data_3T5S # _entry.id 3T5S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3T5S pdb_00003t5s 10.2210/pdb3t5s/pdb RCSB RCSB067072 ? ? WWPDB D_1000067072 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-08-24 2 'Structure model' 1 1 2013-06-26 3 'Structure model' 1 2 2024-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' struct_ref_seq_dif 5 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3T5S _pdbx_database_status.recvd_initial_deposition_date 2011-07-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id GilaA.00834.a _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Crystal structure of a macrophage migration inhibitory factor from Giardia lamblia.' _citation.journal_abbrev J.Struct.Funct.Genom. _citation.journal_volume 14 _citation.page_first 47 _citation.page_last 57 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country NE _citation.journal_id_ISSN 1345-711X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23709284 _citation.pdbx_database_id_DOI 10.1007/s10969-013-9155-9 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 ? primary 'Abendroth, J.' 2 ? primary 'Robinson, H.' 3 ? primary 'Zhang, Y.' 4 ? primary 'Hewitt, S.N.' 5 ? primary 'Edwards, T.E.' 6 ? primary 'Van Voorhis, W.C.' 7 ? primary 'Myler, P.J.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Macrophage migration inhibitory factor' 14669.674 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GILAA.00834.A # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMGTLEAQTQGPGSMPCAIVTTNADFTKDQADAFCLDMGQVLAKETGKPVSYCMAGVRKADMSFGTSTDLCCF VDFYCIGVISQAKNPSISAAITGCLTQHFKVKPERVYISFNEAKGHNWGFNGSTF ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMGTLEAQTQGPGSMPCAIVTTNADFTKDQADAFCLDMGQVLAKETGKPVSYCMAGVRKADMSFGTSTDLCCF VDFYCIGVISQAKNPSISAAITGCLTQHFKVKPERVYISFNEAKGHNWGFNGSTF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GilaA.00834.a # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 ALA n 1 15 GLN n 1 16 THR n 1 17 GLN n 1 18 GLY n 1 19 PRO n 1 20 GLY n 1 21 SER n 1 22 MET n 1 23 PRO n 1 24 CYS n 1 25 ALA n 1 26 ILE n 1 27 VAL n 1 28 THR n 1 29 THR n 1 30 ASN n 1 31 ALA n 1 32 ASP n 1 33 PHE n 1 34 THR n 1 35 LYS n 1 36 ASP n 1 37 GLN n 1 38 ALA n 1 39 ASP n 1 40 ALA n 1 41 PHE n 1 42 CYS n 1 43 LEU n 1 44 ASP n 1 45 MET n 1 46 GLY n 1 47 GLN n 1 48 VAL n 1 49 LEU n 1 50 ALA n 1 51 LYS n 1 52 GLU n 1 53 THR n 1 54 GLY n 1 55 LYS n 1 56 PRO n 1 57 VAL n 1 58 SER n 1 59 TYR n 1 60 CYS n 1 61 MET n 1 62 ALA n 1 63 GLY n 1 64 VAL n 1 65 ARG n 1 66 LYS n 1 67 ALA n 1 68 ASP n 1 69 MET n 1 70 SER n 1 71 PHE n 1 72 GLY n 1 73 THR n 1 74 SER n 1 75 THR n 1 76 ASP n 1 77 LEU n 1 78 CYS n 1 79 CYS n 1 80 PHE n 1 81 VAL n 1 82 ASP n 1 83 PHE n 1 84 TYR n 1 85 CYS n 1 86 ILE n 1 87 GLY n 1 88 VAL n 1 89 ILE n 1 90 SER n 1 91 GLN n 1 92 ALA n 1 93 LYS n 1 94 ASN n 1 95 PRO n 1 96 SER n 1 97 ILE n 1 98 SER n 1 99 ALA n 1 100 ALA n 1 101 ILE n 1 102 THR n 1 103 GLY n 1 104 CYS n 1 105 LEU n 1 106 THR n 1 107 GLN n 1 108 HIS n 1 109 PHE n 1 110 LYS n 1 111 VAL n 1 112 LYS n 1 113 PRO n 1 114 GLU n 1 115 ARG