data_3TXT # _entry.id 3TXT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3TXT RCSB RCSB068054 WWPDB D_1000068054 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3TXT _pdbx_database_status.recvd_initial_deposition_date 2011-09-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xue, Y.' 1 'Ha, Y.' 2 # _citation.id primary _citation.title 'The crystal structure of rhomboid protease GlpG in complex with a mechanism-based inhibitor' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xue, Y.' 1 ? primary 'Ha, Y.' 2 ? # _cell.entry_id 3TXT _cell.length_a 109.667 _cell.length_b 109.667 _cell.length_c 125.097 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3TXT _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Rhomboid protease glpG' 20214.020 1 3.4.21.105 ? 'UNP residues 92-270' ? 2 non-polymer syn 'DIISOPROPYL PHOSPHONATE' 166.155 1 ? ? ? ? 3 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Intramembrane serine protease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGS GKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMAN GAHIAGLAVGLAMAFVDSL ; _entity_poly.pdbx_seq_one_letter_code_can ;RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGS GKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMAN GAHIAGLAVGLAMAFVDSL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 ALA n 1 3 GLY n 1 4 PRO n 1 5 VAL n 1 6 THR n 1 7 TRP n 1 8 VAL n 1 9 MET n 1 10 MET n 1 11 ILE n 1 12 ALA n 1 13 CYS n 1 14 VAL n 1 15 VAL n 1 16 VAL n 1 17 PHE n 1 18 ILE n 1 19 ALA n 1 20 MET n 1 21 GLN n 1 22 ILE n 1 23 LEU n 1 24 GLY n 1 25 ASP n 1 26 GLN n 1 27 GLU n 1 28 VAL n 1 29 MET n 1 30 LEU n 1 31 TRP n 1 32 LEU n 1 33 ALA n 1 34 TRP n 1 35 PRO n 1 36 PHE n 1 37 ASP n 1 38 PRO n 1 39 THR n 1 40 LEU n 1 41 LYS n 1 42 PHE n 1 43 GLU n 1 44 PHE n 1 45 TRP n 1 46 ARG n 1 47 TYR n 1 48 PHE n 1 49 THR n 1 50 HIS n 1 51 ALA n 1 52 LEU n 1 53 MET n 1 54 HIS n 1 55 PHE n 1 56 SER n 1 57 LEU n 1 58 MET n 1 59 HIS n 1 60 ILE n 1 61 LEU n 1 62 PHE n 1 63 ASN n 1 64 LEU n 1 65 LEU n 1 66 TRP n 1 67 TRP n 1 68 TRP n 1 69 TYR n 1 70 LEU n 1 71 GLY n 1 72 GLY n 1 73 ALA n 1 74 VAL n 1 75 GLU n 1 76 LYS n 1 77 ARG n 1 78 LEU n 1 79 GLY n 1 80 SER n 1 81 GLY n 1 82 LYS n 1 83 LEU n 1 84 ILE n 1 85 VAL n 1 86 ILE n 1 87 THR n 1 88 LEU n 1 89 ILE n 1 90 SER n 1 91 ALA n 1 92 LEU n 1 93 LEU n 1 94 SER n 1 95 GLY n 1 96 TYR n 1 97 VAL n 1 98 GLN n 1 99 GLN n 1 100 LYS n 1 101 PHE n 1 102 SER n 1 103 GLY n 1 104 PRO n 1 105 TRP n 1 106 PHE n 1 107 GLY n 1 108 GLY n 1 109 LEU n 1 110 SER n 1 111 GLY n 1 112 VAL n 1 113 VAL n 1 114 TYR n 1 115 ALA n 1 116 LEU n 1 117 MET n 1 118 GLY n 1 119 TYR n 1 120 VAL n 1 121 TRP n 1 122 LEU n 1 123 ARG n 1 124 GLY n 1 125 GLU n 1 126 ARG n 1 127 ASP n 1 128 PRO n 1 129 GLN n 1 130 SER n 1 131 GLY n 1 132 ILE n 1 133 TYR n 1 134 LEU n 1 135 GLN n 1 136 ARG n 1 137 GLY n 1 138 LEU n 1 139 ILE n 1 140 ILE n 1 141 PHE n 1 142 ALA n 1 143 LEU n 1 144 ILE n 1 145 TRP n 1 146 ILE n 1 147 