data_3SSI # _entry.id 3SSI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3SSI WWPDB D_1000179157 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 1996-08-17 _pdbx_database_PDB_obs_spr.pdb_id 3SSI _pdbx_database_PDB_obs_spr.replace_pdb_id 2SSI _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3SSI _pdbx_database_status.recvd_initial_deposition_date 1996-03-01 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Suzuki, T.' 1 'Nonaka, T.' 2 'Mitsui, Y.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural Modulation of the Protein Proteinase Inhibitor Ssi (Streptomyces Subtilisin Inhibitor)' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Crystal Structure of an Engineered Subtilisin Inhibitor Complexed with Bovine Trypsin' Proc.Natl.Acad.Sci.USA 89 4407 ? 1992 PNASA6 US 0027-8424 0040 ? ? ? 2 ;Refined Crystal Structure of the Complex of Subtilisin Bpn' and Streptomyces Subtilisin Inhibitor at 1.8 A Resolution ; J.Mol.Biol. 221 309 ? 1991 JMOBAK UK 0022-2836 0070 ? ? ? 3 ;Molecular Recognition at the Active Site of Subtilisin Bpn': Crystallographic Studies Using Genetically Engineered Proteinaceous Inhibitor Ssi (Streptomyces Subtilisin Inhibitor) ; 'Protein Eng.' 4 501 ? 1991 PRENE9 UK 0269-2139 0859 ? ? ? 4 ;Interactions of Streptomyces Subtilisin Inhibitor with Streptomyces Griseus Proteases a and B. Enzyme Kinetic and Computer Simulation Studies ; 'J.Biochem.(Tokyo)' 98 1263 ? 1985 JOBIAO JA 0021-924X 0418 ? ? ? 6 ;Crystal Structure at 2.6 A Resolution of the Complex of Subtilisin Bpn' with Streptomyces Subtilisin Inhibitor ; J.Mol.Biol. 178 389 ? 1984 JMOBAK UK 0022-2836 0070 ? ? ? 7 'Solvent Accessibility and Microenvironment in a Bacterial Protein Proteinase Inhibitor Ssi (Streptomyces Subtilisin Inhibitor)' 'J.Biochem.(Tokyo)' 88 1739 ? 1980 JOBIAO JA 0021-924X 0418 ? ? ? 8 ;Crystal Structure of the Complex of Subtilisin Bpn' with its Protein Inhibitor Streptomyces Subtilisin Inhibitor. The Structure at 4.3 Angstroms Resolution ; J.Mol.Biol. 131 855 ? 1979 JMOBAK UK 0022-2836 0070 ? ? ? 9 'Crystal Structure of a Bacterial Protein Proteinase Inhibitor (Streptomyces Subtilisin Inhibitor) at 2.6 A Resolution' J.Mol.Biol. 131 697 ? 1979 JMOBAK UK 0022-2836 0070 ? ? ? 10 'Crystal Structures of Streptomyces Subtilisin Inhibitor and its Complex with Subtilisin Bpn' Nature 277 447 ? 1979 NATUAS UK 0028-0836 0006 ? ? ? 11 'Crystal Structure of a Protein Proteinase Inhibitor, Ssi (Streptomyces Subtilisin Inhibitor), at 4 A Resolution' 'J.Biochem.(Tokyo)' 84 897 ? 1978 JOBIAO JA 0021-924X 0418 ? ? ? 12 'Crystal Structure of a Protein Proteinase Inhibitor, Streptomyces Subtilisin Inhibitor, at 2.3 Angstrom Resolution' 'J.Biochem.(Tokyo)' 82 295 ? 1977 JOBIAO JA 0021-924X 0418 ? ? ? 13 'Crystallization and Preliminary X-Ray Investigation of a New Alkaline Protease Inhibitor and its Complex with Subtilisin Bpn' J.Mol.Biol. 75 745 ? 1973 JMOBAK UK 0022-2836 0070 ? ? ? 5 ? 'Protein Protease Inhibitor: The Case of Streptomyces Subtilisin Inhibitor (Ssi)' ? ? ? 1985 ? ? 