data_3TMO # _entry.id 3TMO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3TMO pdb_00003tmo 10.2210/pdb3tmo/pdb RCSB RCSB067663 ? ? WWPDB D_1000067663 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-01-11 2 'Structure model' 1 1 2012-02-29 3 'Structure model' 1 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3TMO _pdbx_database_status.recvd_initial_deposition_date 2011-08-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3TMP _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yin, J.' 1 'Bosanac, I.' 2 'Ma, X.' 3 'Hymowitz, S.' 4 'Starovasnik, M.' 5 'Cochran, A.' 6 # _citation.id primary _citation.title 'Phosphorylation-dependent activity of the deubiquitinase DUBA.' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 19 _citation.page_first 171 _citation.page_last 175 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22245969 _citation.pdbx_database_id_DOI 10.1038/nsmb.2206 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, O.W.' 1 ? primary 'Ma, X.' 2 ? primary 'Yin, J.' 3 ? primary 'Flinders, J.' 4 ? primary 'Maurer, T.' 5 ? primary 'Kayagaki, N.' 6 ? primary 'Phung, Q.' 7 ? primary 'Bosanac, I.' 8 ? primary 'Arnott, D.' 9 ? primary 'Dixit, V.M.' 10 ? primary 'Hymowitz, S.G.' 11 ? primary 'Starovasnik, M.A.' 12 ? primary 'Cochran, A.G.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'OTU domain-containing protein 5' 21598.607 1 3.4.19.12 3.4.19.12 'catalytic or OTU domain (Residues 172-351)' ? 2 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Deubiquitinating enzyme A, DUBA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSH(MSE)GAGYNSEDEYEAAAARIEA(MSE)DPATVEQQEHWFEKALRDKKGFIIKQ(MSE)KEDGACLFRAVADQVYG DQD(MSE)HEVVRKHC(MSE)DYL(MSE)KNADYFSNYVTEDFTTYINRKRKNNCHGNHIE(MSE)QA(MSE)AE(MSE) YNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHC MDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRV SYHRNIHYNSVVNPNKATIGVGLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MSE n 1 5 GLY n 1 6 ALA n 1 7 GLY n 1 8 TYR n 1 9 ASN n 1 10 SER n 1 11 GLU n 1 12 ASP n 1 13 GLU n 1 14 TYR n 1 15 GLU n 1 16 ALA n 1 17 ALA n 1 18 ALA n 1 19 ALA n 1 20 ARG n 1 21 ILE n 1 22 GLU n 1 23 ALA n 1 24 MSE n 1 25 ASP n 1 26 PRO n 1 27 ALA n 1 28 THR n 1 29 VAL n 1 30 GLU n 1 31 GLN n 1 32 GLN n 1 33 GLU n 1 34 HIS n 1 35 TRP n 1 36 PHE n 1 37 GLU n 1 38 LYS n 1 39 ALA n 1 40 LEU n 1 41 ARG n 1 42 ASP n 1 43 LYS n 1 44 LYS n 1 45 GLY n 1 46 PHE n 1 47 ILE n 1 48 ILE n 1 49 LYS n 1 50 GLN n 1 51 MSE n 1 52 LYS n 1 53 GLU n 1 54 ASP n 1 55 GLY n 1 56 ALA n 1 57 CYS n 1 58 LEU n 1 59 PHE n 1 60 ARG n 1 61 ALA n 1 62 VAL n 1 63 ALA n 1 64 ASP n 1 65 GLN n 1 66 VAL n 1 67 TYR n 1 68 GLY n 1 69 ASP n 1 70 GLN n 1 71 ASP n 1 72 MSE n 1 73 HIS n 1 74 GLU n 1 75 VAL n 1 76 VAL n 1 77 ARG n 1 78 LYS n 1 79 HIS n 1 80 CYS n 1 81 MSE n 1 82 ASP n 1 83 TYR n 1 84 LEU n 1 85 MSE n 1 86 LYS n 1 87 ASN n 1 88 ALA n 1 89 ASP n 1 90 TYR n 1 91 PHE n 1 92 SER n 1 93 ASN n 1 94 TYR n 1 95 VAL n 1 96 THR n 1 