n 1 116 VAL n 1 117 TYR n 1 118 ILE n 1 119 SER n 1 120 PHE n 1 121 ASN n 1 122 GLU n 1 123 ALA n 1 124 LYS n 1 125 GLY n 1 126 HIS n 1 127 ASN n 1 128 TRP n 1 129 GLY n 1 130 PHE n 1 131 ASN n 1 132 GLY n 1 133 SER n 1 134 THR n 1 135 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GL50803_12091 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 50803' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Giardia lamblia' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 184922 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name AVA0421 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -20 ? ? ? A . n A 1 2 ALA 2 -19 ? ? ? A . n A 1 3 HIS 3 -18 ? ? ? A . n A 1 4 HIS 4 -17 ? ? ? A . n A 1 5 HIS 5 -16 ? ? ? A . n A 1 6 HIS 6 -15 ? ? ? A . n A 1 7 HIS 7 -14 ? ? ? A . n A 1 8 HIS 8 -13 ? ? ? A . n A 1 9 MET 9 -12 ? ? ? A . n A 1 10 GLY 10 -11 ? ? ? A . n A 1 11 THR 11 -10 ? ? ? A . n A 1 12 LEU 12 -9 ? ? ? A . n A 1 13 GLU 13 -8 ? ? ? A . n A 1 14 ALA 14 -7 ? ? ? A . n A 1 15 GLN 15 -6 ? ? ? A . n A 1 16 THR 16 -5 ? ? ? A . n A 1 17 GLN 17 -4 ? ? ? A . n A 1 18 GLY 18 -3 ? ? ? A . n A 1 19 PRO 19 -2 ? ? ? A . n A 1 20 GLY 20 -1 ? ? ? A . n A 1 21 SER 21 0 0 SER SER A . n A 1 22 MET 22 1 1 MET MET A . n A 1 23 PRO 23 2 2 PRO PRO A . n A 1 24 CYS 24 3 3 CYS CYS A . n A 1 25 ALA 25 4 4 ALA ALA A . n A 1 26 ILE 26 5 5 ILE ILE A . n A 1 27 VAL 27 6 6 VAL VAL A . n A 1 28 THR 28 7 7 THR THR A . n A 1 29 THR 29 8 8 THR THR A . n A 1 30 ASN 30 9 9 ASN ASN A . n A 1 31 ALA 31 10 10 ALA ALA A . n A 1 32 ASP 32 11 11 ASP ASP A . n A 1 33 PHE 33 12 12 PHE PHE A . n A 1 34 THR 34 13 13 THR THR A . n A 1 35 LYS 35 14 14 LYS LYS A . n A 1 36 ASP 36 15 15 ASP ASP A . n A 1 37 GLN 37 16 16 GLN GLN A . n A 1 38 ALA 38 17 17 ALA ALA A . n A 1 39 ASP 39 18 18 ASP ASP A . n A 1 40 ALA 40 19 19 ALA ALA A . n A 1 41 PHE 41 20 20 PHE PHE A . n A 1 42 CYS 42 21 21 CYS CYS A . n A 1 43 LEU 43 22 22 LEU LEU A . n A 1 44 ASP 44 23 23 ASP ASP A . n A 1 45 MET 45 24 24 MET MET A . n A 1 46 GLY 46 25 25 GLY GLY A . n A 1 47 GLN 47 26 26 GLN GLN A . n A 1 48 VAL 48 27 27 VAL VAL A . n A 1 49 LEU 49 28 28 LEU LEU A . n A 1 50 ALA 50 29 29 ALA ALA A . n A 1 51 LYS 51 30 30 LYS LYS A . n A 1 52 GLU 52 31 31 GLU GLU A . n A 1 53 THR 53 32 32 THR THR A . n A 1 54 GLY 54 33 33 GLY GLY A . n A 1 55 LYS 55 34 34 LYS LYS A . n A 1 56 PRO 56 35 35 PRO PRO A . n A 1 57 VAL 57 36 36 VAL VAL A . n A 1 58 SER 58 37 37 SER SER A . n A 1 59 TYR 59 38 38 TYR TYR A . n A 1 60 CYS 60 39 39 CYS CYS A . n A 1 61 MET 61 40 40 MET MET A . n A 1 62 ALA 62 41 41 ALA ALA A . n A 1 63 GLY 63 42 42 GLY GLY A . n A 1 64 VAL 64 43 43 VAL VAL A . n A 1 65 ARG 65 44 44 ARG ARG A . n A 1 66 LYS 66 45 45 LYS LYS A . n A 1 67 ALA 67 46 46 ALA ALA A . n A 1 68 ASP 68 47 47 ASP ASP A . n A 1 69 MET 69 48 48 MET MET A . n A 1 70 SER 70 49 49 SER SER A . n A 1 71 PHE 71 50 50 PHE PHE A . n A 1 72 GLY 72 51 51 GLY GLY A . n A 1 73 THR 73 52 52 THR THR A . n A 1 74 SER 74 53 53 SER SER A . n A 1 75 THR 75 54 54 THR THR A . n A 1 76 ASP 76 55 55 ASP ASP A . n A 1 77 LEU 77 56 56 LEU LEU A . n A 1 78 CYS 78 57 57 CYS CYS A . n A 1 79 CYS 79 58 58 CYS CYS A . n A 1 80 PHE 80 59 59 PHE PHE A . n A 1 81 VAL 81 60 60 VAL VAL A . n A 1 82 ASP 82 61 61 ASP ASP A . n A 1 83 PHE 83 62 62 PHE PHE A . n A 1 84 TYR 84 63 63 TYR TYR A . n A 1 85 CYS 85 64 64 CYS CYS A . n A 1 86 ILE 86 65 65 ILE ILE A . n A 1 87 GLY 87 66 66 GLY GLY A . n A 1 88 VAL 88 67 ? ? ? A . n A 1 89 ILE 89 68 ? ? ? A . n A 1 90 SER 90 69 ? ? ? A . n A 1 91 GLN 91 70 ? ? ? A . n A 1 92 ALA 92 71 ? ? ? A . n A 1 93 LYS 93 72 72 LYS LYS A . n A 1 94 ASN 94 73 73 ASN ASN A . n A 1 95 PRO 95 74 74 PRO PRO A . n A 1 96 SER 96 75 75 SER SER A . n A 1 97 ILE 97 76 76 ILE ILE A . n A 1 98 SER 98 77 77 SER SER A . n A 1 99 ALA 99 78 78 ALA ALA A . n A 1 100 ALA 100 79 79 ALA ALA A . n A 1 101 ILE 101 80 80 ILE ILE A . n A 1 102 THR 102 81 81 THR THR A . n A 1 103 GLY 103 82 82 GLY GLY A . n A 1 104 CYS 104 83 83 CYS CYS A . n A 1 105 LEU 105 84 84 LEU LEU A . n A 1 106 THR 106 85 85 THR THR A . n A 1 107 GLN 107 86 86 GLN GLN A . n A 1 108 HIS 108 87 87 HIS HIS A . n A 1 109 PHE 109 88 88 PHE PHE A . n A 1 110 LYS 110 89 89 LYS LYS A . n A 1 111 VAL 111 90 90 VAL VAL A . n A 1 112 LYS 112 91 91 LYS LYS A . n A 1 113 PRO 113 92 92 PRO PRO A . n A 1 114 GLU 114 93 93 GLU GLU A . n A 1 115 ARG 115 94 94 ARG ARG A . n A 1 116 VAL 116 95 95 VAL VAL A . n A 1 117 TYR 117 96 96 TYR TYR A . n A 1 118 ILE 118 97 97 ILE ILE A . n A 1 119 SER 119 98 98 SER SER A . n A 1 120 PHE 120 99 99 PHE PHE A . n A 1 121 ASN 121 100 100 ASN ASN A . n A 1 122 GLU 122 101 101 GLU GLU A . n A 1 123 ALA 123 102 ? ? ? A . n A 1 124 LYS 124 103 ? ? ? A . n A 1 125 GLY 125 104 ? ? ? A . n A 1 126 HIS 126 105 ? ? ? A . n A 1 127 ASN 127 106 ? ? ? A . n A 1 128 TRP 128 107 ? ? ? A . n A 1 129 GLY 129 108 ? ? ? A . n A 1 130 PHE 130 109 ? ? ? A . n A 1 131 ASN 131 110 ? ? ? A . n A 1 132 GLY 132 111 ? ? ? A . n A 1 133 SER 133 112 ? ? ? A . n A 1 134 THR 134 113 ? ? ? A . n A 1 135 PHE 135 114 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 115 115 SO4 SO4 A . C 3 CL 1 116 116 CL CL A . D 4 HOH 1 117 117 HOH HOH A . D 4 HOH 2 118 118 HOH HOH A . D 4 HOH 3 119 119 HOH HOH A . D 4 HOH 4 120 120 HOH HOH A . D 4 HOH 5 121 121 HOH HOH A . D 4 HOH 6 122 122 HOH HOH A . D 4 HOH 7 123 123 HOH HOH A . D 4 HOH 8 124 124 HOH HOH A . D 4 HOH 9 125 125 HOH HOH A . D 4 HOH 10 126 126 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 11 ? CG ? A ASP 32 CG 2 1 Y 1 A ASP 11 ? OD1 ? A ASP 32 OD1 3 1 Y 1 A ASP 11 ? OD2 ? A ASP 32 OD2 4 1 Y 1 A LYS 14 ? CG ? A LYS 35 CG 5 1 Y 1 A LYS 14 ? CD ? A LYS 35 CD 6 1 Y 1 A LYS 14 ? CE ? A LYS 35 CE 7 1 Y 1 A LYS 14 ? NZ ? A LYS 35 NZ 8 1 Y 1 A GLN 26 ? CG ? A GLN 47 CG 9 1 Y 1 A GLN 26 ? CD ? A GLN 47 CD 10 1 Y 1 A GLN 26 ? OE1 ? A GLN 47 OE1 11 1 Y 1 A GLN 26 ? NE2 ? A GLN 47 NE2 12 1 Y 1 A LYS 30 ? CG ? A LYS 51 CG 13 1 Y 1 A LYS 30 ? CD ? A LYS 51 CD 14 1 Y 1 A LYS 30 ? CE ? A LYS 51 CE 15 1 Y 1 A LYS 30 ? NZ ? A LYS 51 NZ 16 1 Y 1 A GLU 31 ? CG ? A GLU 52 CG 17 1 Y 1 A GLU 31 ? CD ? A GLU 52 CD 18 1 Y 1 A GLU 31 ? OE1 ? A GLU 52 OE1 19 1 Y 1 A GLU 31 ? OE2 ? A GLU 52 OE2 20 1 Y 1 A LYS 34 ? CG ? A LYS 55 CG 21 1 Y 1 A LYS 34 ? CD ? A LYS 55 CD 22 1 Y 1 A LYS 34 ? CE ? A LYS 55 CE 23 1 Y 1 A LYS 34 ? NZ ? A LYS 55 NZ 24 1 Y 1 A CYS 64 ? SG ? A CYS 85 SG 25 1 Y 1 A ILE 65 ? CG1 ? A ILE 86 CG1 26 1 Y 1 A ILE 65 ? CG2 ? A ILE 86 CG2 27 1 Y 1 A ILE 65 ? CD1 ? A ILE 86 CD1 28 1 Y 1 A LYS 72 ? CG ? A LYS 93 CG 29 1 Y 1 A LYS 72 ? CD ? A LYS 93 CD 30 1 Y 1 A LYS 72 ? CE ? A LYS 93 CE 31 1 Y 1 A LYS 72 ? NZ ? A LYS 93 NZ 32 1 Y 1 A SER 75 ? OG ? A SER 96 OG 33 1 Y 1 A ILE 76 ? CG1 ? A ILE 97 CG1 34 1 Y 1 A ILE 76 ? CG2 ? A ILE 97 CG2 35 1 Y 1 A ILE 76 ? CD1 ? A ILE 97 CD1 36 1 Y 1 A GLN 86 ? CG ? A GLN 107 CG 37 1 Y 1 A GLN 86 ? CD ? A GLN 107 CD 38 1 Y 1 A GLN 86 ? OE1 ? A GLN 107 OE1 39 1 Y 1 A GLN 86 ? NE2 ? A GLN 107 NE2 40 1 Y 1 A LYS 89 ? CG ? A LYS 110 CG 41 1 Y 1 A LYS 89 ? CD ? A LYS 110 CD 42 1 Y 1 A LYS 89 ? CE ? A LYS 110 CE 43 1 Y 1 A LYS 89 ? NZ ? A LYS 110 NZ 44 1 Y 1 A GLU 101 ? CG ? A GLU 122 CG 45 1 Y 1 A GLU 101 ? CD ? A GLU 122 CD 46 1 Y 1 A GLU 101 ? OE1 ? A GLU 122 OE1 47 1 Y 1 A GLU 101 ? OE2 ? A GLU 122 OE2 # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal Blu-Ice 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 XDS 'data reduction' . ? 4 XSCALE 'data scaling' . ? 5 # _cell.entry_id 3T5S _cell.length_a 95.550 _cell.length_b 95.550 _cell.length_c 95.550 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3T5S _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 # _exptl.entry_id 3T5S _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.57 _exptl_crystal.density_percent_sol 52.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pdbx_details ;EMERALD BIOSYSTEMS PRECIPITANT SYNERGY 15: 2 M LITHIUM SULFATE, 5% ISOPROPANOL, 0.1 M ACETATE PH 4.5, 0.1 M MGSO4; GILAA.00834.A.A1 AT 4 MG/ML, PH 6.5, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 290K ; _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 100 ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 CCD 'ADSC QUANTUM 315r' 2011-04-15 ? 2 CCD 'MARMOSAIC 300 mm CCD' 2011-06-30 ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M 'Cryogenically cooled double crystal monochromator with horizontal focusing sagittal bend second mono crystal' 'SINGLE WAVELENGTH' x-ray 2 1 M 'double crystal monochromator' 'SINGLE WAVELENGTH' x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.54 1.0 2 0.97934 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'NSLS BEAMLINE X29A' NSLS X29A ? 1.54 2 SYNCHROTRON 'APS BEAMLINE 23-ID-D' APS 23-ID-D ? 0.97934 # _reflns.entry_id 3T5S _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.300 _reflns.number_obs 6594 _reflns.number_all 6597 _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.03200 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 33.8600 _reflns.B_iso_Wilson_estimate 70.32 _reflns.pdbx_redundancy 7.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1,2 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.36 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.44100 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.400 _reflns_shell.pdbx_redundancy 7.