data_3TKZ # _entry.id 3TKZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3TKZ pdb_00003tkz 10.2210/pdb3tkz/pdb RCSB RCSB067607 ? ? WWPDB D_1000067607 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-10-26 2 'Structure model' 1 1 2023-09-13 3 'Structure model' 1 2 2023-12-06 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' 5 3 'Structure model' 'Data collection' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_ref_seq_dif 7 2 'Structure model' struct_sheet 8 3 'Structure model' chem_comp_atom 9 3 'Structure model' chem_comp_bond 10 4 'Structure model' pdbx_entry_details 11 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 2 'Structure model' '_struct_ref_seq_dif.details' 5 2 'Structure model' '_struct_sheet.number_strands' 6 3 'Structure model' '_chem_comp_atom.atom_id' 7 3 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3TKZ _pdbx_database_status.recvd_initial_deposition_date 2011-08-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3TL0 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, Y.' 1 'Zhang, J.' 2 'Yuan, C.' 3 'Hard, R.L.' 4 'Park, I.H.' 5 'Li, C.' 6 'Bell, C.E.' 7 'Pei, D.' 8 # _citation.id primary _citation.title 'Simultaneous binding of two peptidyl ligands by a SRC homology 2 domain.' _citation.journal_abbrev Biochemistry _citation.journal_volume 50 _citation.page_first 7637 _citation.page_last 7646 _citation.year 2011 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21800896 _citation.pdbx_database_id_DOI 10.1021/bi200439v # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, Y.' 1 ? primary 'Zhang, J.' 2 ? primary 'Yuan, C.' 3 ? primary 'Hard, R.L.' 4 ? primary 'Park, I.H.' 5 ? primary 'Li, C.' 6 ? primary 'Bell, C.' 7 ? primary 'Pei, D.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein phosphatase non-receptor type 11' 12288.744 1 3.1.3.48 ? 'N-terminal SH2 domain (UNP residues 1-106)' ? 2 polymer syn 'PROTEIN (RVIpYFVPLNR peptide)' 1358.524 2 ? ? ? 'Y4 residue is phosphorylated' 3 water nat water 18.015 81 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein-tyrosine phosphatase 1D, PTP-1D, Protein-tyrosine phosphatase 2C, PTP-2C, SH-PTP2, SHP-2, Shp2, SH-PTP3' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAEL VQYYMEHHGQLKEKNGDVIELKYPLNCAD ; ;GSHMTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAEL VQYYMEHHGQLKEKNGDVIELKYPLNCAD ; A ? 2 'polypeptide(L)' no yes 'RVI(PTR)FVPLNR' RVIYFVPLNR P,Q ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 THR n 1 6 SER n 1 7 ARG n 1 8 ARG n 1 9 TRP n 1 10 PHE n 1 11 HIS n 1 12 PRO n 1 13 ASN n 1 14 ILE n 1 15 THR n 1 16 GLY n 1 17 VAL n 1 18 GLU n 1 19 ALA n 1 20 GLU n 1 21 ASN n 1 22 LEU n 1 23 LEU n 1 24 LEU n 1 25 THR n 1 26 ARG n 1 27 GLY n 1 28 VAL n 1 29 ASP n 1 30 GLY n 1 31 SER n 1 32 PHE n 1 33 LEU n 1 34 ALA n 1 35 ARG n 1 36 PRO n 1 37 SER n 1 38 LYS n 1 39 SER n 1 40 ASN n 1 41 PRO n 1 42 GLY n 1 43 ASP n 1 44 PHE n 1 45 THR n 1 46 LEU n 1 47 SER n 1 48 VAL n 1 49 ARG n 1 50 ARG n 1 51 ASN n 1 52 GLY n 1 53 ALA n 1 54 VAL n 1 55 THR n 1 56 HIS n 1 57 ILE n 1 58 LYS n 1 59 ILE n 1 60 GLN n 1 61 ASN n 1 62 THR n 1 63 GLY n 1 64 ASP n 1 65 TYR n 1 66 TYR n 1 67 ASP n 1 68 LEU n 1 69 TYR n 1 70 GLY n 1 71 GLY n 1 72 GLU n 1 73 LYS n 1 74 PHE n 1 75 ALA n 1 76 THR n 1 77 LEU n 1 78 ALA n 1 79 GLU n 1 80 LEU n 1 81 VAL n 1 82 GLN n 1 83 TYR n 1 84 TYR n 1 85 MET n 1 86 GLU n 1 87 HIS n 1 88 HIS n 1 89 GLY n 1 90 GLN n 1 91 LEU n 1 92 LYS n 1 93 GLU n 1 94 LYS n 1 95 ASN n 1 96 GLY n 1 97 ASP n 1 98 VAL n 1 99 ILE n 1 100 GLU n 1 101 LEU n 1 102 LYS n 1 103 TYR n 1 104 PRO n 1 105 LEU n 1 106 ASN n 1 107 CYS n 1 108 ALA n 1 109 ASP n 2 1 ARG n 2 2 VAL n 2 3 ILE n 2 4 PTR n 2 5 PHE n 2 6 VAL n 2 7 PRO n 2 8 LEU n 2 9 ASN n 2 10 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTPN11, PTP2C, SHPTP2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The peptide was synthesized using standard Fmoc/HBTU chemistry' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 THR 5 2 ? ? ? A . n A 1 6 SER 6 3 ? ? ? A . n A 1 7 ARG 7 4 4 ARG ARG A . n A 1 8 ARG 8 5 5 ARG ARG A . n A 1 9 TRP 9 6 6 TRP TRP A . n A 1 10 PHE 10 7 7 PHE PHE A . n A 1 11 HIS 11 8 8 HIS HIS A . n A 1 12 PRO 12 9 9 PRO PRO A . n A 1 13 ASN 13 10 10 ASN ASN A . n A 1 14 ILE 14 11 11 ILE ILE A . n A 1 15 THR 15 12 12 THR THR A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 GLU 18 15 15 GLU GLU A . n A 1 19 ALA 19 16 16 ALA ALA A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 ASN 21 18 18 ASN ASN A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 LEU 24 21 21 LEU LEU A . n A 1 25 THR 25 22 22 THR THR A . n A 1 26 ARG 26 23 23 ARG ARG A . n A 1 27 GLY 27 24 24 GLY GLY A . n A 1 28 VAL 28 25 25 VAL VAL A . n A 1 29 ASP 29 26 26 ASP ASP A . n A 1 30 GLY 30 27 27 GLY GLY A . n A 1 31 SER 31 28 28 SER SER A . n A 1 32 PHE 32 29 29 PHE PHE A . n A 1 33 LEU 33 30 30 LEU LEU A . n A 1 34 ALA 34 31 31 ALA ALA A . n A 1 35 ARG 35 32 32 ARG ARG A . n A 1 36 PRO 36 33 33 PRO PRO A . n A 1 37 SER 37 34 34 SER SER A . n A 1 38 LYS 38 35 35 LYS LYS A . n A 1 39 SER 39 36 36 SER SER A . n A 1 40 ASN 40 37 37 ASN ASN A . n A 1 41 PRO 41 38 38 PRO PRO A . n A 1 42 GLY 42 39 39 GLY GLY A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 PHE 44 41 41 PHE PHE A . n A 1 45 THR 45 42 42 THR THR A . n A 1 46 LEU 46 43 43 LEU LEU A . n A 1 47 SER 47 44 44 SER SER A . n A 1 48 VAL 48 45 45 VAL VAL A . n A 1 49 ARG 49 46 46 ARG ARG A . n A 1 50 ARG 50 47 47 ARG ARG A . n A 1 51 ASN 51 48 48 ASN ASN A . n A 1 52 GLY 52 49 49 GLY GLY A . n A 1 53 ALA 53 50 50 ALA ALA A . n A 1 54 VAL 54 51 51 VAL VAL A . n A 1 55 THR 55 52 52 THR THR A . n A 1 56 HIS 56 53 53 HIS HIS A . n A 1 57 ILE 57 54 54 ILE ILE A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 ILE 59 56 56 ILE ILE A . n A 1 60 GLN 60 57 57 GLN GLN A . n A 1 61 ASN 61 58 58 ASN ASN A . n A 1 62 THR 62 59 59 THR THR A . n A 1 63 GLY 63 60 60 GLY GLY A . n A 1 64 ASP 64 61 61 ASP ASP A . n A 1 65 TYR 65 62 62 TYR TYR A . n A 1 66 TYR 66 63 63 TYR TYR A . n A 1 67 ASP 67 64 64 ASP ASP A . n A 1 68 LEU 68 65 65 LEU LEU A . n A 1 69 TYR 69 66 