0-444-80597-4 2087 'Amsterdam : Elsevier Science Publishers' ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Suzuki, T.' 1 1 'Takeuchi, Y.' 2 1 'Nonaka, T.' 3 1 'Nakamura, K.T.' 4 1 'Kojima, S.' 5 1 'Miura, K.' 6 1 'Mitsui, Y.' 7 2 'Takeuchi, Y.' 8 2 'Satow, Y.' 9 2 'Nakamura, K.T.' 10 2 'Mitsui, Y.' 11 3 'Takeuchi, Y.' 12 3 'Noguchi, S.' 13 3 'Satow, Y.' 14 3 'Kojima, S.' 15 3 'Kumagai, I.' 16 3 'Miura, K.' 17 3 'Nakamura, K.T.' 18 3 'Mitsui, Y.' 19 4 'Christensen, U.' 20 4 'Ishida, S.' 21 4 'Ishii, S.' 22 4 'Mitsui, Y.' 23 4 'Iitaka, Y.' 24 4 'Mcclarin, J.' 25 4 'Langridge, R.' 26 6 'Hirono, S.' 27 6 'Akagawa, H.' 28 6 'Mitsui, Y.' 29 6 'Iitaka, Y.' 30 7 'Satow, Y.' 31 7 'Watanabe, Y.' 32 7 'Mitsui, Y.' 33 8 'Hirono, S.' 34 8 'Nakamura, K.T.' 35 8 'Iitaka, Y.' 36 8 'Mitsui, Y.' 37 9 'Mitsui, Y.' 38 9 'Satow, Y.' 39 9 'Watanabe, Y.' 40 9 'Iitaka, Y.' 41 10 'Mitsui, Y.' 42 10 'Satow, Y.' 43 10 'Watanabe, Y.' 44 10 'Hirono, S.' 45 10 'Iitaka, Y.' 46 11 'Satow, Y.' 47 11 'Mitsui, Y.' 48 11 'Iitaka, Y.' 49 12 'Mitsui, Y.' 50 12 'Satow, Y.' 51 12 'Sakamaki, T.' 52 12 'Iitaka, Y.' 53 13 'Satow, Y.' 54 13 'Mitsui, Y.' 55 13 'Iitaka, Y.' 56 13 'Murao, S.' 57 13 'Sato, S.' 58 # loop_ _citation_editor.citation_id _citation_editor.name _citation_editor.ordinal 5 'Hiromi, K.' 1 5 'Akasaka, K.' 2 5 'Mitsui, Y.' 3 5 'Tonomura, B.' 4 5 'Murao, S.' 5 # _cell.entry_id 3SSI _cell.length_a 40.740 _cell.length_b 40.740 _cell.length_c 115.280 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3SSI _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'STREPTOMYCES SUBTILISIN INHIBITOR' 11494.929 1 ? ? ? ? 2 water nat water 18.015 31 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name SSI # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DAPSALYAPSALVLTVGKGVSATTAAPERAVTLTCAPGPSGTHPAAGSACADLAAVGGDLNALTRGEDVMCPMVYDPVLL TVDGVWQGKRVSYERVFSNECEMNAHGSSVFAF ; _entity_poly.pdbx_seq_one_letter_code_can ;DAPSALYAPSALVLTVGKGVSATTAAPERAVTLTCAPGPSGTHPAAGSACADLAAVGGDLNALTRGEDVMCPMVYDPVLL TVDGVWQGKRVSYERVFSNECEMNAHGSSVFAF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 PRO n 1 4 SER n 1 5 ALA n 1 6 LEU n 1 7 TYR n 1 8 ALA n 1 9 PRO n 1 10 SER n 1 11 ALA n 1 12 LEU n 1 13 VAL n 1 14 LEU n 1 15 THR n 1 16 VAL n 1 17 GLY n 1 18 LYS n 1 19 GLY n 1 20 VAL n 1 21 SER n 1 22 ALA n 1 23 THR n 1 24 THR n 1 25 ALA n 1 26 ALA n 1 27 PRO n 1 28 GLU n 1 29 ARG n 1 30 ALA n 1 31 VAL n 1 32 THR n 1 33 LEU n 1 34 THR n 1 35 CYS n 1 36 ALA n 1 37 PRO n 1 38 GLY n 1 39 PRO n 1 40 SER n 1 41 GLY n 1 42 THR n 1 43 HIS n 1 44 PRO n 1 45 ALA n 1 46 ALA n 1 47 GLY n 1 48 SER n 1 49 ALA n 1 50 CYS n 1 51 ALA n 1 52 ASP n 1 53 LEU n 1 54 ALA n 1 55 ALA n 1 56 VAL n 1 57 GLY n 1 58 GLY n 1 59 ASP n 1 60 LEU n 1 61 ASN n 1 62 ALA n 1 63 LEU n 1 64 THR n 1 65 ARG n 1 66 GLY n 1 67 GLU n 1 68 ASP n 1 69 VAL n 1 70 MET n 1 71 CYS n 1 72 PRO n 1 73 MET n 1 74 VAL n 1 75 TYR n 1 76 ASP n 1 77 PRO n 1 78 VAL n 1 79 LEU n 1 80 LEU n 1 81 THR n 1 82 VAL n 1 83 ASP n 1 84 GLY n 1 85 VAL n 1 86 TRP n 1 87 GLN n 1 88 GLY n 1 89 LYS n 1 90 ARG n 1 91 VAL n 1 92 SER n 1 93 TYR n 1 94 GLU n 1 95 ARG n 1 96 VAL n 1 97 PHE n 1 98 SER n 1 99 ASN n 1 100 GLU n 1 101 CYS n 1 102 GLU n 1 103 MET n 1 104 ASN n 1 105 ALA n 1 106 HIS n 1 107 GLY n 1 108 SER n 1 109 SER n 1 110 VAL n 1 111 PHE n 1 112 ALA n 1 113 PHE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Streptomyces albogriseolus' _entity_src_nat.pdbx_ncbi_taxonomy_id 1887 _entity_src_nat.genus Streptomyces _entity_src_nat.species ? _entity_src_nat.strain S-3253 _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SSI_STRAO _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01006 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MRNTGAGPSPSVSRPPPSAAPLSGAALAAPGDAPSALYAPSALVLTVGKGVSATTAAPERAVTLTCAPGPSGTHPAAGSA CADLAAVGGDLNALTRGEDVMCPMVYDPVLLTVDGVWQGKRVSYERVFSNECEMNAHGSSVFAF ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3SSI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01006 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 144 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 113 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3SSI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_percent_sol 49. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.0' # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type RIGAKU _diffrn_detector.pdbx_collection_date 1993-02-26 _diffrn_detector.details 'SUPPER DOUBLE FOCUSING' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3SSI _reflns.observed_criterion_sigma_I 1. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 38.3 _reflns.d_resolution_high 2.03 _reflns.number_obs 4866 _reflns.number_all ? _reflns.percent_possible_obs 63.7 _reflns.pdbx_Rmerge_I_obs 0.048 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.6 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.34 _reflns_shell.percent_possible_all 48.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3SSI _refine.ls_number_reflns_obs 3756 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.0 _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs 75.1 _refine.ls_R_factor_obs 0.185 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.185 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 31.8 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3SSI _refine_analyze.Luzzati_coordinate_error_obs 0.15 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 722 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 31 _refine_hist.number_atoms_total 753 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 6.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.595 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 27.51 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.423 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 3SSI _struct.title 'PROTEINASE INHIBITOR SSI (STREPTOMYCES SUBTILISIN, INHIBITOR) FROM STREPTOMYCES ALBOGRISEOLUS' _struct.pdbx_descriptor 'STREPTOMYCES SUBTILISIN INHIBITOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3SSI _struct_keywords.pdbx_keywords 'SERINE PROTEASE INHIBITOR' _struct_keywords.text 'SSI, SERINE PROTEASE INHIBITOR, SUBTILISIN BPN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A1 ALA A 45 ? VAL A 56 ? ALA A 45 VAL A 56 1 ? 12 HELX_P HELX_P2 A2 ASN A 99 ? ASN A 104 ? ASN A 99 ASN A 104 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 35 A CYS 50 1_555 ? ? ? ? ? ? ? 2.031 ? disulf2 disulf ? ? A CYS 71 SG ? ? ? 1_555 A CYS 101 SG ? ? A CYS 71 A CYS 101 1_555 ? ? ? ? ? ? ? 2.021 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 36 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 36 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 37 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 37 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.06 # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 ARG A 29 ? CYS A 35 ? ARG A 29 CYS A 35 S1 2 SER A 10 ? GLY A 19 ? SER A 10 GLY A 19 S1 3 PRO A 77 ? TRP A 86 ? PRO A 77 TRP A 86 S1 4 LYS A 89 ? PHE A 97 ? LYS A 89 PHE A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O LEU A 33 ? O LEU A 33 N LEU A 12 ? N LEU A 12 S1 2 3 O GLY A 17 ? O GLY A 17 N LEU A 79 ? N LEU A 79 S1 3 4 O TRP A 86 ? O TRP A 86 N LYS A 89 ? N LYS A 89 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details PCR Unknown ? ? ? ? 