97 GLU n 1 98 ASP n 1 99 PHE n 1 100 THR n 1 101 THR n 1 102 TYR n 1 103 ILE n 1 104 ASN n 1 105 ARG n 1 106 LYS n 1 107 ARG n 1 108 LYS n 1 109 ASN n 1 110 ASN n 1 111 CYS n 1 112 HIS n 1 113 GLY n 1 114 ASN n 1 115 HIS n 1 116 ILE n 1 117 GLU n 1 118 MSE n 1 119 GLN n 1 120 ALA n 1 121 MSE n 1 122 ALA n 1 123 GLU n 1 124 MSE n 1 125 TYR n 1 126 ASN n 1 127 ARG n 1 128 PRO n 1 129 VAL n 1 130 GLU n 1 131 VAL n 1 132 TYR n 1 133 GLN n 1 134 TYR n 1 135 SER n 1 136 THR n 1 137 GLY n 1 138 THR n 1 139 SER n 1 140 ALA n 1 141 VAL n 1 142 GLU n 1 143 PRO n 1 144 ILE n 1 145 ASN n 1 146 THR n 1 147 PHE n 1 148 HIS n 1 149 GLY n 1 150 ILE n 1 151 HIS n 1 152 GLN n 1 153 ASN n 1 154 GLU n 1 155 ASP n 1 156 GLU n 1 157 PRO n 1 158 ILE n 1 159 ARG n 1 160 VAL n 1 161 SER n 1 162 TYR n 1 163 HIS n 1 164 ARG n 1 165 ASN n 1 166 ILE n 1 167 HIS n 1 168 TYR n 1 169 ASN n 1 170 SER n 1 171 VAL n 1 172 VAL n 1 173 ASN n 1 174 PRO n 1 175 ASN n 1 176 LYS n 1 177 ALA n 1 178 THR n 1 179 ILE n 1 180 GLY n 1 181 VAL n 1 182 GLY n 1 183 LEU n 1 184 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DUBA, OTUD5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus (DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 168 ? ? ? A . n A 1 2 SER 2 169 ? ? ? A . n A 1 3 HIS 3 170 ? ? ? A . n A 1 4 MSE 4 171 ? ? ? A . n A 1 5 GLY 5 172 ? ? ? A . n A 1 6 ALA 6 173 ? ? ? A . n A 1 7 GLY 7 174 ? ? ? A . n A 1 8 TYR 8 175 ? ? ? A . n A 1 9 ASN 9 176 ? ? ? A . n A 1 10 SER 10 177 ? ? ? A . n A 1 11 GLU 11 178 ? ? ? A . n A 1 12 ASP 12 179 ? ? ? A . n A 1 13 GLU 13 180 ? ? ? A . n A 1 14 TYR 14 181 ? ? ? A . n A 1 15 GLU 15 182 ? ? ? A . n A 1 16 ALA 16 183 ? ? ? A . n A 1 17 ALA 17 184 ? ? ? A . n A 1 18 ALA 18 185 185 ALA ALA A . n A 1 19 ALA 19 186 186 ALA ALA A . n A 1 20 ARG 20 187 187 ARG ARG A . n A 1 21 ILE 21 188 188 ILE ILE A . n A 1 22 GLU 22 189 189 GLU GLU A . n A 1 23 ALA 23 190 190 ALA ALA A . n A 1 24 MSE 24 191 191 MSE MSE A . n A 1 25 ASP 25 192 192 ASP ASP A . n A 1 26 PRO 26 193 193 PRO PRO A . n A 1 27 ALA 27 194 194 ALA ALA A . n A 1 28 THR 28 195 195 THR THR A . n A 1 29 VAL 29 196 196 VAL VAL A . n A 1 30 GLU 30 197 197 GLU GLU A . n A 1 31 GLN 31 198 198 GLN GLN A . n A 1 32 GLN 32 199 199 GLN GLN A . n A 1 33 GLU 33 200 200 GLU GLU A . n A 1 34 HIS 34 201 201 HIS HIS A . n A 1 35 TRP 35 202 202 TRP TRP A . n A 1 36 PHE 36 203 203 PHE PHE A . n A 1 37 GLU 37 204 204 GLU GLU A . n A 1 38 LYS 38 205 205 LYS LYS A . n A 1 39 ALA 39 206 206 ALA ALA A . n A 1 40 LEU 40 207 207 LEU LEU A . n A 1 41 ARG 41 208 208 ARG ARG A . n A 1 42 ASP 42 209 209 ASP ASP A . n A 1 43 LYS 43 210 210 LYS LYS A . n A 1 44 LYS 44 211 211 LYS LYS A . n A 1 45 GLY 45 212 212 GLY GLY A . n A 1 46 PHE 46 213 213 PHE PHE A . n A 1 47 ILE 47 214 214 ILE ILE A . n A 1 48 ILE 48 215 215 ILE ILE A . n A 1 49 LYS 49 216 216 LYS LYS A . n A 1 50 GLN 50 217 217 GLN GLN A . n A 1 51 MSE 51 218 218 MSE MSE A . n A 1 52 LYS 52 219 219 LYS LYS A . n