VAL n 1 148 ALA n 1 149 GLY n 1 150 TRP n 1 151 PHE n 1 152 ASP n 1 153 LEU n 1 154 PHE n 1 155 GLY n 1 156 MET n 1 157 SER n 1 158 MET n 1 159 ALA n 1 160 ASN n 1 161 GLY n 1 162 ALA n 1 163 HIS n 1 164 ILE n 1 165 ALA n 1 166 GLY n 1 167 LEU n 1 168 ALA n 1 169 VAL n 1 170 GLY n 1 171 LEU n 1 172 ALA n 1 173 MET n 1 174 ALA n 1 175 PHE n 1 176 VAL n 1 177 ASP n 1 178 SER n 1 179 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'glpG, b3424, JW5687' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLPG_ECOLI _struct_ref.pdbx_db_accession P09391 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGS GKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMAN GAHIAGLAVGLAMAFVDSL ; _struct_ref.pdbx_align_begin 92 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3TXT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09391 _struct_ref_seq.db_align_beg 92 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 270 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 92 _struct_ref_seq.pdbx_auth_seq_align_end 270 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DFP non-polymer . 'DIISOPROPYL PHOSPHONATE' ? 'C6 H15 O3 P' 166.155 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3TXT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.58 _exptl_crystal.density_percent_sol 65.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pdbx_details '3M NaCl, 0.1 M bis-tris propane, pH7, VAPOR DIFFUSION, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 2011-01-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.54 # _reflns.entry_id 3TXT _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 40 _reflns.d_resolution_high 2.3 _reflns.number_obs 12996 _reflns.number_all ? _reflns.percent_possible_obs 99 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 3TXT _refine.ls_number_reflns_obs 12988 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 23.327 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 99.28 _refine.ls_R_factor_obs 0.2199 _refine.ls_R_factor_R_work 0.2188 _refine.ls_R_factor_R_free 0.2384 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.88 _refine.ls_number_reflns_R_free 634 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -14.3685 _refine.aniso_B[2][2] -14.3685 _refine.aniso_B[3][3] 28.7370 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.400 _refine.solvent_model_param_bsol 79.262 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.95 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.35 _refine.pdbx_overall_phase_error 26.69 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.ls_R_factor_all ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1389 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1422 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 23.327 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.007 ? ? 1447 ? 'X-RAY DIFFRACTION' f_angle_d 0.985 ? ? 1969 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 17.072 ? ? 481 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.066 ? ? 213 ? 'X-RAY DIFFRACTION' f_plane_restr 0.004 ? ? 232 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.30 2.4749 2375 0.2607 97.00 0.2654 . . 132 . . . . 'X-RAY DIFFRACTION' . 2.4749 2.7236 2452 0.2180 100.00 0.2729 . . 136 . . . . 'X-RAY DIFFRACTION' . 2.7236 3.1169 2481 0.2123 100.00 0.2846 . . 120 . . . . 'X-RAY DIFFRACTION' . 3.1169 3.9239 2481 0.1996 100.00 0.2320 . . 133 . . . . 'X-RAY DIFFRACTION' . 3.9239 23.3283 2565 0.2254 99.00 0.2185 . . 113 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 3TXT _struct.title 'Crystal structure of GlpG in complex with inhibitor DFP' _struct.pdbx_descriptor 'Rhomboid protease glpG (E.C.3.4.21.105)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3TXT _struct_keywords.pdbx_keywords HYDROLASE/INHIBITOR _struct_keywords.text 'serine protease, intramembrane protease, membrane, HYDROLASE-INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 3 ? GLY A 24 ? GLY A 94 GLY A 115 1 ? 22 HELX_P HELX_P2 2 GLY A 24 ? ALA A 33 ? GLY A 115 ALA A 124 1 ? 10 HELX_P HELX_P3 3 ASP A 37 ? LYS A 41 ? ASP A 128 LYS A 132 5 ? 5 HELX_P HELX_P4 4 TRP A 45 ? HIS A 50 ? TRP A 136 HIS A 141 1 ? 6 HELX_P HELX_P5 5 ALA A 51 ? MET A 53 ? ALA A 142 MET A 144 5 ? 3 HELX_P HELX_P6 6 SER A 56 ? GLY A 79 ? SER A 147 GLY A 170 1 ? 24 HELX_P HELX_P7 7 GLY A 79 ? GLY A 103 ? GLY A 170 GLY A 194 1 ? 25 HELX_P HELX_P8 8 LEU A 109 ? ASP A 127 ? LEU A 200 ASP A 218 1 ? 19 HELX_P HELX_P9 9 PRO A 128 ? GLY A 131 ? PRO A 219 GLY A 222 5 ? 4 HELX_P HELX_P10 10 GLN A 135 ? PHE A 151 ? GLN A 226 PHE A 242 1 ? 17 HELX_P HELX_P11 11 ALA A 159 ? LEU A 179 ? ALA A 250 LEU A 270 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 110 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id DFP _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id P _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 201 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id DFP _struct_conn.ptnr2_auth_seq_id 1 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.629 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE DFP A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 HIS A 59 ? HIS A 150 . ? 1_555 ? 2 AC1 7 ASN A 63 ? ASN A 154 . ? 1_555 ? 3 AC1 7 GLY A 107 ? GLY A 198 . ? 1_555 ? 4 AC1 7 GLY A 108 ? GLY A 199 . ? 1_555 ? 5 AC1 7 LEU A 109 ? LEU A 200 . ? 1_555 ? 6 AC1 7 SER A 110 ? SER A 201 . ? 1_555 ? 7 AC1 7 TYR A 114 ? TYR A 205 . ? 1_555 ? # _database_PDB_matrix.entry_id 3TXT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3TXT _atom_sites.fract_transf_matrix[1][1] 0.009119 _atom_sites.fract_transf_matrix[1][2] 0.005265 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010529 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007994 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 92 92 ARG ARG A . n A 1 2 ALA 2 93 93 ALA ALA A . n A 1 3 GLY 3 94 94 GLY GLY A . n A 1 4 PRO 4 95 95 PRO PRO A . n A 1 5 VAL 5 96 96 VAL VAL A . n A 1 6 THR 6 97 97 THR THR A . n A 1 7 TRP 7 98 98 TRP TRP A . n A 1 8 VAL 8 99 99 VAL VAL A . n A 1 9 MET 9 100 100 MET MET A . n A 1 10 MET 10 101 101 MET MET A . n A 1 11 ILE 11 102 102 ILE ILE A . n A 1 12 ALA 12 103 103 ALA ALA A . n A 1 13 CYS 13 104 104 CYS CYS A . n A 1 14 VAL 14 105 105 VAL VAL A . n A 1 15 VAL 15 106 106 VAL VAL A . n A 1 16 VAL 16 107 107 VAL VAL A . n A 1 17 PHE 17 108 108 PHE PHE A . n A 1 18 ILE 18 109 109 ILE ILE A . n A 1 19 ALA 19 110 110 ALA ALA A . n A 1 20 MET 20 111 111 MET MET A . n A 1 21 GLN 21 112 112 GLN GLN A . n A 1 22 ILE 22 113 113 ILE ILE A . n A 1 23 LEU 23 114 114 LEU LEU A . n A 1 24 GLY 24 115 115 GLY GLY A . n A 1 25 ASP 25 116 116 ASP ASP A . n A 1 26 GLN 26 117 117 GLN GLN A . n A 1 27 GLU 27 118 118 GLU GLU A . n A 1 28 VAL 28 119 119 VAL VAL A . n A 1 29 MET 29 120 120 MET MET A . n A 1 30 LEU 30 121 121 LEU LEU A . n A 1 31 TRP 31 122 122 TRP TRP A . n A 1 32 LEU 32 123 123 LEU LEU A . n A 1 33 ALA 33 124 124 ALA ALA A . n A 1 34 TRP 34 125 125 TRP TRP A . n A 1 35 PRO 35 126 126 PRO PRO A . n A 1 36 PHE 36 127 127 PHE PHE A . n A 1 37 ASP 37 128 128 ASP ASP A . n A 1 38 PRO 38 129 129 PRO PRO A . n A 1 39 THR 39 130 130 THR THR A . n A 1 40 LEU 40 131 131 LEU LEU A . n A 1 41 LYS 41 132 132 LYS LYS A . n A 1 42 PHE 42 133 133 PHE PHE A . n A 1 43 GLU 43 134 134 GLU GLU A . n A 1 44 PHE 44 135 135 PHE PHE A . n A 1 45 TRP 45 136 136 TRP TRP A . n A 1 46 ARG 46 137 137 ARG ARG A . n A 1 47 TYR 47 138 138 TYR TYR A . n A 1 48 PHE 48 139 139 PHE PHE A . n A 1 49 THR 49 140 140 THR THR A . n A 1 50 HIS 50 141 141 HIS HIS A . n A 1 51 ALA 51 142 142 ALA ALA A . n A 1 52 LEU 52 143 143 LEU LEU A . n A 1 53 MET 53 144 144 MET MET A . n A 1 54 HIS 54 145 145 HIS HIS A . n A 1 55 PHE 55 146 146 PHE PHE A . n A 1 56 SER 56 147 147 SER SER A . n A 1 57 LEU 57 148 148 LEU LEU A . n A 1 58 MET 58 149 149 MET MET A . n A 1 59 HIS 59 150 150 HIS HIS A . n A 1 60 ILE 60 151 151 ILE ILE A . n A 1 61 LEU 61 152 152 LEU LEU A . n A 1 62 PHE 62 153 153 PHE PHE A . n A 1 63 ASN 63 154 154 ASN ASN A . n A 1 64 LEU 64 155 155 LEU LEU A . n A 1 65 LEU 65 156 156 LEU LEU A . n A 1 66 TRP 66 157 157 TRP TRP A . n A 1 67 TRP 67 158 158 TRP TRP A . n A 1 68 TRP 68 159 159 TRP TRP A . n A 1 69 TYR 69 160 160 TYR TYR A . n A 1 70 LEU 70 161 161 LEU LEU A . n A 1 71 GLY 71 162 162 GLY GLY A . n A 1 72 GLY 72 163 163 GLY GLY A . n A 1 73 ALA 73 164 164 ALA ALA A . n A 1 74 VAL 74 165 165 VAL VAL A . n A 1 75 GLU 75 166 166 GLU GLU A . n A 1 76 LYS 76 167 167 LYS LYS A . n A 1 77 ARG 77 168 168 ARG ARG A . n A 1 78 LEU 78 169 169 LEU LEU A . n A 1 79 GLY 79 170 170 GLY GLY A . n A 1 80 SER 80 171 171 SER SER A . n A 1 81 GLY 81 172 172 GLY GLY A . n A 1 82 LYS 82 173 173 LYS LYS A . n A 1 83 LEU 83 174 174 LEU LEU A . n A 1 84 ILE 84 175 175 ILE ILE A . n A 1 85 VAL 85 176 176 VAL VAL A . n A 1 86 ILE 86 177 177 ILE ILE A . n A 1 87 THR 87 178 178 THR THR A . n A 1 88 LEU 88 179 179 LEU LEU A . n A 1 89 ILE 89 180 180 ILE ILE A . n A 1 90 SER 90 181 181 SER SER A . n A 1 91 ALA 91 182 182 ALA ALA A . n A 1 92 LEU 92 183 183 LEU LEU A . n A 1 93 LEU 93 184 184 LEU LEU A . n A 1 94 SER 94 185 185 SER SER A . n A 1 95 GLY 95 186 186 GLY GLY A . n A 1 96 TYR 96 187 187 TYR TYR A . n A 1 97 VAL 97 188 188 VAL VAL A . n A 1 98 GLN 98 189 189 GLN GLN A . n A 1 99 GLN 99 190 190 GLN GLN A . n A 1 100 LYS 100 191 191 LYS LYS A . n A 1 101 PHE 101 192 192 PHE PHE A . n A 1 102 SER 102 193 193 SER SER A . n A 1 103 GLY 103 194 194 GLY GLY A . n A 1 104 PRO 104 195 195 PRO PRO A . n A 1 105 TRP 105 196 196 TRP TRP A . n A 1 106 PHE 106 197 197 PHE PHE A . n A 1 107 GLY 107 198 198 GLY GLY A . n A 1 108 GLY 108 199 199 GLY GLY A . n A 1 109 LEU 109 200 200 LEU LEU A . n A 1 110 SER 110 201 201 SER SER A . n A 1 111 GLY 111 202 202 GLY GLY A . n A 1 112 VAL 112 203 203 VAL VAL A . n A 1 113 VAL 113 204 204 VAL VAL A . n A 1 114 TYR 114 205 205 TYR TYR A . n A 1 115 ALA 115 206 206 ALA ALA A . n A 1 116 LEU 116 207 207 LEU LEU A . n A 1 117 MET 117 208 208 MET MET A . n A 1 118 GLY 118 209 209 GLY GLY A . n A 1 119 TYR 119 210 210 TYR TYR A . n A 1 120 VAL 120 211 211 VAL VAL A . n A 1 121 TRP 121 212 212 TRP TRP A . n A 1 122 LEU 122 213 213 LEU LEU A . n A 1 123 ARG 123 214 214 ARG ARG A . n A 1 124 GLY 124 215 215 GLY GLY A . n A 1 125 GLU 125 216 216 GLU GLU A . n A 1 126 ARG 126 217 217 ARG ARG A . n A 1 127 ASP 127 218 218 ASP ASP A . n A 1 128 PRO 128 219 219 PRO PRO A . n A 1 129 GLN 129 220 220 GLN GLN A . n A 1 130 SER 130 221 221 SER SER A . n A 1 131 GLY 131 222 222 GLY GLY A . n A 1 132 ILE 132 223 223 ILE ILE A . n A 1 133 TYR 133 224 224 TYR TYR A . n A 1 134 LEU 134 225 225 LEU LEU A . n A 1 135 GLN 135 226 226 GLN GLN A . n A 1 136 ARG 136 227 227 ARG ARG A . n A 1 137 GLY 137 228 228 GLY GLY A . n A 1 138 LEU 138 229 229 LEU LEU A . n A 1 139 ILE 139 230 230 ILE ILE A . n A 1 140 ILE 140 231 231 ILE ILE A . n A 1 141 PHE 141 232 232 PHE PHE A . n A 1 142 ALA 142 233 233 ALA ALA A . n A 1 143 LEU 143 234 234 LEU LEU A . n A 1 144 ILE 144 235 235 ILE ILE A . n A 1 145 TRP 145 236 236 TRP TRP A . n A 1 146 ILE 146 237 237 ILE ILE A . n A 1 147 VAL 147 238 238 VAL VAL A . n A 1 148 ALA 148 239 239 ALA ALA A . n A 1 149 GLY 149 240 240 GLY GLY A . n A 1 150 TRP 150 241 241 TRP TRP A . n A 1 151 PHE 151 242 242 PHE PHE A . n A 1 152 ASP 152 243 243 ASP ASP A . n A 1 153 LEU 153 244 244 LEU LEU A . n A 1 154 PHE 154 245 ? ? ? A . n A 1 155 GLY 155 246 ? ? ? A . n A 1 156 MET 156 247 ? ? ? A . n A 1 157 SER 157 248 ? ? ? A . n A 1 158 MET 158 249 249 MET MET A . n A 1 159 ALA 159 250 250 ALA ALA A . n A 1 160 ASN 160 251 251 ASN ASN A . n A 1 161 GLY 161 252 252 GLY GLY A . n A 1 162 ALA 162 253 253 ALA ALA A . n A 1 163 HIS 163 254 254 HIS HIS A . n A 1 164 ILE 164 255 255 ILE ILE A . n A 1 165 ALA 165 256 256 ALA ALA A . n A 1 166 GLY 166 257 257 GLY GLY A . n A 1 167 LEU 167 258 258 LEU LEU