 HOH 166 503 176 HOH HOH A . E 5 HOH 167 504 177 HOH HOH A . E 5 HOH 168 505 178 HOH HOH A . E 5 HOH 169 506 179 HOH HOH A . E 5 HOH 170 507 180 HOH HOH A . E 5 HOH 171 508 181 HOH HOH A . E 5 HOH 172 509 182 HOH HOH A . E 5 HOH 173 510 183 HOH HOH A . E 5 HOH 174 511 184 HOH HOH A . E 5 HOH 175 512 185 HOH HOH A . E 5 HOH 176 513 186 HOH HOH A . E 5 HOH 177 514 187 HOH HOH A . E 5 HOH 178 515 188 HOH HOH A . E 5 HOH 179 516 189 HOH HOH A . E 5 HOH 180 517 190 HOH HOH A . E 5 HOH 181 518 191 HOH HOH A . E 5 HOH 182 519 192 HOH HOH A . E 5 HOH 183 520 193 HOH HOH A . E 5 HOH 184 521 194 HOH HOH A . E 5 HOH 185 522 195 HOH HOH A . E 5 HOH 186 523 196 HOH HOH A . E 5 HOH 187 524 1 HOH HOH A . E 5 HOH 188 525 2 HOH HOH A . E 5 HOH 189 526 3 HOH HOH A . E 5 HOH 190 527 4 HOH HOH A . E 5 HOH 191 528 5 HOH HOH A . E 5 HOH 192 529 6 HOH HOH A . E 5 HOH 193 530 7 HOH HOH A . E 5 HOH 194 531 8 HOH HOH A . E 5 HOH 195 532 9 HOH HOH A . E 5 HOH 196 533 10 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id LLP _pdbx_struct_mod_residue.label_seq_id 51 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id LLP _pdbx_struct_mod_residue.auth_seq_id 51 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6320 ? 1 MORE -76 ? 1 'SSA (A^2)' 23340 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_755 -x+2,-y,z -1.0000000000 0.0000000000 0.0000000000 230.5320000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 389 ? E HOH . 2 1 A HOH 502 ? E HOH . # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OE1 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id GLU _pdbx_struct_conn_angle.ptnr1_label_seq_id 44 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id GLU _pdbx_struct_conn_angle.ptnr1_auth_seq_id 44 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id NA _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id C _pdbx_struct_conn_angle.ptnr2_label_comp_id NA _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id NA _pdbx_struct_conn_angle.ptnr2_auth_seq_id 336 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id OE2 _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id GLU _pdbx_struct_conn_angle.ptnr3_label_seq_id 44 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id GLU _pdbx_struct_conn_angle.ptnr3_auth_seq_id 44 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 42.6 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-07-04 2 'Structure model' 1 1 2012-08-08 3 'Structure model' 1 2 2014-03-12 4 'Structure model' 1 3 2017-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' # _pdbx_phasing_MR.entry_id 3SPX _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 1.970 _pdbx_phasing_MR.d_res_low_rotation 42.200 _pdbx_phasing_MR.d_res_high_translation 1.970 _pdbx_phasing_MR.d_res_low_translation 42.200 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 MOLREP . ? program 'Alexei Vaguine' alexei@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/molrep.html Fortran_77 ? 4 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A MET 106 ? ? NH1 A ARG 111 ? ? 1.77 2 1 OE1 A GLU 63 ? ? O A HOH 520 ? ? 2.02 3 1 O A HOH 489 ? ? O A HOH 501 ? ? 2.12 4 1 OE2 A GLU 104 ? ? O A HOH 508 ? ? 2.15 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 503 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 504 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_755 _pdbx_validate_symm_contact.dist 1.69 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CE2 A TYR 96 ? ? CD2 A TYR 96 ? ? 1.284 1.389 -0.105 0.015 N 2 1 CB A CYS 112 ? ? SG A CYS 112 ? ? 1.931 1.818 0.113 0.017 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 317 ? ? CZ A ARG 317 ? ? NH1 A ARG 317 ? ? 124.46 120.30 4.16 0.50 N 2 1 NE A ARG 317 ? ? CZ A ARG 317 ? ? NH2 A ARG 317 ? ? 116.90 120.30 -3.40 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 28 ? ? -124.10 -83.47 2 1 LYS A 72 ? ? -121.34 -54.91 3 1 THR A 165 ? ? -125.39 -68.65 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 322 ? A SER 322 3 1 Y 1 A LEU 323 ? A LEU 323 4 1 Y 1 A PRO 324 ? A PRO 324 5 1 Y 1 A VAL 325 ? A VAL 325 6 1 Y 1 A ALA 326 ? A ALA 326 7 1 Y 1 A LEU 327 ? A LEU 327 8 1 Y 1 A GLU 328 ? A GLU 328 9 1 Y 1 A HIS 329 ? A HIS 329 10 1 Y 1 A HIS 330 ? A HIS 330 11 1 Y 1 A HIS 331 ? A HIS 331 12 1 Y 1 A HIS 332 ? A HIS 332 13 1 Y 1 A HIS 333 ? A HIS 333 14 1 Y 1 A HIS 334 ? A HIS 334 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'SODIUM ION' NA 4 'DI(HYDROXYETHYL)ETHER' PEG 5 water HOH #