A 1 53 GLU 53 220 220 GLU GLU A . n A 1 54 ASP 54 221 221 ASP ASP A . n A 1 55 GLY 55 222 222 GLY GLY A . n A 1 56 ALA 56 223 223 ALA ALA A . n A 1 57 CYS 57 224 224 CYS CYS A . n A 1 58 LEU 58 225 225 LEU LEU A . n A 1 59 PHE 59 226 226 PHE PHE A . n A 1 60 ARG 60 227 227 ARG ARG A . n A 1 61 ALA 61 228 228 ALA ALA A . n A 1 62 VAL 62 229 229 VAL VAL A . n A 1 63 ALA 63 230 230 ALA ALA A . n A 1 64 ASP 64 231 231 ASP ASP A . n A 1 65 GLN 65 232 232 GLN GLN A . n A 1 66 VAL 66 233 233 VAL VAL A . n A 1 67 TYR 67 234 234 TYR TYR A . n A 1 68 GLY 68 235 235 GLY GLY A . n A 1 69 ASP 69 236 236 ASP ASP A . n A 1 70 GLN 70 237 237 GLN GLN A . n A 1 71 ASP 71 238 238 ASP ASP A . n A 1 72 MSE 72 239 239 MSE MSE A . n A 1 73 HIS 73 240 240 HIS HIS A . n A 1 74 GLU 74 241 241 GLU GLU A . n A 1 75 VAL 75 242 242 VAL VAL A . n A 1 76 VAL 76 243 243 VAL VAL A . n A 1 77 ARG 77 244 244 ARG ARG A . n A 1 78 LYS 78 245 245 LYS LYS A . n A 1 79 HIS 79 246 246 HIS HIS A . n A 1 80 CYS 80 247 247 CYS CYS A . n A 1 81 MSE 81 248 248 MSE MSE A . n A 1 82 ASP 82 249 249 ASP ASP A . n A 1 83 TYR 83 250 250 TYR TYR A . n A 1 84 LEU 84 251 251 LEU LEU A . n A 1 85 MSE 85 252 252 MSE MSE A . n A 1 86 LYS 86 253 253 LYS LYS A . n A 1 87 ASN 87 254 254 ASN ASN A . n A 1 88 ALA 88 255 255 ALA ALA A . n A 1 89 ASP 89 256 256 ASP ASP A . n A 1 90 TYR 90 257 257 TYR TYR A . n A 1 91 PHE 91 258 258 PHE PHE A . n A 1 92 SER 92 259 259 SER SER A . n A 1 93 ASN 93 260 260 ASN ASN A . n A 1 94 TYR 94 261 261 TYR TYR A . n A 1 95 VAL 95 262 ? ? ? A . n A 1 96 THR 96 263 ? ? ? A . n A 1 97 GLU 97 264 ? ? ? A . n A 1 98 ASP 98 265 ? ? ? A . n A 1 99 PHE 99 266 ? ? ? A . n A 1 100 THR 100 267 ? ? ? A . n A 1 101 THR 101 268 ? ? ? A . n A 1 102 TYR 102 269 ? ? ? A . n A 1 103 ILE 103 270 ? ? ? A . n A 1 104 ASN 104 271 ? ? ? A . n A 1 105 ARG 105 272 ? ? ? A . n A 1 106 LYS 106 273 ? ? ? A . n A 1 107 ARG 107 274 ? ? ? A . n A 1 108 LYS 108 275 ? ? ? A . n A 1 109 ASN 109 276 ? ? ? A . n A 1 110 ASN 110 277 ? ? ? A . n A 1 111 CYS 111 278 ? ? ? A . n A 1 112 HIS 112 279 279 HIS HIS A . n A 1 113 GLY 113 280 280 GLY GLY A . n A 1 114 ASN 114 281 281 ASN ASN A . n A 1 115 HIS 115 282 282 HIS HIS A . n A 1 116 ILE 116 283 283 ILE ILE A . n A 1 117 GLU 117 284 284 GLU GLU A . n A 1 118 MSE 118 285 285 MSE MSE A . n A 1 119 GLN 119 286 286 GLN GLN A . n A 1 120 ALA 120 287 287 ALA ALA A . n A 1 121 MSE 121 288 288 MSE MSE A . n A 1 122 ALA 122 289 289 ALA ALA A . n A 1 123 GLU 123 290 290 GLU GLU A . n A 1 124 MSE 124 291 291 MSE MSE A . n A 1 125 TYR 125 292 292 TYR TYR A . n A 1 126 ASN 126 293 293 ASN ASN A . n A 1 127 ARG 127 294 294 ARG ARG A . n A 1 128 PRO 128 295 295 PRO PRO A . n A 1 129 VAL 129 296 296 VAL VAL A . n A 1 130 GLU 130 297 297 GLU GLU A . n A 1 131 VAL 131 298 298 VAL VAL A . n A 1 132 TYR 132 299 299 TYR TYR A . n A 1 133 GLN 133 300 300 GLN GLN A . n A 1 134 TYR 134 301 301 TYR TYR A . n A 1 135 SER 135 302 302 SER SER A . n A 1 