A . n A 1 168 ALA 168 259 259 ALA ALA A . n A 1 169 VAL 169 260 260 VAL VAL A . n A 1 170 GLY 170 261 261 GLY GLY A . n A 1 171 LEU 171 262 262 LEU LEU A . n A 1 172 ALA 172 263 263 ALA ALA A . n A 1 173 MET 173 264 264 MET MET A . n A 1 174 ALA 174 265 265 ALA ALA A . n A 1 175 PHE 175 266 266 PHE PHE A . n A 1 176 VAL 176 267 267 VAL VAL A . n A 1 177 ASP 177 268 268 ASP ASP A . n A 1 178 SER 178 269 269 SER SER A . n A 1 179 LEU 179 270 270 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DFP 1 1 1 DFP DFP A . C 3 HOH 1 2 2 HOH HOH A . C 3 HOH 2 3 3 HOH HOH A . C 3 HOH 3 4 4 HOH HOH A . C 3 HOH 4 5 5 HOH HOH A . C 3 HOH 5 6 6 HOH HOH A . C 3 HOH 6 7 7 HOH HOH A . C 3 HOH 7 8 8 HOH HOH A . C 3 HOH 8 9 9 HOH HOH A . C 3 HOH 9 10 10 HOH HOH A . C 3 HOH 10 11 11 HOH HOH A . C 3 HOH 11 12 12 HOH HOH A . C 3 HOH 12 13 13 HOH HOH A . C 3 HOH 13 14 14 HOH HOH A . C 3 HOH 14 15 15 HOH HOH A . C 3 HOH 15 16 16 HOH HOH A . C 3 HOH 16 17 17 HOH HOH A . C 3 HOH 17 18 18 HOH HOH A . C 3 HOH 18 19 19 HOH HOH A . C 3 HOH 19 20 20 HOH HOH A . C 3 HOH 20 21 21 HOH HOH A . C 3 HOH 21 22 22 HOH HOH A . C 3 HOH 22 23 23 HOH HOH A . C 3 HOH 23 271 1 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5850 ? 1 MORE -44 ? 1 'SSA (A^2)' 22710 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 54.8335000000 0.8660254038 -0.5000000000 0.0000000000 94.9744079568 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -54.8335000000 -0.8660254038 -0.5000000000 0.0000000000 94.9744079568 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-12-07 2 'Structure model' 1 1 2019-07-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.classification' 2 2 'Structure model' '_software.name' 3 2 'Structure model' '_software.version' 4 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(phenix.refine: 1.7.1_743)' ? 1 REFMAC refinement . ? 2 CrystalClear 'data collection' . ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 REFMAC phasing . ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 5 ? ? O A HOH 19 ? ? 1.98 2 1 O A THR 130 ? ? O A HOH 6 ? ? 2.01 3 1 O A ASP 218 ? ? OG A SER 221 ? ? 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 125 ? ? -39.18 134.91 2 1 GLN A 220 ? ? -58.27 5.33 3 1 ASP A 243 ? ? 39.26 49.68 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 167 ? CG ? A LYS 76 CG 2 1 Y 1 A LYS 167 ? CD ? A LYS 76 CD 3 1 Y 1 A LYS 167 ? CE ? A LYS 76 CE 4 1 Y 1 A LYS 167 ? NZ ? A LYS 76 NZ 5 1 Y 1 A GLN 220 ? CG ? A GLN 129 CG 6 1 Y 1 A GLN 220 ? CD ? A GLN 129 CD 7 1 Y 1 A GLN 220 ? OE1 ? A GLN 129 OE1 8 1 Y 1 A GLN 220 ? NE2 ? A GLN 129 NE2 9 1 Y 1 A ASP 243 ? CG ? A ASP 152 CG 10 1 Y 1 A ASP 243 ? OD1 ? A ASP 152 OD1 11 1 Y 1 A ASP 243 ? OD2 ? A ASP 152 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PHE 245 ? A PHE 154 2 1 Y 1 A GLY 246 ? A GLY 155 3 1 Y 1 A MET 247 ? A MET 156 4 1 Y 1 A SER 248 ? A SER 157 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DIISOPROPYL PHOSPHONATE' DFP 3 water HOH #