9 ;THE PRIMARY CONTACT REGION (PCR) CONSISTS OF P7-P2' RESIDUES WHICH INVOLVE THE SCISSILE BOND (OR THE REACTIVE SITE PEPTIDE BOND) AND MAKE CONTACTS WITH THE TARGET ENZYMES. ; SCR Unknown ? ? ? ? 5 ;THE SECONDARY CONTACT REGION (SCR) IS LOCATED CLOSE TO THE PRIMARY CONTACT REGION. THE MAIN ROLE OF THE SCR IS PERHAPS TO STABILIZE THE PRIMARY CONTACT REGION FROM INSIDE OF THE INHIBITOR MOLECULE RATHER THAN TO MAKE INTERACTIONS WITH THE TARGET ENZYMES. ; # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 PCR 9 GLU A 67 ? GLU A 67 . ? 1_555 ? 2 PCR 9 ASP A 68 ? ASP A 68 . ? 1_555 ? 3 PCR 9 VAL A 69 ? VAL A 69 . ? 1_555 ? 4 PCR 9 MET A 70 ? MET A 70 . ? 1_555 ? 5 PCR 9 CYS A 71 ? CYS A 71 . ? 1_555 ? 6 PCR 9 PRO A 72 ? PRO A 72 . ? 1_555 ? 7 PCR 9 MET A 73 ? MET A 73 . ? 1_555 ? 8 PCR 9 VAL A 74 ? VAL A 74 . ? 1_555 ? 9 PCR 9 TYR A 75 ? TYR A 75 . ? 1_555 ? 10 SCR 5 SER A 98 ? SER A 98 . ? 1_555 ? 11 SCR 5 ASN A 99 ? ASN A 99 . ? 1_555 ? 12 SCR 5 GLU A 100 ? GLU A 100 . ? 1_555 ? 13 SCR 5 CYS A 101 ? CYS A 101 . ? 1_555 ? 14 SCR 5 GLU A 102 ? GLU A 102 . ? 1_555 ? # _database_PDB_matrix.entry_id 3SSI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3SSI _atom_sites.fract_transf_matrix[1][1] 0.024546 _atom_sites.fract_transf_matrix[1][2] 0.014172 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028343 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008675 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 PHE 113 113 113 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 114 1 HOH HOH A . B 2 HOH 2 115 2 HOH HOH A . B 2 HOH 3 116 3 HOH HOH A . B 2 HOH 4 117 4 HOH HOH A . B 2 HOH 5 118 5 HOH HOH A . B 2 HOH 6 119 6 HOH HOH A . B 2 HOH 7 120 7 HOH HOH A . B 2 HOH 8 121 8 HOH HOH A . B 2 HOH 9 122 9 HOH HOH A . B 2 HOH 10 123 10 HOH HOH A . B 2 HOH 11 124 11 HOH HOH A . B 2 HOH 12 125 12 HOH HOH A . B 2 HOH 13 126 13 HOH HOH A . B 2 HOH 14 127 14 HOH HOH A . B 2 HOH 15 128 15 HOH HOH A . B 2 HOH 16 129 16 HOH HOH A . B 2 HOH 17 130 17 HOH HOH A . B 2 HOH 18 131 18 HOH HOH A . B 2 HOH 19 132 19 HOH HOH A . B 2 HOH 20 133 20 HOH HOH A . B 2 HOH 21 134 21 HOH HOH A . B 2 HOH 22 135 22 HOH HOH A . B 2 HOH 23 136 23 HOH HOH A . B 2 HOH 24 137 24 HOH HOH A . B 2 HOH 25 138 25 HOH HOH A . B 2 HOH 26 139 26 HOH HOH A . B 2 HOH 27 140 27 HOH HOH A . B 2 HOH 28 141 28 HOH HOH A . B 2 HOH 29 142 29 HOH HOH A . B 2 HOH 30 143 30 HOH HOH A . B 2 HOH 31 144 31 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 115.2800000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-08-17 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PROCESS 'data collection' . ? 1 PROCESS 'data reduction' . ? 2 X-PLOR 'model building' 3.1 ? 3 X-PLOR refinement 3.1 ? 4 PROCESS 'data scaling' . ? 5 X-PLOR phasing 3.1 ? 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 1 ? A ASP 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A ALA 5 ? A ALA 5 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #