data_3SYY # _entry.id 3SYY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3SYY RCSB RCSB066826 WWPDB D_1000066826 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3SZ4 . unspecified PDB 3SZ5 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3SYY _pdbx_database_status.recvd_initial_deposition_date 2011-07-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yang, W.' 1 'Chen, W.Y.' 2 'Wang, H.' 3 'Zhang, Q.' 4 'Zhou, W.' 5 'Bartlam, M.' 6 'Watt, R.M.' 7 'Rao, Z.' 8 # _citation.id primary _citation.title 'Structural and functional insight into the mechanism of an alkaline exonuclease from Laribacter hongkongensis.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 39 _citation.page_first 9803 _citation.page_last 9819 _citation.year 2011 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21893587 _citation.pdbx_database_id_DOI 10.1093/nar/gkr660 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yang, W.' 1 primary 'Chen, W.Y.' 2 primary 'Wang, H.' 3 primary 'Ho, J.W.' 4 primary 'Huang, J.D.' 5 primary 'Woo, P.C.' 6 primary 'Lau, S.K.' 7 primary 'Yuen, K.Y.' 8 primary 'Zhang, Q.' 9 primary 'Zhou, W.' 10 primary 'Bartlam, M.' 11 primary 'Watt, R.M.' 12 primary 'Rao, Z.' 13 # _cell.entry_id 3SYY _cell.length_a 108.939 _cell.length_b 108.939 _cell.length_c 47.647 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3SYY _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Exonuclease 24476.742 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 water nat water 18.015 176 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'alkaline exonuclease, LHK-Exo' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEQRTEEWFAARLGKVTASRVADVMTKTKSGYAASRQNYMAELICQRLTGTQEIRFSNAAMQRGTELEPHARARYIIETG EIVTEVGLIDHPTIAGFGASPDGLVGDTGLIEIKCPNTWTHIETIKTGKPKPEYIKQMQTQMACTGRQWCDFVSYDDRLP DDMQYFCTRIERDDALIAEIETEVSAFLAELEAEIEYLKRKAAKLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEQRTEEWFAARLGKVTASRVADVMTKTKSGYAASRQNYMAELICQRLTGTQEIRFSNAAMQRGTELEPHARARYIIETG EIVTEVGLIDHPTIAGFGASPDGLVGDTGLIEIKCPNTWTHIETIKTGKPKPEYIKQMQTQMACTGRQWCDFVSYDDRLP DDMQYFCTRIERDDALIAEIETEVSAFLAELEAEIEYLKRKAAKLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLN n 1 4 ARG n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 TRP n 1 9 PHE n 1 10 ALA n 1 11 ALA n 1 12 ARG n 1 13 LEU n 1 14 GLY n 1 15 LYS n 1 16 VAL n 1 17 THR n 1 18 ALA n 1 19 SER n 1 20 ARG n 1 21 VAL n 1 22 ALA n 1 23 ASP n 1 24 VAL n 1 25 MET n 1 26 THR n 1 27 LYS n 1 28 THR n 1 29 LYS n 1 30 SER n 1 31 GLY n 1 32 TYR n 1 33 ALA n 1 34 ALA n 1 35 SER n 1 36 ARG n 1 37 GLN n 1 38 ASN n 1 39 TYR n 1 40 MET n 1 41 ALA n 1 42 GLU n 1 43 LEU n 1 44 ILE n 1 45 CYS n 1 46 GLN n 1 47 ARG n 1 48 LEU n 1 49 THR n 1 50 GLY n 1 51 THR n 1 52 GLN n 1 53 GLU n 1 54 ILE n 1 55 ARG n 1 56 PHE n 1 57 SER n 1 58 ASN n 1 59 ALA n 1 60 ALA n 1 61 MET n 1 62 GLN n 1 63 ARG n 1 64 GLY n 1 65 THR n 1 66 GLU n 1 67 LEU n 1 68 GLU n 1 69 PRO n 1 70 HIS n 1 71 ALA n 1 72 ARG n 1 73 ALA n 1 74 ARG n 1 75 TYR n 1 76 ILE n 1 77 ILE n 1 78 GLU n 1 79 THR n 1 80 GLY n 1 81 GLU n 1 82 ILE n 1 83 VAL n 1 84 THR n 1 85 GLU n 1 86 VAL n 1 87 GLY n 1 88 LEU n 1 89 ILE n 1 90 ASP n 1 91 HIS n 1 92 PRO n 1 93 THR n 1 94 ILE n 1 95 ALA n 1 96 GLY n 1 97 PHE n 1 98 GLY n 1 99 ALA n 1 100 SER n 1 101 PRO n 1 102 ASP n 1 103 GLY n 1 104 LEU n 1 105 VAL n 1 106 GLY n 1 107 ASP n 1 108 THR n 1 109 GLY n 1 110 LEU n 1 111 ILE n 1 112 GLU n 1 113 ILE n 1 114 LYS n 1 115 CYS n 1 116 PRO n 1 117 ASN n 1 118 THR n 1 119 TRP n 1 120 THR n 1 121 HIS n 1 122 ILE n 1 123 GLU n 1 124 THR n 1 125 ILE n 1 126 LYS n 1 127 THR n 1 128 GLY n 1 129 LYS n 1 130 PRO n 1 131 LYS n 1 132 PRO n 1 133 GLU n 1 134 TYR n 1 135 ILE n 1 136 LYS n 1 137 GLN n 1 138 MET n 1 139 GLN n 1 140 THR n 1 141 GLN n 1 142 MET n 1 143 ALA n 1 144 CYS n 1 145 THR n 1 146 GLY n 1 147 ARG n 1 148 GLN n 1 149 TRP n 1 150 CYS n 1 151 ASP n 1 152 PHE n 1 153 VAL n 1 154 SER n 1 155 TYR n 1 156 ASP n 1 157 ASP n 1 158 ARG n 1 159 LEU n 1 160 PRO n 1 161 ASP n 1 162 ASP n 1 163 MET n 1 164 GLN n 1 165 TYR n 1 166 PHE n 1 167 CYS n 1 168 THR n 1 169 ARG n 1 170 ILE n 1 171 GLU n 1 172 ARG n 1 173 ASP n 1 174 ASP n 1 175 ALA n 1 176 LEU n 1 177 ILE n 1 178 ALA n 1 179 GLU n 1 180 ILE n 1 181 GLU n 1 182 THR n 1 183 GLU n 1 184 VAL n 1 185 SER n 1 186 ALA n 1 187 PHE n 1 188 LEU n 1 189 ALA n 1 190 GLU n 1 191 LEU n 1 192 GLU n 1 193 ALA n 1 194 GLU n 1 195 ILE n 1 196 GLU n 1 197 TYR n 1 198 LEU n 1 199 LYS n 1 200 ARG n 1 201 LYS n 1 202 ALA n 1 203 ALA n 1 204 LYS n 1 205 LEU n 1 206 ALA n 1 207 ALA n 1 208 ALA n 1 209 LEU n 1 210 GLU n 1 211 HIS n 1 212 HIS n 1 213 HIS n 1 214 HIS n 1 215 HIS n 1 216 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LHK_01497 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain HLHK9 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Laribacter hongkongensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 557598 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C1D7P6_LARHH _struct_ref.pdbx_db_accession C1D7P6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEQRTEEWFAARLGKVTASRVADVMTKTKSGYAASRQNYMAELICQRLTGTQEIRFSNAAMQRGTELEPHARARYIIETG EIVTEVGLIDHPTIAGFGASPDGLVGDTGLIEIKCPNTWTHIETIKTGKPKPEYIKQMQTQMACTGRQWCDFVSYDDRLP DDMQYFCTRIERDDALIAEIETEVSAFLAELEAEIEYLKRKAA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3SYY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 203 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C1D7P6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 203 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 203 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3SYY LYS A 204 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 204 1 1 3SYY LEU A 205 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 205 2 1 3SYY ALA A 206 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 206 3 1 3SYY ALA A 207 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 207 4 1 3SYY ALA A 208 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 208 5 1 3SYY LEU A 209 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 209 6 1 3SYY GLU A 210 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 210 7 1 3SYY HIS A 211 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 211 8 1 3SYY HIS A 212 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 212 9 1 3SYY HIS A 213 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 213 10 1 3SYY HIS A 214 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 214 11 1 3SYY HIS A 215 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 215 12 1 3SYY HIS A 216 ? UNP C1D7P6 ? ? 'EXPRESSION TAG' 216 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3SYY _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.33 _exptl_crystal.density_percent_sol 63.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.4 _exptl_crystal_grow.pdbx_details '0.1M Tris pH 8.4, 1.0M potassium sodium tartrate tetrahydrate, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2008-04-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0000 # _reflns.entry_id 3SYY _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.9 _reflns.number_obs 47456 _reflns.number_all 49906 _reflns.percent_possible_obs 95.1 _reflns.pdbx_Rmerge_I_obs 0.084 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 32.6 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.97 _reflns_shell.percent_possible_all 70.6 _reflns_shell.Rmerge_I_obs 0.581 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy 5.3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 4942 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3SYY _refine.ls_number_reflns_obs 23585 _refine.ls_number_reflns_all 24394 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 1.90 _refine.ls_percent_reflns_obs 96.68 _refine.ls_R_factor_obs 0.20632 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20436 _refine.ls_R_factor_R_free 0.24096 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1268 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.935 _refine.B_iso_mean 37.620 _refine.aniso_B[1][1] -1.21 _refine.aniso_B[2][2] -1.21 _refine.aniso_B[3][3] 1.81 _refine.aniso_B[1][2] -0.60 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 1AVQ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.126 _refine.overall_SU_ML 0.093 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 3.156 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1523 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 176 _refine_hist.number_atoms_total 1701 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.019 0.022 ? 1547 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.629 1.959 ? 2090 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 5.550 5.000 ? 191 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 33.995 24.306 ? 72 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 17.523 15.000 ? 277 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 16.524 15.000 ? 12 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.120 0.200 ? 237 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.008 0.021 ? 1155 ? 'X-RAY DIFFRACTION' r_mcbond_it 1.091 1.500 ? 962 ? 'X-RAY DIFFRACTION' r_mcangle_it 1.905 2.000 ? 1548 ? 'X-RAY DIFFRACTION' r_scbond_it 3.105 3.000 ? 585 ? 'X-RAY DIFFRACTION' r_scangle_it 4.817 4.500 ? 542 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.899 _refine_ls_shell.d_res_low 1.949 _refine_ls_shell.number_reflns_R_work 1361 _refine_ls_shell.R_factor_R_work 0.271 _refine_ls_shell.percent_reflns_obs 75.94 _refine_ls_shell.R_factor_R_free 0.367 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 75 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 3SYY _struct.title 'Crystal Structure of an alkaline exonuclease (LHK-Exo) from Laribacter hongkongensis' _struct.pdbx_descriptor Exonuclease _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3SYY _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'alkaline exonuclease, digest double stranded DNA, strict 5-3-polarity, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 6 ? LEU A 13 ? GLU A 6 LEU A 13 1 ? 