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 494 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1,2 # _refine.entry_id 3T5S _refine.ls_number_reflns_obs 6569 _refine.ls_number_reflns_all 6597 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.01 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 99.8 _refine.ls_R_factor_obs 0.223 _refine.ls_R_factor_all 0.223 _refine.ls_R_factor_R_work 0.221 _refine.ls_R_factor_R_free 0.268 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.500 _refine.ls_number_reflns_R_free 298 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.928 _refine.B_iso_mean 53.32 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model 'isotropic, TLS' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.209 _refine.overall_SU_ML 0.169 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 14.714 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1,2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 685 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 701 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 39.01 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.012 0.020 ? 702 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.001 0.020 ? 430 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.631 1.951 ? 956 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.906 3.000 ? 1051 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.439 5.000 ? 95 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 33.847 23.750 ? 24 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 15.066 15.000 ? 91 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 13.817 15.000 ? 2 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.084 0.200 ? 114 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.007 0.021 ? 802 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.001 0.020 ? 148 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.30 _refine_ls_shell.d_res_low 2.36 _refine_ls_shell.number_reflns_R_work 422 _refine_ls_shell.R_factor_R_work 0.4440 _refine_ls_shell.percent_reflns_obs 99.55 _refine_ls_shell.R_factor_R_free 0.3650 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 494 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 3T5S _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 3T5S _struct.title 'Structure of macrophage migration inhibitory factor from Giardia lamblia' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3T5S _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A8BFP4_GIAIC _struct_ref.pdbx_db_accession A8BFP4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPCAIVTTNADFTKDQADAFCLDMGQVLAKETGKPVSYCMAGVRKADMSFGTSTDLCCFVDFYCIGVISQAKNPSISAAI TGCLTQHFKVKPERVYISFNEAKGHNWGFNGSTF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3T5S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 135 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A8BFP4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 114 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 114 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3T5S MET A 1 ? UNP A8BFP4 ? ? 'expression tag' -20 1 1 3T5S ALA A 2 ? UNP A8BFP4 ? ? 'expression tag' -19 2 1 3T5S HIS A 3 ? UNP A8BFP4 ? ? 'expression tag' -18 3 1 3T5S HIS A 4 ? UNP A8BFP4 ? ? 'expression tag' -17 4 1 3T5S HIS A 5 ? UNP A8BFP4 ? ? 'expression tag' -16 5 1 3T5S HIS A 6 ? UNP A8BFP4 ? ? 'expression tag' -15 6 1 3T5S HIS A 7 ? UNP A8BFP4 ? ? 'expression tag' -14 7 1 3T5S HIS A 8 ? UNP A8BFP4 ? ? 'expression tag' -13 8 1 3T5S MET A 9 ? UNP A8BFP4 ? ? 'expression tag' -12 9 1 3T5S GLY A 10 ? UNP A8BFP4 ? ? 'expression tag' -11 10 1 3T5S THR A 11 ? UNP A8BFP4 ? ? 'expression tag' -10 11 1 3T5S LEU A 12 ? UNP A8BFP4 ? ? 'expression tag' -9 12 1 3T5S GLU A 13 ? UNP A8BFP4 ? ? 'expression tag' -8 13 1 3T5S ALA A 14 ? UNP A8BFP4 ? ? 'expression tag' -7 14 1 3T5S GLN A 15 ? UNP A8BFP4 ? ? 'expression tag' -6 15 1 3T5S THR A 16 ? UNP A8BFP4 ? ? 'expression tag' -5 16 1 3T5S GLN A 17 ? UNP A8BFP4 ? ? 'expression tag' -4 17 1 3T5S GLY A 18 ? UNP A8BFP4 ? ? 'expression tag' -3 18 1 3T5S PRO A 19 ? UNP A8BFP4 ? ? 'expression tag' -2 19 1 3T5S GLY A 20 ? UNP A8BFP4 ? ? 'expression tag' -1 20 1 3T5S SER A 21 ? UNP A8BFP4 ? ? 'expression tag' 0 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5180 ? 1 MORE -87 ? 1 'SSA (A^2)' 12000 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -z,x+1/2,-y+1/2 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 47.7750000000 0.0000000000 -1.0000000000 0.0000000000 47.7750000000 3 'crystal symmetry operation' 11_455 y-1/2,-z+1/2,-x 0.0000000000 1.0000000000 0.0000000000 -47.7750000000 0.0000000000 0.0000000000 -1.0000000000 47.7750000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 34 ? GLY A 54 ? THR A 13 GLY A 33 1 ? 21 HELX_P HELX_P2 2 PRO A 56 ? CYS A 60 ? PRO A 35 CYS A 39 5 ? 5 HELX_P HELX_P3 3 ASN A 94 ? LYS A 110 ? ASN A 73 LYS A 89 1 ? 17 HELX_P HELX_P4 4 LYS A 112 ? GLU A 114 ? LYS A 91 GLU A 93 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 61 ? LYS A 66 ? MET A 40 LYS A 45 A 2 CYS A 24 ? THR A 29 ? CYS A 3 THR A 8 A 3 CYS A 79 ? TYR A 84 ? CYS A 58 TYR A 63 A 4 VAL A 116 ? ASN A 121 ? VAL A 95 ASN A 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 63 ? O GLY A 42 N VAL A 27 ? N VAL A 6 A 2 3 N THR A 28 ? N THR A 7 O PHE A 80 ? O PHE A 59 A 3 4 N VAL A 81 ? N VAL A 60 O SER A 119 ? O SER A 98 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 115 ? 2 'BINDING SITE FOR RESIDUE SO4 A 115' AC2 Software A CL 116 ? 1 'BINDING SITE FOR RESIDUE CL A 116' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 THR A 34 ? THR A 13 . ? 1_555 ? 2 AC1 2 LYS A 35 ? LYS A 14 . ? 1_555 ? 3 AC2 1 HIS A 108 ? HIS A 87 . ? 1_555 ? # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 123 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -23.4110 20.1580 12.6950 0.4194 0.2152 0.3814 -0.0114 -0.0666 0.0223 2.4171 1.6873 3.4556 -0.8312 2.2166 0.4219 0.1466 -0.1233 -0.2733 -0.0027 -0.0381 0.3346 0.5771 -0.0966 -0.1086 'X-RAY DIFFRACTION' 2 ? refined -20.5590 11.8520 13.7790 0.6770 0.1017 0.4333 -0.0092 -0.1194 0.0096 2.8110 3.3745 7.0367 0.2943 2.2952 -1.8432 0.4945 0.1615 -0.7132 -0.0370 0.0011 0.1153 1.3075 0.1204 -0.4956 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 0 ? ? A 66 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 72 ? ? A 101 ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -20 ? A MET 1 2 1 Y 1 A ALA -19 ? A ALA 2 3 1 Y 1 A HIS -18 ? A HIS 3 4 1 Y 1 A HIS -17 ? A HIS 4 5 1 Y 1 A HIS -16 ? A HIS 5 6 1 Y 1 A HIS -15 ? A HIS 6 7 1 Y 1 A HIS -14 ? A HIS 7 8 1 Y 1 A HIS -13 ? A HIS 8 9 1 Y 1 A MET -12 ? A MET 9 10 1 Y 1 A GLY -11 ? A GLY 10 11 1 Y 1 A THR -10 ? A THR 11 12 1 Y 1 A LEU -9 ? A LEU 12 13 1 Y 1 A GLU -8 ? A GLU 13 14 1 Y 1 A ALA -7 ? A ALA 14 15 1 Y 1 A GLN -6 ? A GLN 15 16 1 Y 1 A THR -5 ? A THR 16 17 1 Y 1 A GLN -4 ? A GLN 17 18 1 Y 1 A GLY -3 ? A GLY 18 19 1 Y 1 A PRO -2 ? A PRO 19 20 1 Y 1 A GLY -1 ? A GLY 20 21 1 Y 1 A VAL 67 ? A VAL 88 22 1 Y 1 A ILE 68 ? A ILE 89 23 1 Y 1 A SER 69 ? A SER 90 24 1 Y 1 A GLN 70 ? A GLN 91 25 1 Y 1 A ALA 71 ? A ALA 92 26 1 Y 1 A ALA 102 ? A ALA 123 27 1 Y 1 A LYS 103 ? A LYS 124 28 1 Y 1 A GLY 104 ? A GLY 125 29 1 Y 1 A HIS 105 ? A HIS 126 30 1 Y 1 A ASN 106 ? A ASN 127 31 1 Y 1 A TRP 107 ? A TRP 128 32 1 Y 1 A GLY 108 ? A GLY 129 33 1 Y 1 A PHE 109 ? A PHE 130 34 1 Y 1 A ASN 110 ? A ASN 131 35 1 Y 1 A GLY 111 ? A GLY 132 36 1 Y 1 A SER 112 ? A SER 133 37 1 Y 1 A THR 113 ? A THR 134 38 1 Y 1 A PHE 114 ? A PHE 135 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TRP N N N N 327 TRP CA C N S 328 TRP C C N N 329 TRP O O N N 330 TRP CB C N N 331 TRP CG C Y N 332 TRP CD1 C Y N 333 TRP CD2 C Y N 334 TRP NE1 N Y N 335 TRP CE2 C Y N 336 TRP CE3 C Y N 337 TRP CZ2 C Y N 338 TRP CZ3 C Y N 339 TRP CH2 C Y N 340 TRP OXT O N N 341 TRP H H N N 342 TRP H2 H N N 343 TRP HA H N N 344 TRP HB2 H N N 345 TRP HB3 H N N 346 TRP HD1 H N N 347 TRP HE1 H N N 348 TRP HE3 H N N 349 TRP HZ2 H N N 350 TRP HZ3 H N N 351 TRP HH2 H N N 352 TRP HXT H N N 353 TYR N N N N 354 TYR CA C N S 355 TYR C C N N 356 TYR O O N N 357 TYR CB C N N 358 TYR CG C Y N 359 TYR CD1 C Y N 360 TYR CD2 C Y N 361 TYR CE1 C Y N 362 TYR CE2 C Y N 363 TYR CZ C Y N 364 TYR OH O N N 365 TYR OXT O N N 366 TYR H H N N 367 TYR H2 H N N 368 TYR HA H N N 369 TYR HB2 H N N 370 TYR HB3 H N N 371 TYR HD1 H N N 372 TYR HD2 H N N 373 TYR HE1 H N N 374 TYR HE2 H N N 375 TYR HH H N N 376 TYR HXT H N N 377 VAL N N N N 378 VAL CA C N S 379 VAL C C N N 380 VAL O O N N 381 VAL CB C N N 382 VAL CG1 C N N 383 VAL CG2 C N N 384 VAL OXT O N N 385 VAL H H N N 386 VAL H2 H N N 387 VAL HA H N N 388 VAL HB H N N 389 VAL HG11 H N N 390 VAL HG12 H N N 391 VAL HG13 H N N 392 VAL HG21 H N N 393 VAL HG22 H N N 394 VAL HG23 H N N 395 VAL HXT H N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _atom_sites.entry_id 3T5S _atom_sites.fract_transf_matrix[1][1] 0.010466 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010466 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010466 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_