136 THR 136 303 303 THR THR A . n A 1 137 GLY 137 304 304 GLY GLY A . n A 1 138 THR 138 305 305 THR THR A . n A 1 139 SER 139 306 306 SER SER A . n A 1 140 ALA 140 307 307 ALA ALA A . n A 1 141 VAL 141 308 308 VAL VAL A . n A 1 142 GLU 142 309 309 GLU GLU A . n A 1 143 PRO 143 310 310 PRO PRO A . n A 1 144 ILE 144 311 311 ILE ILE A . n A 1 145 ASN 145 312 312 ASN ASN A . n A 1 146 THR 146 313 313 THR THR A . n A 1 147 PHE 147 314 314 PHE PHE A . n A 1 148 HIS 148 315 315 HIS HIS A . n A 1 149 GLY 149 316 316 GLY GLY A . n A 1 150 ILE 150 317 317 ILE ILE A . n A 1 151 HIS 151 318 318 HIS HIS A . n A 1 152 GLN 152 319 319 GLN GLN A . n A 1 153 ASN 153 320 320 ASN ASN A . n A 1 154 GLU 154 321 321 GLU GLU A . n A 1 155 ASP 155 322 322 ASP ASP A . n A 1 156 GLU 156 323 323 GLU GLU A . n A 1 157 PRO 157 324 324 PRO PRO A . n A 1 158 ILE 158 325 325 ILE ILE A . n A 1 159 ARG 159 326 326 ARG ARG A . n A 1 160 VAL 160 327 327 VAL VAL A . n A 1 161 SER 161 328 328 SER SER A . n A 1 162 TYR 162 329 329 TYR TYR A . n A 1 163 HIS 163 330 330 HIS HIS A . n A 1 164 ARG 164 331 331 ARG ARG A . n A 1 165 ASN 165 332 332 ASN ASN A . n A 1 166 ILE 166 333 333 ILE ILE A . n A 1 167 HIS 167 334 334 HIS HIS A . n A 1 168 TYR 168 335 335 TYR TYR A . n A 1 169 ASN 169 336 336 ASN ASN A . n A 1 170 SER 170 337 337 SER SER A . n A 1 171 VAL 171 338 338 VAL VAL A . n A 1 172 VAL 172 339 339 VAL VAL A . n A 1 173 ASN 173 340 340 ASN ASN A . n A 1 174 PRO 174 341 341 PRO PRO A . n A 1 175 ASN 175 342 342 ASN ASN A . n A 1 176 LYS 176 343 ? ? ? A . n A 1 177 ALA 177 344 ? ? ? A . n A 1 178 THR 178 345 ? ? ? A . n A 1 179 ILE 179 346 ? ? ? A . n A 1 180 GLY 180 347 ? ? ? A . n A 1 181 VAL 181 348 ? ? ? A . n A 1 182 GLY 182 349 ? ? ? A . n A 1 183 LEU 183 350 ? ? ? A . n A 1 184 GLY 184 351 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1 1 HOH HOH A . B 2 HOH 2 2 2 HOH HOH A . B 2 HOH 3 3 3 HOH HOH A . B 2 HOH 4 4 4 HOH HOH A . B 2 HOH 5 5 5 HOH HOH A . B 2 HOH 6 6 6 HOH HOH A . B 2 HOH 7 7 7 HOH HOH A . B 2 HOH 8 8 8 HOH HOH A . B 2 HOH 9 9 9 HOH HOH A . B 2 HOH 10 10 10 HOH HOH A . B 2 HOH 11 11 11 HOH HOH A . B 2 HOH 12 12 12 HOH HOH A . B 2 HOH 13 13 13 HOH HOH A . B 2 HOH 14 14 14 HOH HOH A . B 2 HOH 15 15 15 HOH HOH A . B 2 HOH 16 16 16 HOH HOH A . B 2 HOH 17 17 17 HOH HOH A . B 2 HOH 18 18 18 HOH HOH A . B 2 HOH 19 19 19 HOH HOH A . B 2 HOH 20 20 20 HOH HOH A . B 2 HOH 21 21 21 HOH HOH A . B 2 HOH 22 22 22 HOH HOH A . B 2 HOH 23 23 23 HOH HOH A . B 2 HOH 24 24 24 HOH HOH A . B 2 HOH 25 25 25 HOH HOH A . B 2 HOH 26 26 26 HOH HOH A . B 2 HOH 27 27 27 HOH HOH A . B 2 HOH 28 28 28 HOH HOH A . B 2 HOH 29 29 29 HOH HOH A . B 2 HOH 30 30 30 HOH HOH A . B 2 HOH 31 31 31 HOH HOH A . B 2 HOH 32 32 32 HOH HOH A . B 2 HOH 33 33 33 HOH HOH A . B 2 HOH 34 34 34 HOH HOH A . B 2 HOH 35 35 35 HOH HOH A . B 2 HOH 36 36 36 HOH HOH A . B 2 HOH 37 37 37 HOH HOH A . B 2 HOH 38 38 38 HOH HOH A . B 2 HOH 39 39 39 HOH HOH A . B 2 HOH 40 40 40 HOH