66 TYR TYR A . n A 1 70 GLY 70 67 67 GLY GLY A . n A 1 71 GLY 71 68 68 GLY GLY A . n A 1 72 GLU 72 69 69 GLU GLU A . n A 1 73 LYS 73 70 70 LYS LYS A . n A 1 74 PHE 74 71 71 PHE PHE A . n A 1 75 ALA 75 72 72 ALA ALA A . n A 1 76 THR 76 73 73 THR THR A . n A 1 77 LEU 77 74 74 LEU LEU A . n A 1 78 ALA 78 75 75 ALA ALA A . n A 1 79 GLU 79 76 76 GLU GLU A . n A 1 80 LEU 80 77 77 LEU LEU A . n A 1 81 VAL 81 78 78 VAL VAL A . n A 1 82 GLN 82 79 79 GLN GLN A . n A 1 83 TYR 83 80 80 TYR TYR A . n A 1 84 TYR 84 81 81 TYR TYR A . n A 1 85 MET 85 82 82 MET MET A . n A 1 86 GLU 86 83 83 GLU GLU A . n A 1 87 HIS 87 84 84 HIS HIS A . n A 1 88 HIS 88 85 85 HIS HIS A . n A 1 89 GLY 89 86 86 GLY GLY A . n A 1 90 GLN 90 87 87 GLN GLN A . n A 1 91 LEU 91 88 88 LEU LEU A . n A 1 92 LYS 92 89 89 LYS LYS A . n A 1 93 GLU 93 90 90 GLU GLU A . n A 1 94 LYS 94 91 91 LYS LYS A . n A 1 95 ASN 95 92 92 ASN ASN A . n A 1 96 GLY 96 93 93 GLY GLY A . n A 1 97 ASP 97 94 94 ASP ASP A . n A 1 98 VAL 98 95 95 VAL VAL A . n A 1 99 ILE 99 96 96 ILE ILE A . n A 1 100 GLU 100 97 97 GLU GLU A . n A 1 101 LEU 101 98 98 LEU LEU A . n A 1 102 LYS 102 99 99 LYS LYS A . n A 1 103 TYR 103 100 100 TYR TYR A . n A 1 104 PRO 104 101 101 PRO PRO A . n A 1 105 LEU 105 102 102 LEU LEU A . n A 1 106 ASN 106 103 103 ASN ASN A . n A 1 107 CYS 107 104 ? ? ? A . n A 1 108 ALA 108 105 ? ? ? A . n A 1 109 ASP 109 106 ? ? ? A . n B 2 1 ARG 1 1 ? ? ? P . n B 2 2 VAL 2 2 2 VAL VAL P . n B 2 3 ILE 3 3 3 ILE ILE P . n B 2 4 PTR 4 4 4 PTR PTR P . n B 2 5 PHE 5 5 5 PHE PHE P . n B 2 6 VAL 6 6 6 VAL VAL P . n B 2 7 PRO 7 7 7 PRO PRO P . n B 2 8 LEU 8 8 8 LEU LEU P . n B 2 9 ASN 9 9 ? ? ? P . n B 2 10 ARG 10 10 ? ? ? P . n C 2 1 ARG 1 1 ? ? ? Q . n C 2 2 VAL 2 2 2 VAL VAL Q . n C 2 3 ILE 3 3 3 ILE ILE Q . n C 2 4 PTR 4 4 4 PTR PTR Q . n C 2 5 PHE 5 5 5 PHE PHE Q . n C 2 6 VAL 6 6 6 VAL VAL Q . n C 2 7 PRO 7 7 7 PRO PRO Q . n C 2 8 LEU 8 8 ? ? ? Q . n C 2 9 ASN 9 9 ? ? ? Q . n C 2 10 ARG 10 10 ? ? ? Q . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 HOH 1 107 1 HOH HOH A . D 3 HOH 2 108 2 HOH HOH A . D 3 HOH 3 109 3 HOH HOH A . D 3 HOH 4 110 5 HOH HOH A . D 3 HOH 5 111 6 HOH HOH A . D 3 HOH 6 112 7 HOH HOH A . D 3 HOH 7 113 8 HOH HOH A . D 3 HOH 8 114 9 HOH HOH A . D 3 HOH 9 115 10 HOH HOH A . D 3 HOH 10 116 11 HOH HOH A . D 3 HOH 11 117 12 HOH HOH A . D 3 HOH 12 118 13 HOH HOH A . D 3 HOH 13 119 14 HOH HOH A . D 3 HOH 14 120 17 HOH HOH A . D 3 HOH 15 121 18 HOH HOH A . D 3 HOH 16 122 19 HOH HOH A . D 3 HOH 17 123 20 HOH HOH A . D 3 HOH 18 124 21 HOH HOH A . D 3 HOH 19 125 22 HOH HOH A . D 3 HOH 20 126 23 HOH HOH A . D 3 HOH 21 127 26 HOH HOH A . D 3 HOH 22 128 27 HOH HOH A . D 3 HOH 23 129 29 HOH HOH A . D 3 HOH 24 130 30 HOH HOH A . D 3 HOH 25 131 31 HOH HOH A . D 3 HOH 26 132 32 HOH HOH A . D 3 HOH 27 133 33 HOH HOH A . D 3 HOH 28 134 34 HOH HOH A . D 3 HOH 29 135 35 HOH HOH A . D 3 HOH 30 136 36 HOH HOH A . D 3 HOH 31 137 40 HOH HOH A . D 3 HOH 32 138 41 HOH HOH A . D 3 HOH 33 139 42 HOH HOH A . D 3 HOH 34 140 43 HOH HOH A . D 3 HOH 35 141 45 HOH