8 HELX_P HELX_P2 2 ARG A 20 ? THR A 26 ? ARG A 20 THR A 26 1 ? 7 HELX_P HELX_P3 3 ALA A 33 ? GLY A 50 ? ALA A 33 GLY A 50 1 ? 18 HELX_P HELX_P4 4 ASN A 58 ? GLY A 80 ? ASN A 58 GLY A 80 1 ? 23 HELX_P HELX_P5 5 ASN A 117 ? GLY A 128 ? ASN A 117 GLY A 128 1 ? 12 HELX_P HELX_P6 6 LYS A 131 ? GLY A 146 ? LYS A 131 GLY A 146 1 ? 16 HELX_P HELX_P7 7 PRO A 160 ? MET A 163 ? PRO A 160 MET A 163 5 ? 4 HELX_P HELX_P8 8 ASP A 173 ? ALA A 206 ? ASP A 173 ALA A 206 1 ? 34 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 400 A HOH 384 1_555 ? ? ? ? ? ? ? 2.266 ? metalc2 metalc ? ? A GLU 112 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 112 A MG 400 1_555 ? ? ? ? ? ? ? 2.311 ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 400 A HOH 383 1_555 ? ? ? ? ? ? ? 2.347 ? metalc4 metalc ? ? A ASP 102 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 102 A MG 400 1_555 ? ? ? ? ? ? ? 2.401 ? metalc5 metalc ? ? A ILE 113 O ? ? ? 1_555 B MG . MG ? ? A ILE 113 A MG 400 1_555 ? ? ? ? ? ? ? 2.428 ? metalc6 metalc ? ? A SER 100 O ? ? ? 1_555 C MG . MG ? ? A SER 100 A MG 401 1_555 ? ? ? ? ? ? ? 2.706 ? metalc7 metalc ? ? A GLU 112 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 112 A MG 401 1_555 ? ? ? ? ? ? ? 2.731 ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 401 A HOH 387 1_555 ? ? ? ? ? ? ? 2.741 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 16 ? THR A 17 ? VAL A 16 THR A 17 A 2 PHE A 97 ? ALA A 99 ? PHE A 97 ALA A 99 A 3 ILE A 89 ? ASP A 90 ? ILE A 89 ASP A 90 B 1 VAL A 83 ? THR A 84 ? VAL A 83 THR A 84 B 2 GLY A 103 ? VAL A 105 ? GLY A 103 VAL A 105 B 3 GLY A 109 ? LYS A 114 ? GLY A 109 LYS A 114 B 4 TRP A 149 ? TYR A 155 ? TRP A 149 TYR A 155 B 5 TYR A 165 ? GLU A 171 ? TYR A 165 GLU A 171 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 16 ? N VAL A 16 O GLY A 98 ? O GLY A 98 A 2 3 O ALA A 99 ? O ALA A 99 N ILE A 89 ? N ILE A 89 B 1 2 N THR A 84 ? N THR A 84 O LEU A 104 ? O LEU A 104 B 2 3 N VAL A 105 ? N VAL A 105 O GLY A 109 ? O GLY A 109 B 3 4 N LYS A 114 ? N LYS A 114 O VAL A 153 ? O VAL A 153 B 4 5 N PHE A 152 ? N PHE A 152 O THR A 168 ? O THR A 168 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 400' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 102 ? ASP A 102 . ? 1_555 ? 2 AC1 5 GLU A 112 ? GLU A 112 . ? 1_555 ? 3 AC1 5 ILE A 113 ? ILE A 113 . ? 1_555 ? 4 AC1 5 HOH D . ? HOH A 383 . ? 1_555 ? 5 AC1 5 HOH D . ? HOH A 384 . ? 1_555 ? 6 AC2 5 SER A 100 ? SER A 100 . ? 1_555 ? 7 AC2 5 ASP A 102 ? ASP A 102 . ? 1_555 ? 8 AC2 5 GLU A 112 ? GLU A 112 . ? 1_555 ? 9 AC2 5 GLN A 137 ? GLN A 137 . ? 1_555 ? 10 AC2 5 HOH D . ? HOH A 387 . ? 1_555 ? # _database_PDB_matrix.entry_id 3SYY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3SYY _atom_sites.fract_transf_matrix[1][1] 0.009179 _atom_sites.fract_transf_matrix[1][2] 0.005300 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010600 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020988 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 THR 28 28 ? ? ? A . n A 1 29 LYS 29 29 ? ? ? A . n A 1 30 SER 30 30 ? ? ? A . n A 1 31 GLY 31 31 ? ? ? A . n A 1 32 TYR 32 32 ? ? ? A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ARG 55 55 ? ? ? A . n A 1 56 PHE 56 56 ? ? ? A . n A 1 57 SER 57 57 ? ? ? A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 TRP 119 119 119 TRP TRP A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 TRP 149 149 149 TRP TRP A . n A 1 150 CYS 150 150 150 CYS CYS A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 CYS 167 167 167 CYS CYS A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 ILE 195 195 195 ILE ILE A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 TYR 197 197 197 TYR TYR A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 ALA 207 207 ? ? ? A . n A 1 208 ALA 208 208 ? ? ? A . n A 1 209 LEU 209 209 ? ? ? A . n A 1 210 GLU 210 210 ? ? ? A . n A 1 211 HIS 211 211 ? ? ? A . n A 1 212 HIS 212 212 ? ? ? A . n A 1 213 HIS 213 213 ? ? ? A . n A 1 214 HIS 214 214 ? ? ? A . n A 1 215 HIS 215 215 ? ? ? A . n A 1 216 HIS 216 216 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3620 ? 1 MORE -86 ? 1 'SSA (A^2)' 29540 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_565 -y,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 -54.4695000000 0.8660254038 -0.5000000000 0.0000000000 94.3439414629 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_455 -x+y-1,-x,z -0.5000000000 0.8660254038 0.0000000000 -108.9390000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? D HOH . ? A HOH 384 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 OE2 ? A GLU 112 ? A GLU 112 ? 1_555 135.0 ? 2 O ? D HOH . ? A HOH 384 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 O ? D HOH . ? A HOH 383 ? 1_555 96.3 ? 3 OE2 ? A GLU 112 ? A GLU 112 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 O ? D HOH . ? A HOH 383 ? 1_555 88.8 ? 4 O ? D HOH . ? A HOH 384 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 OD2 ? A ASP 102 ? A ASP 102 ? 1_555 83.1 ? 5 OE2 ? A GLU 112 ? A GLU 112 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 OD2 ? A ASP 102 ? A ASP 102 ? 1_555 89.1 ? 6 O ? D HOH . ? A HOH 383 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 OD2 ? A ASP 102 ? A ASP 102 ? 1_555 176.3 ? 7 O ? D HOH . ? A HOH 384 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 O ? A ILE 113 ? A ILE 113 ? 1_555 128.1 ? 8 OE2 ? A GLU 112 ? A GLU 112 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 O ? A ILE 113 ? A ILE 113 ? 1_555 95.6 ? 9 O ? D HOH . ? A HOH 383 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 O ? A ILE 113 ? A ILE 113 ? 1_555 95.2 ? 10 OD2 ? A ASP 102 ? A ASP 102 ? 1_555 MG ? B MG . ? A MG 400 ? 1_555 O ? A ILE 113 ? A ILE 113 ? 1_555 88.0 ? 11 O ? A SER 100 ? A SER 100 ? 1_555 MG ? C MG . ? A MG 401 ? 1_555 OE1 ? A GLU 112 ? A GLU 112 ? 1_555 107.8 ? 12 O ? A SER 100 ? A SER 100 ? 1_555 MG ? C MG . ? A MG 401 ? 1_555 O ? D HOH . ? A HOH 387 ? 1_555 112.3 ? 13 OE1 ? A GLU 112 ? A GLU 112 ? 1_555 MG ? C MG . ? A MG 401 ? 1_555 O ? D HOH . ? A HOH 387 ? 1_555 132.9 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-02-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 PHASER phasing . ? 2 REFMAC refinement 5.5.0044 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NZ _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 LYS _pdbx_validate_symm_contact.auth_seq_id_1 201 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 349 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_554 _pdbx_validate_symm_contact.dist 2.09 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A THR 28 ? A THR 28 6 1 Y 1 A LYS 29 ? A LYS 29 7 1 Y 1 A SER 30 ? A SER 30 8 1 Y 1 A GLY 31 ? A GLY 31 9 1 Y 1 A TYR 32 ? A TYR 32 10 1 Y 1 A ARG 55 ? A ARG 55 11 1 Y 1 A PHE 56 ? A PHE 56 12 1 Y 1 A SER 57 ? A SER 57 13 1 Y 1 A ALA 207 ? A ALA 207 14 1 Y 1 A ALA 208 ? A ALA 208 15 1 Y 1 A LEU 209 ? A LEU 209 16 1 Y 1 A GLU 210 ? A GLU 210 17 1 Y 1 A HIS 211 ? A HIS 211 18 1 Y 1 A HIS 212 ? A HIS 212 19 1 Y 1 A HIS 213 ? A HIS 213 20 1 Y 1 A HIS 214 ? A HIS 214 21 1 Y 1 A HIS 215 ? A HIS 215 22 1 Y 1 A HIS 216 ? A HIS 216 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 400 400 MG MG A . C 2 MG 1 401 401 MG MG A . D 3 HOH 1 217 217 HOH HOH A . D 3 HOH 2 218 218 HOH HOH A . D 3 HOH 3 219 219 HOH HOH A . D 3 HOH 4 220 220 HOH HOH A . D 3 HOH 5 221 221 HOH HOH A . D 3 HOH 6 222 222 HOH HOH A . D 3 HOH 7 223 223 HOH HOH A . D 3 HOH 8 224 210 HOH HOH A . D 3 HOH 9 225 225 HOH HOH A . D 3 HOH 10 226 226 HOH HOH A . D 3 HOH 11 227 227 HOH HOH A . D 3 HOH 12 228 228 HOH HOH A . D 3 HOH 13 229 229 HOH HOH A . D 3 HOH 14 230 230 HOH HOH A . D 3 HOH 15 231 231 HOH HOH A . D 3 HOH 16 232 232 HOH HOH A . D 3 HOH 17 233 233 HOH HOH A . D 3 HOH 18 234 234 HOH HOH A . D 3 HOH 19 235 235 HOH HOH A . D 3 HOH 20 236 236 HOH HOH A . D 3 HOH 21 237 237 HOH HOH A . D 3 HOH 22 238 238 HOH HOH A . D 3 HOH 23 239 239 HOH HOH A . D 3 HOH 24 240 240 HOH HOH A . D 3 HOH 25 241 241 HOH HOH A . D 3 HOH 26 242 242 HOH HOH A . D 3 HOH 27 243 243 HOH HOH A . D 3 HOH 28 244 244 HOH HOH A . D 3 HOH 29 245 245 HOH HOH A . D 3 HOH 30 246 246 HOH HOH A . D 3 HOH 31 247 247 HOH HOH A . D 3 HOH 32 248 248 HOH HOH A . D 3 HOH 33 249 249 HOH HOH A . D 3 HOH 34 250 250 HOH HOH A . D 3 HOH 35 251 251 HOH HOH A . D 3 HOH 36 252 252 HOH HOH A . D 3 HOH 37 253 253 HOH HOH A . D 3 HOH 38 254 254 HOH HOH A . D 3 HOH 39 255 255 HOH HOH A . D 3 HOH 40 256 256 HOH HOH A . D 3 HOH 41 257 257 HOH HOH A . D 3 HOH 42 258 258 HOH HOH A . D 3 HOH 43 259 259 HOH HOH A . D 3 HOH 44 260 260 HOH HOH A . D 3 HOH 45 261 261 HOH HOH A . D 3 HOH 46 262 262 HOH HOH A . D 3 HOH 47 263 263 HOH HOH A . D 3 HOH 48 264 264 HOH HOH A . D 3 HOH 49 265 265 HOH HOH A . D 3 HOH 50 266 266 HOH HOH A . D 3 HOH 51 267 267 HOH HOH A . D 3 HOH 52 268 268 HOH HOH A . D 3 HOH 53 269 269 HOH HOH A . D 3 HOH 54 270 270 HOH HOH A . D 3 HOH 55 271 271 HOH HOH A . D 3 HOH 56 272 272 HOH HOH A . D 3 HOH 57 273 273 HOH HOH A . D 3 HOH 58 274 274 HOH HOH A . D 3 HOH 59 275 211 HOH HOH A . D 3 HOH 60 276 276 HOH HOH A . D 3 HOH 61 277 277 HOH HOH A . D 3 HOH 62 278 278 HOH HOH A . D 3 HOH 63 279 279 HOH HOH A . D 3 HOH 64 280 280 HOH HOH A . D 3 HOH 65 281 281 HOH HOH A . D 3 HOH 66 282 282 HOH HOH A . D 3 HOH 67 283 283 HOH HOH A . D 3 HOH 68 284 284 HOH HOH A . D 3 HOH 69 285 285 HOH HOH A . D 3 HOH 70 286 286 HOH HOH A . D 3 HOH 71 287 287 HOH HOH A . D 3 HOH 72 288 288 HOH HOH A . D 3 HOH 73 289 289 HOH HOH A . D 3 HOH 74 290 290 HOH HOH A . D 3 HOH 75 291 291 HOH HOH A . D 3 HOH 76 292 292 HOH HOH A . D 3 HOH 77 293 293 HOH HOH A . D 3 HOH 78 294 294 HOH HOH A . D 3 HOH 79 295 295 HOH HOH A . D 3 HOH 80 296 296 HOH HOH A . D 3 HOH 81 297 297 HOH HOH A . D 3 HOH 82 298 298 HOH HOH A . D 3 HOH 83 299 299 HOH HOH A . D 3 HOH 84 300 300 HOH HOH A . D 3 HOH 85 301 301 HOH HOH A . D 3 HOH 86 302 302 HOH HOH A . D 3 HOH 87 303 303 HOH HOH A . D 3 HOH 88 304 304 HOH HOH A . D 3 HOH 89 305 305 HOH HOH A . D 3 HOH 90 306 306 HOH HOH A . D 3 HOH 91 307 307 HOH HOH A . D 3 HOH 92 308 308 HOH HOH A . D 3 HOH 93 309 309 HOH HOH A . D 3 HOH 94 310 310 HOH HOH A . D 3 HOH 95 311 311 HOH HOH A . D 3 HOH 96 312 312 HOH HOH A . D 3 HOH 97 313 313 HOH HOH A . D 3 HOH 98 314 314 HOH HOH A . D 3 HOH 99 315 315 HOH HOH A . D 3 HOH 100 316 316 HOH HOH A . D 3 HOH 101 317 317 HOH HOH A . D 3 HOH 102 318 318 HOH HOH A . D 3 HOH 103 319 319 HOH HOH A . D 3 HOH 104 320 320 HOH HOH A . D 3 HOH 105 321 321 HOH HOH A . D 3 HOH 106 322 322 HOH HOH A . D 3 HOH 107 323 323 HOH HOH A . D 3 HOH 108 324 324 HOH HOH A . D 3 HOH 109 325 325 HOH HOH A . D 3 HOH 110 326 326 HOH HOH A . D 3 HOH 111 327 327 HOH HOH A . D 3 HOH 112 328 328 HOH HOH A . D 3 HOH 113 329 329 HOH HOH A . D 3 HOH 114 330 330 HOH HOH A . D 3 HOH 115 331 331 HOH HOH A . D 3 HOH 116 332 332 HOH HOH A . D 3 HOH 117 333 333 HOH HOH A . D 3 HOH 118 334 334 HOH HOH A . D 3 HOH 119 335 335 HOH HOH A . D 3 HOH 120 336 336 HOH HOH A . D 3 HOH 121 337 337 HOH HOH A . D 3 HOH 122 338 338 HOH HOH A . D 3 HOH 123 339 339 HOH HOH A . D 3 HOH 124 340 340 HOH HOH A . D 3 HOH 125 341 341 HOH HOH A . D 3 HOH 126 342 212 HOH HOH A . D 3 HOH 127 343 343 HOH HOH A . D 3 HOH 128 344 344 HOH HOH A . D 3 HOH 129 345 345 HOH HOH A . D 3 HOH 130 346 346 HOH HOH A . D 3 HOH 131 347 347 HOH HOH A . D 3 HOH 132 348 348 HOH HOH A . D 3 HOH 133 349 349 HOH HOH A . D 3 HOH 134 350 350 HOH HOH A . D 3 HOH 135 351 351 HOH HOH A . D 3 HOH 136 352 352 HOH HOH A . D 3 HOH 137 353 353 HOH HOH A . D 3 HOH 138 354 354 HOH HOH A . D 3 HOH 139 355 355 HOH HOH A . D 3 HOH 140 356 356 HOH HOH A . D 3 HOH 141 357 357 HOH HOH A . D 3 HOH 142 358 358 HOH HOH A . D 3 HOH 143 359 359 HOH HOH A . D 3 HOH 144 360 360 HOH HOH A . D 3 HOH 145 361 361 HOH HOH A . D 3 HOH 146 362 362 HOH HOH A . D 3 HOH 147 363 363 HOH HOH A . D 3 HOH 148 364 364 HOH HOH A . D 3 HOH 149 365 365 HOH HOH A . D 3 HOH 150 366 366 HOH HOH A . D 3 HOH 151 367 367 HOH HOH A . D 3 HOH 152 368 368 HOH HOH A . D 3 HOH 153 369 369 HOH HOH A . D 3 HOH 154 370 370 HOH HOH A . D 3 HOH 155 371 371 HOH HOH A . D 3 HOH 156 372 372 HOH HOH A . D 3 HOH 157 373 373 HOH HOH A . D 3 HOH 158 374 374 HOH HOH A . D 3 HOH 159 375 375 HOH HOH A . D 3 HOH 160 376 376 HOH HOH A . D 3 HOH 161 377 377 HOH HOH A . D 3 HOH 162 378 378 HOH HOH A . D 3 HOH 163 379 379 HOH HOH A . D 3 HOH 164 380 380 HOH HOH A . D 3 HOH 165 381 381 HOH HOH A . D 3 HOH 166 382 382 HOH HOH A . D 3 HOH 167 383 383 HOH HOH A . D 3 HOH 168 384 384 HOH HOH A . D 3 HOH 169 385 385 HOH HOH A . D 3 HOH 170 386 386 HOH HOH A . D 3 HOH 171 387 387 HOH HOH A . D 3 HOH 172 388 388 HOH HOH A . D 3 HOH 173 389 213 HOH HOH A . D 3 HOH 174 390 214 HOH HOH A . D 3 HOH 175 391 215 HOH HOH A . D 3 HOH 176 392 216 HOH HOH A . #