HOH A . B 2 HOH 41 41 41 HOH HOH A . B 2 HOH 42 42 42 HOH HOH A . B 2 HOH 43 43 43 HOH HOH A . B 2 HOH 44 44 44 HOH HOH A . B 2 HOH 45 45 45 HOH HOH A . B 2 HOH 46 46 46 HOH HOH A . B 2 HOH 47 47 47 HOH HOH A . B 2 HOH 48 48 48 HOH HOH A . B 2 HOH 49 49 49 HOH HOH A . B 2 HOH 50 50 50 HOH HOH A . B 2 HOH 51 51 51 HOH HOH A . B 2 HOH 52 52 52 HOH HOH A . B 2 HOH 53 53 53 HOH HOH A . B 2 HOH 54 54 54 HOH HOH A . B 2 HOH 55 57 57 HOH HOH A . B 2 HOH 56 58 58 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHENIX 'model building' . ? 2 REFMAC refinement 5.5.0109 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 PHENIX phasing . ? 6 # _cell.entry_id 3TMO _cell.length_a 66.658 _cell.length_b 66.658 _cell.length_c 82.218 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3TMO _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 _symmetry.space_group_name_Hall ? # _exptl.entry_id 3TMO _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.44 _exptl_crystal.density_percent_sol 49.62 _exptl_crystal.description 'THE STRUCTURE FACTOR FILE CONTAINS FRIEDEL PAIRS' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '0.8 M succinic acid, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2008-10-07 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'a high resolution Si(311) cut and a lower resolution Si(111)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9798 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9798 # _reflns.entry_id 3TMO _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 2.15 _reflns.number_obs 21875 _reflns.number_all 22276 _reflns.percent_possible_obs 98.2 _reflns.pdbx_Rsym_value 0.062 _reflns.pdbx_netI_over_sigmaI 19.9 _reflns.B_iso_Wilson_estimate 44.7 _reflns.pdbx_redundancy 4.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.15 _reflns_shell.d_res_low 2.23 _reflns_shell.percent_possible_all 83.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.425 _reflns_shell.meanI_over_sigI_obs 3.0 _reflns_shell.pdbx_redundancy 4.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1866 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3TMO _refine.ls_number_reflns_obs 10073 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 28.86 _refine.ls_d_res_high 2.20 _refine.ls_percent_reflns_obs 99.73 _refine.ls_R_factor_obs 0.24459 _refine.ls_R_factor_R_work 0.24308 _refine.ls_R_factor_R_free 0.27615 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 503 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.925 _refine.correlation_coeff_Fo_to_Fc_free 0.915 _refine.B_iso_mean 43.351 _refine.aniso_B[1][1] 0.37 _refine.aniso_B[2][2] 0.37 _refine.aniso_B[3][3] -0.55 _refine.aniso_B[1][2] 0.18 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] -0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.214 _refine.overall_SU_ML 0.163 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 6.184 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.ls_R_factor_all ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1157 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 1213 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 28.86 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.010 0.021 ? 