HOH A . D 3 HOH 36 142 48 HOH HOH A . D 3 HOH 37 143 50 HOH HOH A . D 3 HOH 38 144 51 HOH HOH A . D 3 HOH 39 145 52 HOH HOH A . D 3 HOH 40 146 54 HOH HOH A . D 3 HOH 41 147 56 HOH HOH A . D 3 HOH 42 148 57 HOH HOH A . D 3 HOH 43 149 58 HOH HOH A . D 3 HOH 44 150 59 HOH HOH A . D 3 HOH 45 151 60 HOH HOH A . D 3 HOH 46 152 61 HOH HOH A . D 3 HOH 47 153 62 HOH HOH A . D 3 HOH 48 154 63 HOH HOH A . D 3 HOH 49 155 64 HOH HOH A . D 3 HOH 50 156 65 HOH HOH A . D 3 HOH 51 157 66 HOH HOH A . D 3 HOH 52 158 67 HOH HOH A . D 3 HOH 53 159 68 HOH HOH A . D 3 HOH 54 160 69 HOH HOH A . D 3 HOH 55 161 70 HOH HOH A . D 3 HOH 56 162 71 HOH HOH A . D 3 HOH 57 163 72 HOH HOH A . D 3 HOH 58 164 73 HOH HOH A . D 3 HOH 59 165 74 HOH HOH A . D 3 HOH 60 166 75 HOH HOH A . D 3 HOH 61 167 76 HOH HOH A . D 3 HOH 62 168 77 HOH HOH A . D 3 HOH 63 169 1 HOH HOH A . D 3 HOH 64 170 2 HOH HOH A . D 3 HOH 65 171 3 HOH HOH A . D 3 HOH 66 172 4 HOH HOH A . D 3 HOH 67 173 6 HOH HOH A . D 3 HOH 68 174 7 HOH HOH A . D 3 HOH 69 175 8 HOH HOH A . D 3 HOH 70 176 9 HOH HOH A . D 3 HOH 71 177 12 HOH HOH A . D 3 HOH 72 178 13 HOH HOH A . D 3 HOH 73 179 14 HOH HOH A . D 3 HOH 74 180 25 HOH HOH A . E 3 HOH 1 18 11 HOH HOH P . E 3 HOH 2 24 24 HOH HOH P . E 3 HOH 3 25 10 HOH HOH P . E 3 HOH 4 37 37 HOH HOH P . E 3 HOH 5 46 46 HOH HOH P . F 3 HOH 1 17 16 HOH HOH Q . F 3 HOH 2 38 38 HOH HOH Q . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 4 ? CG ? A ARG 7 CG 2 1 Y 1 A ARG 4 ? CD ? A ARG 7 CD 3 1 Y 1 A ARG 4 ? NE ? A ARG 7 NE 4 1 Y 1 A ARG 4 ? CZ ? A ARG 7 CZ 5 1 Y 1 A ARG 4 ? NH1 ? A ARG 7 NH1 6 1 Y 1 A ARG 4 ? NH2 ? A ARG 7 NH2 7 1 Y 1 A LYS 35 ? CG ? A LYS 38 CG 8 1 Y 1 A LYS 35 ? CD ? A LYS 38 CD 9 1 Y 1 A LYS 35 ? CE ? A LYS 38 CE 10 1 Y 1 A LYS 35 ? NZ ? A LYS 38 NZ 11 1 Y 1 A LYS 91 ? CG ? A LYS 94 CG 12 1 Y 1 A LYS 91 ? CD ? A LYS 94 CD 13 1 Y 1 A LYS 91 ? CE ? A LYS 94 CE 14 1 Y 1 A LYS 91 ? NZ ? A LYS 94 NZ # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing 'of CCP4' ? 2 REFMAC refinement 5.5.0100 ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # _cell.entry_id 3TKZ _cell.length_a 62.865 _cell.length_b 62.865 _cell.length_c 75.322 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3TKZ _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # _exptl.entry_id 3TKZ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_percent_sol 50.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_details '20% PEG 3350, 0.1M Bis-Tris, 0.2M Li2SO4, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector ? _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 2007-03-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.98 # _reflns.entry_id 3TKZ _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 48.3 _reflns.d_resolution_high 1.80 _reflns.number_obs 15827 _reflns.number_all ? _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs 0.030 _reflns.pdbx_netI_over_sigmaI 61.5 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.89 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.382 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.0 _reflns_shell.pdbx_redundancy 11.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3TKZ _refine.ls_number_reflns_obs 13727 _refine.ls_number_reflns_all 13727 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 32.31 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 99.27 _refine.ls_R_factor_obs 0.19776 _refine.ls_R_factor_R_work 0.19679 _refine.ls_R_factor_R_free 0.21602 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 728 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.955 _refine.B_iso_mean 43.354 _refine.aniso_B[1][1] 0.03 _refine.aniso_B[2][2] 0.03 _refine.aniso_B[3][3] -0.05 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB entry 1AYD' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.107 _refine.overall_SU_ML 0.079 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 5.508 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.ls_R_factor_all ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 911 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 81 _refine_hist.number_atoms_total 992 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 32.31 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.021 0.022 ? 934 ? 'X-RAY DIFFRACTION' r_bond_other_d ? ? ? ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.960 1.967 ? 1272 ? 'X-RAY DIFFRACTION' r_angle_other_deg ? ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 7.397 5.000 ? 110 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 39.781 23.696 ? 46 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 15.929 15.000 ? 141 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 17.219 15.000 ? 5 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.146 0.200 ? 137 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.011 0.021 ? 717 ? 'X-RAY DIFFRACTION' r_gen_planes_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it 1.277 1.500 ? 558 ? 'X-RAY DIFFRACTION' r_mcbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_it 2.291 2.000 ? 897 ? 'X-RAY DIFFRACTION' r_scbond_it 3.376 3.000 ? 376 ? 'X-RAY DIFFRACTION' r_scangle_it 5.397 4.500 ? 375 ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.800 _refine_ls_shell.d_res_low 1.847 _refine_ls_shell.number_reflns_R_work 992 _refine_ls_shell.R_factor_R_work 0.297 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.431 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 61 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 3TKZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 3TKZ _struct.title 'Structure of the SHP-2 N-SH2 domain in a 1:2 complex with RVIpYFVPLNR peptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3TKZ _struct_keywords.pdbx_keywords HYDROLASE/Peptide _struct_keywords.text 'SH2 domain, Protein Protein Interactions, PTR Residues, HYDROLASE-Peptide complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP PTN11_HUMAN Q06124 1 ;MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQY YMEHHGQLKEKNGDVIELKYPLNCAD ; 1 ? 2 PDB 3TKZ 3TKZ 2 RVIYFVPLNR ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3TKZ A 4 ? 109 ? Q06124 1 ? 106 ? 1 106 2 2 3TKZ P 1 ? 10 ? 3TKZ 1 ? 10 ? 1 10 3 2 3TKZ Q 1 ? 10 ? 3TKZ 1 ? 10 ? 1 10 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3TKZ GLY A 1 ? UNP Q06124 ? ? 'expression tag' -2 1 1 3TKZ SER A 2 ? UNP Q06124 ? ? 'expression tag' -1 2 1 3TKZ HIS A 3 ? UNP Q06124 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2130 ? 1 MORE -22 ? 1 'SSA (A^2)' 5700 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_biol.id _struct_biol.details 1 ? 0 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 15 ? GLY A 27 ? THR A 12 GLY A 24 1 ? 13 HELX_P HELX_P2 2 THR A 76 ? HIS A 87 ? THR A 73 HIS A 84 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ILE 3 C ? ? ? 1_555 B PTR 4 N ? ? P ILE 3 P PTR 4 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale2 covale both ? B PTR 4 C ? ? ? 1_555 B PHE 5 N ? ? P PTR 4 P PHE 5 1_555 ? ? ? ? ? ? ? 1.309 ? ? covale3 covale both ? C ILE 3 C ? ? ? 1_555 C PTR 4 N ? ? Q ILE 3 Q PTR 4 1_555 ? ? ? ? ? ? ? 1.346 ? ? covale4 covale both ? C PTR 4 C ? ? ? 1_555 C PHE 5 N ? ? Q PTR 4 Q PHE 5 1_555 ? ? ? ? ? ? ? 1.322 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PTR B 4 ? . . . . PTR P 4 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 2 PTR C 4 ? . . . . PTR Q 4 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 7 A . ? ARG 4 A ARG 8 A ? ARG 5 A 1 18.07 2 ASN 95 A . ? ASN 92 A GLY 96 A ? GLY 93 A 1 10.93 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 1 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 66 ? ASP A 67 ? TYR A 63 ASP A 64 A 2 ALA A 53 ? ASN A 61 ? ALA A 50 ASN A 58 A 3 PHE A 44 ? ARG A 50 ? PHE A 41 ARG A 47 A 4 SER A 31 ? PRO A 36 ? SER A 28 PRO A 33 A 5 TYR A 103 ? PRO A 104 ? TYR A 100 PRO A 101 B 1 LEU A 91 ? GLU A 93 ? LEU A 88 GLU A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASP A 67 ? O ASP A 64 N GLN A 60 ? N GLN A 57 A 2 3 O ILE A 57 ? O ILE A 54 N LEU A 46 ? N LEU A 43 A 3 4 O ARG A 49 ? O ARG A 46 N SER A 31 ? N SER A 28 A 4 5 N PHE A 32 ? N PHE A 29 O TYR A 103 ? O TYR A 100 # _pdbx_entry_details.entry_id 3TKZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE2 A GLU 76 ? ? 1_555 OE2 A GLU 76 ? ? 7_555 0.99 2 1 CD A GLU 76 ? ? 1_555 OE2 A GLU 76 ? ? 7_555 2.18 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 64 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 64 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 64 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.13 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 5.83 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 91 ? ? -67.63 19.64 2 1 ASN A 92 ? ? -177.65 33.28 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B PTR 4 P PTR 4 ? TYR O-PHOSPHOTYROSINE 2 C PTR 4 Q PTR 4 ? TYR O-PHOSPHOTYROSINE # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 167 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 4.3280 26.7700 11.0270 0.1816 0.2177 0.2268 0.0149 0.0536 0.0131 6.7029 7.6224 18.7069 0.9577 -3.7751 5.4317 0.5925 0.2835 0.5659 -0.0385 -0.5522 0.0884 -1.0321 -0.8278 -0.0403 'X-RAY DIFFRACTION' 2 ? refined 1.2560 24.0480 22.5780 0.3023 0.3232 0.1495 -0.1626 0.1130 -0.1118 9.4046 7.8926 3.2981 6.3330 -1.0112 0.6101 0.5100 -0.9650 0.6350 0.2458 -0.2827 0.7107 -0.8073 0.5294 -0.2274 'X-RAY DIFFRACTION' 3 ? refined 8.0600 19.7350 18.5610 0.1357 0.4002 0.1379 -0.0911 0.0288 0.0380 4.7631 2.1978 2.9983 2.3145 -0.6914 -0.1741 0.2107 -0.5491 0.0255 0.1815 -0.4404 0.1762 -0.2377 0.7722 0.2297 'X-RAY DIFFRACTION' 4 ? refined 19.7060 18.9930 8.8010 0.0905 0.2471 0.2351 -0.0181 0.0074 0.1179 3.1009 1.3255 2.9968 1.8937 -0.4768 0.0295 0.1125 -0.5317 -0.2698 -0.1184 -0.1985 -0.2925 -0.0988 0.1152 0.0860 'X-RAY DIFFRACTION' 5 ? refined 10.3330 14.8570 5.3310 0.1466 0.1802 0.1767 -0.0070 0.0141 0.0398 3.5334 8.0975 1.9688 2.7493 -2.2905 -0.0203 -0.1452 -0.0318 -0.2625 -0.1871 -0.1053 -0.1827 0.0344 -0.0375 0.2505 'X-RAY DIFFRACTION' 6 ? refined 11.3830 5.3400 15.7090 0.2259 0.3879 0.4733 -0.0505 0.0310 0.4282 9.1190 5.2815 26.2324 0.5141 -2.9926 -4.5675 -0.1402 -1.5718 -1.9338 0.1266 0.0009 -0.0498 1.4490 -0.3029 0.1393 'X-RAY DIFFRACTION' 7 ? refined 1.9900 14.1230 13.0600 0.0973 0.2312 0.3249 0.0014 0.0121 0.0068 6.3435 2.8936 4.9276 3.6393 -1.2723 -0.5997 -0.0730 -0.2035 -0.4136 -0.1641 -0.2987 0.2708 -0.1339 0.1537 0.3717 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 4 ? ? A 10 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 11 ? ? A 23 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 24 ? ? A 53 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 54 ? ? A 73 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 74 ? ? A 83 ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 84 ? ? A 95 ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 96 ? ? A 103 ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A THR 2 ? A THR 5 6 1 Y 1 A SER 3 ? A SER 6 7 1 Y 1 A CYS 104 ? A CYS 107 8 1 Y 1 A ALA 105 ? A ALA 108 9 1 Y 1 A ASP 106 ? A ASP 109 10 1 Y 1 P ARG 1 ? B ARG 1 11 1 Y 1 P ASN 9 ? B ASN 9 12 1 Y 1 P ARG 10 ? B ARG 10 13 1 Y 1 Q ARG 1 ? C ARG 1 14 1 Y 1 Q LEU 8 ? C LEU 8 15 1 Y 1 Q ASN 9 ? C ASN 9 16 1 Y 1 Q ARG 10 ? C ARG 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 PTR N N N N 290 PTR CA C N S 291 PTR C C N N 292 PTR O O N N 293 PTR OXT O N N 294 PTR CB C N N 295 PTR CG C Y N 296 PTR CD1 C Y N 297 PTR CD2 C Y N 298 PTR CE1 C Y N 299 PTR CE2 C Y N 300 PTR CZ C Y N 301 PTR OH O N N 302 PTR P P N N 303 PTR O1P O N N 304 PTR O2P O N N 305 PTR O3P O N N 306 PTR H H N N 307 PTR H2 H N N 308 PTR HA H N N 309 PTR HXT H N N 310 PTR HB2 H N N 311 PTR HB3 H N N 312 PTR HD1 H N N 313 PTR HD2 H N N 314 PTR HE1 H N N 315 PTR HE2 H N N 316 PTR HO2P H N N 317 PTR HO3P H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 PTR N CA sing N N 277 PTR N H sing N N 278 PTR N H2 sing N N 279 PTR CA C sing N N 280 PTR CA CB sing N N 281 PTR CA HA sing N N 282 PTR C O doub N N 283 PTR C OXT sing N N 284 PTR OXT HXT sing N N 285 PTR CB CG sing N N 286 PTR CB HB2 sing N N 287 PTR CB HB3 sing N N 288 PTR CG CD1 doub Y N 289 PTR CG CD2 sing Y N 290 PTR CD1 CE1 sing Y N 291 PTR CD1 HD1 sing N N 292 PTR CD2 CE2 doub Y N 293 PTR CD2 HD2 sing N N 294 PTR CE1 CZ doub Y N 295 PTR CE1 HE1 sing N N 296 PTR CE2 CZ sing Y N 297 PTR CE2 HE2 sing N N 298 PTR CZ OH sing N N 299 PTR OH P sing N N 300 PTR P O1P doub N N 301 PTR P O2P sing N N 302 PTR P O3P sing N N 303 PTR O2P HO2P sing N N 304 PTR O3P HO3P sing N N 305 SER N CA sing N N 306 SER N H sing N N 307 SER N H2 sing N N 308 SER CA C sing N N 309 SER CA CB sing N N 310 SER CA HA sing N N 311 SER C O doub N N 312 SER C OXT sing N N 313 SER CB OG sing N N 314 SER CB HB2 sing N N 315 SER CB HB3 sing N N 316 SER OG HG sing N N 317 SER OXT HXT sing N N 318 THR N CA sing N N 319 THR N H sing N N 320 THR N H2 sing N N 321 THR CA C sing N N 322 THR CA CB sing N N 323 THR CA HA sing N N 324 THR C O doub N N 325 THR C OXT sing N N 326 THR CB OG1 sing N N 327 THR CB CG2 sing N N 328 THR CB HB sing N N 329 THR OG1 HG1 sing N N 330 THR CG2 HG21 sing N N 331 THR CG2 HG22 sing N N 332 THR CG2 HG23 sing N N 333 THR OXT HXT sing N N 334 TRP N CA sing N N 335 TRP N H sing N N 336 TRP N H2 sing N N 337 TRP CA C sing N N 338 TRP CA CB sing N N 339 TRP CA HA sing N N 340 TRP C O doub N N 341 TRP C OXT sing N N 342 TRP CB CG sing N N 343 TRP CB HB2 sing N N 344 TRP CB HB3 sing N N 345 TRP CG CD1 doub Y N 346 TRP CG CD2 sing Y N 347 TRP CD1 NE1 sing Y N 348 TRP CD1 HD1 sing N N 349 TRP CD2 CE2 doub Y N 350 TRP CD2 CE3 sing Y N 351 TRP NE1 CE2 sing Y N 352 TRP NE1 HE1 sing N N 353 TRP CE2 CZ2 sing Y N 354 TRP CE3 CZ3 doub Y N 355 TRP CE3 HE3 sing N N 356 TRP CZ2 CH2 doub Y N 357 TRP CZ2 HZ2 sing N N 358 TRP CZ3 CH2 sing Y N 359 TRP CZ3 HZ3 sing N N 360 TRP CH2 HH2 sing N N 361 TRP OXT HXT sing N N 362 TYR N CA sing N N 363 TYR N H sing N N 364 TYR N H2 sing N N 365 TYR CA C sing N N 366 TYR CA CB sing N N 367 TYR CA HA sing N N 368 TYR C O doub N N 369 TYR C OXT sing N N 370 TYR CB CG sing N N 371 TYR CB HB2 sing N N 372 TYR CB HB3 sing N N 373 TYR CG CD1 doub Y N 374 TYR CG CD2 sing Y N 375 TYR CD1 CE1 sing Y N 376 TYR CD1 HD1 sing N N 377 TYR CD2 CE2 doub Y N 378 TYR CD2 HD2 sing N N 379 TYR CE1 CZ doub Y N 380 TYR CE1 HE1 sing N N 381 TYR CE2 CZ sing Y N 382 TYR CE2 HE2 sing N N 383 TYR CZ OH sing N N 384 TYR OH HH sing N N 385 TYR OXT HXT sing N N 386 VAL N CA sing N N 387 VAL N H sing N N 388 VAL N H2 sing N N 389 VAL CA C sing N N 390 VAL CA CB sing N N 391 VAL CA HA sing N N 392 VAL C O doub N N 393 VAL C OXT sing N N 394 VAL CB CG1 sing N N 395 VAL CB CG2 sing N N 396 VAL CB HB sing N N 397 VAL CG1 HG11 sing N N 398 VAL CG1 HG12 sing N N 399 VAL CG1 HG13 sing N N 400 VAL CG2 HG21 sing N N 401 VAL CG2 HG22 sing N N 402 VAL CG2 HG23 sing N N 403 VAL OXT HXT sing N N 404 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1AYD _pdbx_initial_refinement_model.details 'PDB entry 1AYD' # _atom_sites.entry_id 3TKZ _atom_sites.fract_transf_matrix[1][1] 0.015907 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015907 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013276 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_