1185 ? 'X-RAY DIFFRACTION' r_bond_other_d ? ? ? ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.011 1.909 ? 1599 ? 'X-RAY DIFFRACTION' r_angle_other_deg ? ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 5.165 5.000 ? 139 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 33.357 24.571 ? 70 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 15.434 15.000 ? 200 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 10.701 15.000 ? 7 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.079 0.200 ? 161 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.004 0.021 ? 938 ? 'X-RAY DIFFRACTION' r_gen_planes_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it 0.797 1.500 ? 702 ? 'X-RAY DIFFRACTION' r_mcbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_it 1.539 2.000 ? 1130 ? 'X-RAY DIFFRACTION' r_scbond_it 2.105 3.000 ? 483 ? 'X-RAY DIFFRACTION' r_scangle_it 3.472 4.500 ? 469 ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.200 _refine_ls_shell.d_res_low 2.257 _refine_ls_shell.number_reflns_R_work 756 _refine_ls_shell.R_factor_R_work 0.287 _refine_ls_shell.percent_reflns_obs 99.87 _refine_ls_shell.R_factor_R_free 0.387 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 39 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 3TMO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 3TMO _struct.title 'The catalytic domain of human deubiquitinase DUBA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3TMO _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'OTU fold, Deubiquitinase, phosphorylation, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OTUD5_HUMAN _struct_ref.pdbx_db_accession Q96G74 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYL MKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHR NIHYNSVVNPNKATIGVGLG ; _struct_ref.pdbx_align_begin 172 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3TMO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 184 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96G74 _struct_ref_seq.db_align_beg 172 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 351 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 172 _struct_ref_seq.pdbx_auth_seq_align_end 351 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3TMO GLY A 1 ? UNP Q96G74 ? ? 'expression tag' 168 1 1 3TMO SER A 2 ? UNP Q96G74 ? ? 'expression tag' 169 2 1 3TMO HIS A 3 ? UNP Q96G74 ? ? 'expression tag' 170 3 1 3TMO MSE A 4 ? UNP Q96G74 ? ? 'expression tag' 171 4 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 5250 ? 2 MORE -21 ? 2 'SSA (A^2)' 15150 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2 A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 33.3290000000 0.0000000000 -1.0000000000 0.0000000000 57.7275213655 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 18 ? ASP A 25 ? ALA A 185 ASP A 192 1 ? 8 HELX_P HELX_P2 2 ASP A 25 ? GLY A 45 ? ASP A 192 GLY A 212 1 ? 21 HELX_P HELX_P3 3 LEU A 58 ? GLY A 68 ? LEU A 225 GLY A 235 1 ? 11 HELX_P HELX_P4 4 ASP A 69 ? ASP A 71 ? ASP A 236 ASP A 238 5 ? 3 HELX_P HELX_P5 5 MSE A 72 ? ASN A 87 ? MSE A 239 ASN A 254 1 ? 16 HELX_P HELX_P6 6 ASN A 87 ? SER A 92 ? ASN A 254 SER A 259 1 ? 6 HELX_P HELX_P7 7 GLY A 113 ? TYR A 125 ? GLY A 280 TYR A 292 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 23 C ? ? ? 1_555 A MSE 24 N ? ? A ALA 190 A MSE 191 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale2 covale both ? A MSE 24 C ? ? ? 1_555 A ASP 25 N ? ? A MSE 191 A ASP 192 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? A GLN 50 C ? ? ? 1_555 A MSE 51 N ? ? A GLN 217 A MSE 218 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale4 covale both ? A MSE 51 C ? ? ? 1_555 A LYS 52 N ? ? A MSE 218 A LYS 219 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale5 covale both ? A ASP 71 C ? ? ? 1_555 A MSE 72 N ? ? A ASP 238 A MSE 239 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale6 covale both ? A MSE 72 C ? ? ? 1_555 A HIS 73 N ? ? A MSE 239 A HIS 240 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale7 covale both ? A CYS 80 C ? ? ? 1_555 A MSE 81 N ? ? A CYS 247 A MSE 248 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? A MSE 81 C ? ? ? 1_555 A ASP 82 N ? ? A MSE 248 A ASP 249 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale9 covale both ? A LEU 84 C ? ? ? 1_555 A MSE 85 N ? ? A LEU 251 A MSE 252 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale10 covale both ? A MSE 85 C ? ? ? 1_555 A LYS 86 N ? ? A MSE 252 A LYS 253 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale11 covale both ? A GLU 117 C ? ? ? 1_555 A MSE 118 N ? ? A GLU 284 A MSE 285 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale12 covale both ? A MSE 118 C ? ? ? 1_555 A GLN 119 N ? ? A MSE 285 A GLN 286 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale13 covale both ? A ALA 120 C ? ? ? 1_555 A MSE 121 N ? ? A ALA 287 A MSE 288 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale14 covale both ? A MSE 121 C ? ? ? 1_555 A ALA 122 N ? ? A MSE 288 A ALA 289 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale15 covale both ? A GLU 123 C ? ? ? 1_555 A MSE 124 N ? ? A GLU 290 A MSE 291 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale16 covale both ? A MSE 124 C ? ? ? 1_555 A TYR 125 N ? ? A MSE 291 A TYR 292 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 24 ? . . . . MSE A 191 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 51 ? . . . . MSE A 218 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 72 ? . . . . MSE A 239 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 81 ? . . . . MSE A 248 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 85 ? . . . . MSE A 252 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 118 ? . . . . MSE A 285 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE A 121 ? . . . . MSE A 288 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 8 MSE A 124 ? . . . . MSE A 291 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 145 ? PHE A 147 ? ASN A 312 PHE A 314 A 2 VAL A 129 ? GLN A 133 ? VAL A 296 GLN A 300 A 3 ILE A 158 ? TYR A 162 ? ILE A 325 TYR A 329 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 147 ? O PHE A 314 N VAL A 129 ? N VAL A 296 A 2 3 N GLU A 130 ? N GLU A 297 O ILE A 158 ? O ILE A 325 # _pdbx_entry_details.entry_id 3TMO _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 224 ? ? O A HOH 58 ? ? 1.88 2 1 O A TYR 261 ? ? O A HOH 32 ? ? 1.94 3 1 O A HOH 24 ? ? O A HOH 42 ? ? 2.10 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 306 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 40.89 _pdbx_validate_torsion.psi 81.26 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 24 A MSE 191 ? MET SELENOMETHIONINE 2 A MSE 51 A MSE 218 ? MET SELENOMETHIONINE 3 A MSE 72 A MSE 239 ? MET SELENOMETHIONINE 4 A MSE 81 A MSE 248 ? MET SELENOMETHIONINE 5 A MSE 85 A MSE 252 ? MET SELENOMETHIONINE 6 A MSE 118 A MSE 285 ? MET SELENOMETHIONINE 7 A MSE 121 A MSE 288 ? MET SELENOMETHIONINE 8 A MSE 124 A MSE 291 ? MET SELENOMETHIONINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 168 ? A GLY 1 2 1 Y 1 A SER 169 ? A SER 2 3 1 Y 1 A HIS 170 ? A HIS 3 4 1 Y 1 A MSE 171 ? A MSE 4 5 1 Y 1 A GLY 172 ? A GLY 5 6 1 Y 1 A ALA 173 ? A ALA 6 7 1 Y 1 A GLY 174 ? A GLY 7 8 1 Y 1 A TYR 175 ? A TYR 8 9 1 Y 1 A ASN 176 ? A ASN 9 10 1 Y 1 A SER 177 ? A SER 10 11 1 Y 1 A GLU 178 ? A GLU 11 12 1 Y 1 A ASP 179 ? A ASP 12 13 1 Y 1 A GLU 180 ? A GLU 13 14 1 Y 1 A TYR 181 ? A TYR 14 15 1 Y 1 A GLU 182 ? A GLU 15 16 1 Y 1 A ALA 183 ? A ALA 16 17 1 Y 1 A ALA 184 ? A ALA 17 18 1 Y 1 A VAL 262 ? A VAL 95 19 1 Y 1 A THR 263 ? A THR 96 20 1 Y 1 A GLU 264 ? A GLU 97 21 1 Y 1 A ASP 265 ? A ASP 98 22 1 Y 1 A PHE 266 ? A PHE 99 23 1 Y 1 A THR 267 ? A THR 100 24 1 Y 1 A THR 268 ? A THR 101 25 1 Y 1 A TYR 269 ? A TYR 102 26 1 Y 1 A ILE 270 ? A ILE 103 27 1 Y 1 A ASN 271 ? A ASN 104 28 1 Y 1 A ARG 272 ? A ARG 105 29 1 Y 1 A LYS 273 ? A LYS 106 30 1 Y 1 A ARG 274 ? A ARG 107 31 1 Y 1 A LYS 275 ? A LYS 108 32 1 Y 1 A ASN 276 ? A ASN 109 33 1 Y 1 A ASN 277 ? A ASN 110 34 1 Y 1 A CYS 278 ? A CYS 111 35 1 Y 1 A LYS 343 ? A LYS 176 36 1 Y 1 A ALA 344 ? A ALA 177 37 1 Y 1 A THR 345 ? A THR 178 38 1 Y 1 A ILE 346 ? A ILE 179 39 1 Y 1 A GLY 347 ? A GLY 180 40 1 Y 1 A VAL 348 ? A VAL 181 41 1 Y 1 A GLY 349 ? A GLY 182 42 1 Y 1 A LEU 350 ? A LEU 183 43 1 Y 1 A GLY 351 ? A GLY 184 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _atom_sites.entry_id 3TMO _atom_sites.fract_transf_matrix[1][1] 0.015002 _atom_sites.fract_transf_matrix[1][2] 0.008661 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017323 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012163 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ #