data_3UL3 # _entry.id 3UL3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3UL3 RCSB RCSB068889 WWPDB D_1000068889 # _pdbx_database_status.entry_id 3UL3 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-11-10 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sharma, A.' 1 'Sharma, A.' 2 'Dixit, S.' 3 'Sharma, A.' 4 # _citation.id primary _citation.title 'Structural insights into thioredoxin-2: a component of malaria parasite protein secretion machinery.' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 1 _citation.page_first 179 _citation.page_last 179 _citation.year 2011 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22355694 _citation.pdbx_database_id_DOI 10.1038/srep00179 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sharma, A.' 1 ? primary 'Sharma, A.' 2 ? primary 'Dixit, S.' 3 ? primary 'Sharma, A.' 4 ? # _cell.length_a 87.046 _cell.length_b 87.046 _cell.length_c 90.904 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 3UL3 _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.entry_id 3UL3 _symmetry.Int_Tables_number 154 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Thioredoxin 15033.751 2 ? ? 'UNP residues 29-156' ? 2 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Thioredoxin-2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;STNDDPLTPLNRFDKYYLRMFKKVPRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKV DLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKH ; _entity_poly.pdbx_seq_one_letter_code_can ;STNDDPLTPLNRFDKYYLRMFKKVPRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKV DLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKH ; _entity_poly.pdbx_strand_id B,A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 ASN n 1 4 ASP n 1 5 ASP n 1 6 PRO n 1 7 LEU n 1 8 THR n 1 9 PRO n 1 10 LEU n 1 11 ASN n 1 12 ARG n 1 13 PHE n 1 14 ASP n 1 15 LYS n 1 16 TYR n 1 17 TYR n 1 18 LEU n 1 19 ARG n 1 20 MET n 1 21 PHE n 1 22 LYS n 1 23 LYS n 1 24 VAL n 1 25 PRO n 1 26 ARG n 1 27 LEU n 1 28 GLN n 1 29 GLN n 1 30 ASN n 1 31 GLY n 1 32 SER n 1 33 ASN n 1 34 ILE n 1 35 ILE n 1 36 ASN n 1 37 GLY n 1 38 VAL n 1 39 ASN n 1 40 MET n 1 41 LYS n 1 42 ASN n 1 43 THR n 1 44 VAL n 1 45 ILE n 1 46 VAL n 1 47 LEU n 1 48 TYR n 1 49 PHE n 1 50 PHE n 1 51 ALA n 1 52 LYS n 1 53 TRP n 1 54 CYS n 1 55 GLN n 1 56 ALA n 1 57 CYS n 1 58 THR n 1 59 MET n 1 60 GLN n 1 61 SER n 1 62 THR n 1 63 GLU n 1 64 MET n 1 65 ASP n 1 66 LYS n 1 67 LEU n 1 68 GLN n 1 69 LYS n 1 70 TYR n 1 71 TYR n 1 72 GLY n 1 73 LYS n 1 74 ARG n 1 75 ILE n 1 76 TYR n 1 77 LEU n 1 78 LEU n 1 79 LYS n 1 80 VAL n 1 81 ASP n 1 82 LEU n 1 83 ASP n 1 84 LYS n 1 85 ASN n 1 86 GLU n 1 87 SER n 1 88 LEU n 1 89 ALA n 1 90 ARG n 1 91 LYS n 1 92 PHE n 1 93 SER n 1 94 VAL n 1 95 LYS n 1 96 SER n 1 97 LEU n 1 98 PRO n 1 99 THR n 1 100 ILE n 1 101 ILE n 1 102 LEU n 1 103 LEU n 1 104 LYS n 1 105 ASN n 1 106 LYS n 1 107 THR n 1 108 MET n 1 109 LEU n 1 110 ALA n 1 111 ARG n 1 112 LYS n 1 113 ASP n 1 114 HIS n 1 115 PHE n 1 116 VAL n 1 117 SER n 1 118 SER n 1 119 ASN n 1 120 ASP n 1 121 LEU n 1 122 ILE n 1 123 ALA n 1 124 LEU n 1 125 ILE n 1 126 LYS n 1 127 LYS n 1 128 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAL13P1.225, trx2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 3D7 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36329 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Lemo21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX4T1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8IDP4_PLAF7 _struct_ref.pdbx_db_accession Q8IDP4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;STNDDPLTPLNRFDKYYLRMFKKVPRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKV DLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKH ; _struct_ref.pdbx_align_begin 29 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3UL3 B 1 ? 128 ? Q8IDP4 29 ? 156 ? 29 156 2 1 3UL3 A 1 ? 128 ? Q8IDP4 29 ? 156 ? 29 156 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 3 _exptl.entry_id 3UL3 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity 0.364 _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 3.31 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 62.80 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.125M Bis-tris pH 5.5, 2.2M ammonium sulfate, 5mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2010-12-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.07 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.07 _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 # _reflns.entry_id 3UL3 _reflns.d_resolution_high 2.900 _reflns.d_resolution_low 100.000 _reflns.number_obs 8947 _reflns.pdbx_Rmerge_I_obs 0.040 _reflns.pdbx_netI_over_sigmaI 15.100 _reflns.pdbx_chi_squared 0.933 _reflns.pdbx_redundancy 3.700 _reflns.percent_possible_obs 98.200 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.900 3.000 ? ? ? ? 0.366 ? ? 0.745 3.700 ? ? ? 877 ? ? ? ? 99.100 ? ? 1 1 3.000 3.120 ? ? ? ? 0.245 ? ? 0.816 3.700 ? ? ? 900 ? ? ? ? 99.200 ? ? 2 1 3.120 3.270 ? ? ? ? 0.164 ? ? 0.795 3.700 ? ? ? 867 ? ? ? ? 98.300 ? ? 3 1 3.270 3.440 ? ? ? ? 0.104 ? ? 0.849 3.700 ? ? ? 886 ? ? ? ? 99.200 ? ? 4 1 3.440 3.650 ? ? ? ? 0.062 ? ? 0.837 3.700 ? ? ? 888 ? ? ? ? 98.700 ? ? 5 1 3.650 3.940 ? ? ? ? 0.048 ? ? 1.000 3.700 ? ? ? 909 ? ? ? ? 99.000 ? ? 6 1 3.940 4.330 ? ? ? ? 0.045 ? ? 1.312 3.700 ? ? ? 883 ? ? ? ? 98.300 ? ? 7 1 4.330 4.960 ? ? ? ? 0.037 ? ? 1.398 3.700 ? ? ? 894 ? ? ? ? 98.700 ? ? 8 1 4.960 6.250 ? ? ? ? 0.027 ? ? 0.891 3.600 ? ? ? 911 ? ? ? ? 97.400 ? ? 9 1 6.250 100.000 ? ? ? ? 0.018 ? ? 0.688 3.500 ? ? ? 932 ? ? ? ? 94.300 ? ? 10 1 # _refine.entry_id 3UL3 _refine.ls_d_res_high 2.9050 _refine.ls_d_res_low 39.2560 _refine.pdbx_ls_sigma_F 0.140 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 94.6700 _refine.ls_number_reflns_obs 8635 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2612 _refine.ls_R_factor_R_work 0.2571 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2976 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 10.0900 _refine.ls_number_reflns_R_free 871 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 90.2451 _refine.solvent_model_param_bsol 110.7300 _refine.solvent_model_param_ksol 0.3610 _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.3982 _refine.aniso_B[2][2] 0.3982 _refine.aniso_B[3][3] -0.7964 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.8000 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 0.5000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.1600 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIRAS _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 173.450 _refine.B_iso_min 20.000 _refine.pdbx_overall_phase_error 30.6900 _refine.occupancy_max 1.000 _refine.occupancy_min 0.500 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1591 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1621 _refine_hist.d_res_high 2.9050 _refine_hist.d_res_low 39.2560 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 1624 0.025 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2173 1.688 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 246 0.121 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 266 0.007 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 609 23.275 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.redundancy_reflns_obs 2.9051 3.0871 6 88.0000 1175 . 0.3675 0.3640 . 131 . 1306 . 'X-RAY DIFFRACTION' . 3.0871 3.3253 6 93.0000 1243 . 0.3390 0.3764 . 143 . 1386 . 'X-RAY DIFFRACTION' . 3.3253 3.6597 6 96.0000 1292 . 0.3078 0.3585 . 141 . 1433 . 'X-RAY DIFFRACTION' . 3.6597 4.1888 6 97.0000 1346 . 0.2352 0.2930 . 144 . 1490 . 'X-RAY DIFFRACTION' . 4.1888 5.2754 6 98.0000 1317 . 0.2038 0.2440 . 152 . 1469 . 'X-RAY DIFFRACTION' . 5.2754 39.2592 6 96.0000 1391 . 0.2503 0.2860 . 160 . 1551 . 'X-RAY DIFFRACTION' . # _struct.entry_id 3UL3 _struct.title 'Structural insights into thioredoxin-2: a component of malaria parasite protein secretion machinery' _struct.pdbx_descriptor Thioredoxin _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3UL3 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'thioredoxin, PTEX, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 54 ? GLY A 72 ? CYS B 82 GLY B 100 1 ? 19 HELX_P HELX_P2 2 ASN A 85 ? PHE A 92 ? ASN B 113 PHE B 120 1 ? 8 HELX_P HELX_P3 3 SER A 117 ? LYS A 126 ? SER B 145 LYS B 154 1 ? 10 HELX_P HELX_P4 4 CYS B 54 ? GLY B 72 ? CYS A 82 GLY A 100 1 ? 19 HELX_P HELX_P5 5 ASN B 85 ? PHE B 92 ? ASN A 113 PHE A 120 1 ? 8 HELX_P HELX_P6 6 SER B 117 ? HIS B 128 ? SER A 145 HIS A 156 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 97 A . ? LEU 125 B PRO 98 A ? PRO 126 B 1 -3.13 2 VAL 38 B . ? VAL 66 A ASN 39 B ? ASN 67 A 1 0.77 3 MET 40 B . ? MET 68 A LYS 41 B ? LYS 69 A 1 3.50 4 LEU 97 B . ? LEU 125 A PRO 98 B ? PRO 126 A 1 -2.27 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 75 ? ASP A 81 ? ILE B 103 ASP B 109 A 2 VAL A 44 ? PHE A 50 ? VAL B 72 PHE B 78 A 3 THR A 99 ? LYS A 104 ? THR B 127 LYS B 132 A 4 THR A 107 ? LYS A 112 ? THR B 135 LYS B 140 B 1 ILE B 75 ? ASP B 81 ? ILE A 103 ASP A 109 B 2 VAL B 44 ? PHE B 50 ? VAL A 72 PHE A 78 B 3 THR B 99 ? LYS B 104 ? THR A 127 LYS A 132 B 4 THR B 107 ? LYS B 112 ? THR A 135 LYS A 140 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 76 ? O TYR B 104 N VAL A 46 ? N VAL B 74 A 2 3 N PHE A 49 ? N PHE B 77 O THR A 99 ? O THR B 127 A 3 4 N LEU A 102 ? N LEU B 130 O LEU A 109 ? O LEU B 137 B 1 2 O TYR B 76 ? O TYR A 104 N VAL B 46 ? N VAL A 74 B 2 3 N LEU B 47 ? N LEU A 75 O ILE B 101 ? O ILE A 129 B 3 4 N ILE B 100 ? N ILE A 128 O LYS B 112 ? O LYS A 140 # _atom_sites.entry_id 3UL3 _atom_sites.fract_transf_matrix[1][1] 0.011488 _atom_sites.fract_transf_matrix[1][2] 0.006633 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013265 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011001 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 29 ? ? ? B . n A 1 2 THR 2 30 ? ? ? B . n A 1 3 ASN 3 31 ? ? ? B . n A 1 4 ASP 4 32 ? ? ? B . n A 1 5 ASP 5 33 ? ? ? B . n A 1 6 PRO 6 34 ? ? ? B . n A 1 7 LEU 7 35 ? ? ? B . n A 1 8 THR 8 36 ? ? ? B . n A 1 9 PRO 9 37 ? ? ? B . n A 1 10 LEU 10 38 ? ? ? B . n A 1 11 ASN 11 39 ? ? ? B . n A 1 12 ARG 12 40 ? ? ? B . n A 1 13 PHE 13 41 ? ? ? B . n A 1 14 ASP 14 42 ? ? ? B . n A 1 15 LYS 15 43 ? ? ? B . n A 1 16 TYR 16 44 ? ? ? B . n A 1 17 TYR 17 45 ? ? ? B . n A 1 18 LEU 18 46 ? ? ? B . n A 1 19 ARG 19 47 ? ? ? B . n A 1 20 MET 20 48 ? ? ? B . n A 1 21 PHE 21 49 ? ? ? B . n A 1 22 LYS 22 50 ? ? ? B . n A 1 23 LYS 23 51 ? ? ? B . n A 1 24 VAL 24 52 ? ? ? B . n A 1 25 PRO 25 53 ? ? ? B . n A 1 26 ARG 26 54 54 ARG ARG B . n A 1 27 LEU 27 55 55 LEU LEU B . n A 1 28 GLN 28 56 56 GLN GLN B . n A 1 29 GLN 29 57 57 GLN GLN B . n A 1 30 ASN 30 58 58 ASN ASN B . n A 1 31 GLY 31 59 59 GLY GLY B . n A 1 32 SER 32 60 60 SER SER B . n A 1 33 ASN 33 61 61 ASN ASN B . n A 1 34 ILE 34 62 62 ILE ILE B . n A 1 35 ILE 35 63 63 ILE ILE B . n A 1 36 ASN 36 64 64 ASN ASN B . n A 1 37 GLY 37 65 65 GLY GLY B . n A 1 38 VAL 38 66 66 VAL VAL B . n A 1 39 ASN 39 67 67 ASN ASN B . n A 1 40 MET 40 68 68 MET MET B . n A 1 41 LYS 41 69 69 LYS LYS B . n A 1 42 ASN 42 70 70 ASN ASN B . n A 1 43 THR 43 71 71 THR THR B . n A 1 44 VAL 44 72 72 VAL VAL B . n A 1 45 ILE 45 73 73 ILE ILE B . n A 1 46 VAL 46 74 74 VAL VAL B . n A 1 47 LEU 47 75 75 LEU LEU B . n A 1 48 TYR 48 76 76 TYR TYR B . n A 1 49 PHE 49 77 77 PHE PHE B . n A 1 50 PHE 50 78 78 PHE PHE B . n A 1 51 ALA 51 79 79 ALA ALA B . n A 1 52 LYS 52 80 80 LYS LYS B . n A 1 53 TRP 53 81 81 TRP TRP B . n A 1 54 CYS 54 82 82 CYS CYS B . n A 1 55 GLN 55 83 83 GLN GLN B . n A 1 56 ALA 56 84 84 ALA ALA B . n A 1 57 CYS 57 85 85 CYS CYS B . n A 1 58 THR 58 86 86 THR THR B . n A 1 59 MET 59 87 87 MET MET B . n A 1 60 GLN 60 88 88 GLN GLN B . n A 1 61 SER 61 89 89 SER SER B . n A 1 62 THR 62 90 90 THR THR B . n A 1 63 GLU 63 91 91 GLU GLU B . n A 1 64 MET 64 92 92 MET MET B . n A 1 65 ASP 65 93 93 ASP ASP B . n A 1 66 LYS 66 94 94 LYS LYS B . n A 1 67 LEU 67 95 95 LEU LEU B . n A 1 68 GLN 68 96 96 GLN GLN B . n A 1 69 LYS 69 97 97 LYS LYS B . n A 1 70 TYR 70 98 98 TYR TYR B . n A 1 71 TYR 71 99 99 TYR TYR B . n A 1 72 GLY 72 100 100 GLY GLY B . n A 1 73 LYS 73 101 101 LYS LYS B . n A 1 74 ARG 74 102 102 ARG ARG B . n A 1 75 ILE 75 103 103 ILE ILE B . n A 1 76 TYR 76 104 104 TYR TYR B . n A 1 77 LEU 77 105 105 LEU LEU B . n A 1 78 LEU 78 106 106 LEU LEU B . n A 1 79 LYS 79 107 107 LYS LYS B . n A 1 80 VAL 80 108 108 VAL VAL B . n A 1 81 ASP 81 109 109 ASP ASP B . n A 1 82 LEU 82 110 110 LEU LEU B . n A 1 83 ASP 83 111 111 ASP ASP B . n A 1 84 LYS 84 112 112 LYS LYS B . n A 1 85 ASN 85 113 113 ASN ASN B . n A 1 86 GLU 86 114 114 GLU GLU B . n A 1 87 SER 87 115 115 SER SER B . n A 1 88 LEU 88 116 116 LEU LEU B . n A 1 89 ALA 89 117 117 ALA ALA B . n A 1 90 ARG 90 118 118 ARG ARG B . n A 1 91 LYS 91 119 119 LYS LYS B . n A 1 92 PHE 92 120 120 PHE PHE B . n A 1 93 SER 93 121 121 SER SER B . n A 1 94 VAL 94 122 122 VAL VAL B . n A 1 95 LYS 95 123 123 LYS LYS B . n A 1 96 SER 96 124 124 SER SER B . n A 1 97 LEU 97 125 125 LEU LEU B . n A 1 98 PRO 98 126 126 PRO PRO B . n A 1 99 THR 99 127 127 THR THR B . n A 1 100 ILE 100 128 128 ILE ILE B . n A 1 101 ILE 101 129 129 ILE ILE B . n A 1 102 LEU 102 130 130 LEU LEU B . n A 1 103 LEU 103 131 131 LEU LEU B . n A 1 104 LYS 104 132 132 LYS LYS B . n A 1 105 ASN 105 133 133 ASN ASN B . n A 1 106 LYS 106 134 134 LYS LYS B . n A 1 107 THR 107 135 135 THR THR B . n A 1 108 MET 108 136 136 MET MET B . n A 1 109 LEU 109 137 137 LEU LEU B . n A 1 110 ALA 110 138 138 ALA ALA B . n A 1 111 ARG 111 139 139 ARG ARG B . n A 1 112 LYS 112 140 140 LYS LYS B . n A 1 113 ASP 113 141 141 ASP ASP B . n A 1 114 HIS 114 142 142 HIS HIS B . n A 1 115 PHE 115 143 143 PHE PHE B . n A 1 116 VAL 116 144 144 VAL VAL B . n A 1 117 SER 117 145 145 SER SER B . n A 1 118 SER 118 146 146 SER SER B . n A 1 119 ASN 119 147 147 ASN ASN B . n A 1 120 ASP 120 148 148 ASP ASP B . n A 1 121 LEU 121 149 149 LEU LEU B . n A 1 122 ILE 122 150 150 ILE ILE B . n A 1 123 ALA 123 151 151 ALA ALA B . n A 1 124 LEU 124 152 152 LEU LEU B . n A 1 125 ILE 125 153 153 ILE ILE B . n A 1 126 LYS 126 154 154 LYS LYS B . n A 1 127 LYS 127 155 155 LYS LYS B . n A 1 128 HIS 128 156 156 HIS HIS B . n B 1 1 SER 1 29 ? ? ? A . n B 1 2 THR 2 30 ? ? ? A . n B 1 3 ASN 3 31 ? ? ? A . n B 1 4 ASP 4 32 ? ? ? A . n B 1 5 ASP 5 33 ? ? ? A . n B 1 6 PRO 6 34 ? ? ? A . n B 1 7 LEU 7 35 ? ? ? A . n B 1 8 THR 8 36 ? ? ? A . n B 1 9 PRO 9 37 ? ? ? A . n B 1 10 LEU 10 38 ? ? ? A . n B 1 11 ASN 11 39 ? ? ? A . n B 1 12 ARG 12 40 ? ? ? A . n B 1 13 PHE 13 41 ? ? ? A . n B 1 14 ASP 14 42 ? ? ? A . n B 1 15 LYS 15 43 ? ? ? A . n B 1 16 TYR 16 44 ? ? ? A . n B 1 17 TYR 17 45 ? ? ? A . n B 1 18 LEU 18 46 ? ? ? A . n B 1 19 ARG 19 47 ? ? ? A . n B 1 20 MET 20 48 ? ? ? A . n B 1 21 PHE 21 49 ? ? ? A . n B 1 22 LYS 22 50 ? ? ? A . n B 1 23 LYS 23 51 ? ? ? A . n B 1 24 VAL 24 52 ? ? ? A . n B 1 25 PRO 25 53 ? ? ? A . n B 1 26 ARG 26 54 54 ARG ARG A . n B 1 27 LEU 27 55 55 LEU LEU A . n B 1 28 GLN 28 56 56 GLN GLN A . n B 1 29 GLN 29 57 57 GLN GLN A . n B 1 30 ASN 30 58 58 ASN ASN A . n B 1 31 GLY 31 59 59 GLY GLY A . n B 1 32 SER 32 60 60 SER SER A . n B 1 33 ASN 33 61 61 ASN ASN A . n B 1 34 ILE 34 62 62 ILE ILE A . n B 1 35 ILE 35 63 63 ILE ILE A . n B 1 36 ASN 36 64 64 ASN ASN A . n B 1 37 GLY 37 65 65 GLY GLY A . n B 1 38 VAL 38 66 66 VAL VAL A . n B 1 39 ASN 39 67 67 ASN ASN A . n B 1 40 MET 40 68 68 MET MET A . n B 1 41 LYS 41 69 69 LYS LYS A . n B 1 42 ASN 42 70 70 ASN ASN A . n B 1 43 THR 43 71 71 THR THR A . n B 1 44 VAL 44 72 72 VAL VAL A . n B 1 45 ILE 45 73 73 ILE ILE A . n B 1 46 VAL 46 74 74 VAL VAL A . n B 1 47 LEU 47 75 75 LEU LEU A . n B 1 48 TYR 48 76 76 TYR TYR A . n B 1 49 PHE 49 77 77 PHE PHE A . n B 1 50 PHE 50 78 78 PHE PHE A . n B 1 51 ALA 51 79 79 ALA ALA A . n B 1 52 LYS 52 80 80 LYS LYS A . n B 1 53 TRP 53 81 81 TRP TRP A . n B 1 54 CYS 54 82 82 CYS CYS A . n B 1 55 GLN 55 83 83 GLN GLN A . n B 1 56 ALA 56 84 84 ALA ALA A . n B 1 57 CYS 57 85 85 CYS CYS A . n B 1 58 THR 58 86 86 THR THR A . n B 1 59 MET 59 87 87 MET MET A . n B 1 60 GLN 60 88 88 GLN GLN A . n B 1 61 SER 61 89 89 SER SER A . n B 1 62 THR 62 90 90 THR THR A . n B 1 63 GLU 63 91 91 GLU GLU A . n B 1 64 MET 64 92 92 MET MET A . n B 1 65 ASP 65 93 93 ASP ASP A . n B 1 66 LYS 66 94 94 LYS LYS A . n B 1 67 LEU 67 95 95 LEU LEU A . n B 1 68 GLN 68 96 96 GLN GLN A . n B 1 69 LYS 69 97 97 LYS LYS A . n B 1 70 TYR 70 98 98 TYR TYR A . n B 1 71 TYR 71 99 99 TYR TYR A . n B 1 72 GLY 72 100 100 GLY GLY A . n B 1 73 LYS 73 101 101 LYS LYS A . n B 1 74 ARG 74 102 102 ARG ARG A . n B 1 75 ILE 75 103 103 ILE ILE A . n B 1 76 TYR 76 104 104 TYR TYR A . n B 1 77 LEU 77 105 105 LEU LEU A . n B 1 78 LEU 78 106 106 LEU LEU A . n B 1 79 LYS 79 107 107 LYS LYS A . n B 1 80 VAL 80 108 108 VAL VAL A . n B 1 81 ASP 81 109 109 ASP ASP A . n B 1 82 LEU 82 110 110 LEU LEU A . n B 1 83 ASP 83 111 111 ASP ASP A . n B 1 84 LYS 84 112 112 LYS LYS A . n B 1 85 ASN 85 113 113 ASN ASN A . n B 1 86 GLU 86 114 114 GLU GLU A . n B 1 87 SER 87 115 115 SER SER A . n B 1 88 LEU 88 116 116 LEU LEU A . n B 1 89 ALA 89 117 117 ALA ALA A . n B 1 90 ARG 90 118 118 ARG ARG A . n B 1 91 LYS 91 119 119 LYS LYS A . n B 1 92 PHE 92 120 120 PHE PHE A . n B 1 93 SER 93 121 121 SER SER A . n B 1 94 VAL 94 122 122 VAL VAL A . n B 1 95 LYS 95 123 123 LYS LYS A . n B 1 96 SER 96 124 124 SER SER A . n B 1 97 LEU 97 125 125 LEU LEU A . n B 1 98 PRO 98 126 126 PRO PRO A . n B 1 99 THR 99 127 127 THR THR A . n B 1 100 ILE 100 128 128 ILE ILE A . n B 1 101 ILE 101 129 129 ILE ILE A . n B 1 102 LEU 102 130 130 LEU LEU A . n B 1 103 LEU 103 131 131 LEU LEU A . n B 1 104 LYS 104 132 132 LYS LYS A . n B 1 105 ASN 105 133 133 ASN ASN A . n B 1 106 LYS 106 134 134 LYS LYS A . n B 1 107 THR 107 135 135 THR THR A . n B 1 108 MET 108 136 136 MET MET A . n B 1 109 LEU 109 137 137 LEU LEU A . n B 1 110 ALA 110 138 138 ALA ALA A . n B 1 111 ARG 111 139 139 ARG ARG A . n B 1 112 LYS 112 140 140 LYS LYS A . n B 1 113 ASP 113 141 141 ASP ASP A . n B 1 114 HIS 114 142 142 HIS HIS A . n B 1 115 PHE 115 143 143 PHE PHE A . n B 1 116 VAL 116 144 144 VAL VAL A . n B 1 117 SER 117 145 145 SER SER A . n B 1 118 SER 118 146 146 SER SER A . n B 1 119 ASN 119 147 147 ASN ASN A . n B 1 120 ASP 120 148 148 ASP ASP A . n B 1 121 LEU 121 149 149 LEU LEU A . n B 1 122 ILE 122 150 150 ILE ILE A . n B 1 123 ALA 123 151 151 ALA ALA A . n B 1 124 LEU 124 152 152 LEU LEU A . n B 1 125 ILE 125 153 153 ILE ILE A . n B 1 126 LYS 126 154 154 LYS LYS A . n B 1 127 LYS 127 155 155 LYS LYS A . n B 1 128 HIS 128 156 156 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 1 1 HOH HOH B . C 2 HOH 2 2 2 HOH HOH B . C 2 HOH 3 5 5 HOH HOH B . C 2 HOH 4 10 10 HOH HOH B . C 2 HOH 5 11 11 HOH HOH B . C 2 HOH 6 14 14 HOH HOH B . C 2 HOH 7 19 19 HOH HOH B . C 2 HOH 8 20 20 HOH HOH B . C 2 HOH 9 21 21 HOH HOH B . C 2 HOH 10 22 22 HOH HOH B . C 2 HOH 11 23 23 HOH HOH B . C 2 HOH 12 25 25 HOH HOH B . C 2 HOH 13 26 26 HOH HOH B . C 2 HOH 14 27 27 HOH HOH B . D 2 HOH 1 3 3 HOH HOH A . D 2 HOH 2 4 4 HOH HOH A . D 2 HOH 3 6 6 HOH HOH A . D 2 HOH 4 7 7 HOH HOH A . D 2 HOH 5 8 8 HOH HOH A . D 2 HOH 6 9 9 HOH HOH A . D 2 HOH 7 12 12 HOH HOH A . D 2 HOH 8 13 13 HOH HOH A . D 2 HOH 9 15 15 HOH HOH A . D 2 HOH 10 16 16 HOH HOH A . D 2 HOH 11 17 17 HOH HOH A . D 2 HOH 12 18 18 HOH HOH A . D 2 HOH 13 24 24 HOH HOH A . D 2 HOH 14 28 28 HOH HOH A . D 2 HOH 15 157 31 HOH HOH A . D 2 HOH 16 158 32 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-12-14 2 'Structure model' 1 1 2017-11-08 3 'Structure model' 1 2 2019-12-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.classification' 2 2 'Structure model' '_software.contact_author' 3 2 'Structure model' '_software.contact_author_email' 4 2 'Structure model' '_software.date' 5 2 'Structure model' '_software.language' 6 2 'Structure model' '_software.location' 7 2 'Structure model' '_software.name' 8 2 'Structure model' '_software.type' 9 2 'Structure model' '_software.version' 10 3 'Structure model' '_citation.journal_abbrev' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation.pdbx_database_id_PubMed' 15 3 'Structure model' '_citation.title' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 2.900 _diffrn_reflns.pdbx_d_res_low 100.000 _diffrn_reflns.pdbx_number_obs 8947 _diffrn_reflns.pdbx_Rmerge_I_obs 0.040 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared 0.93 _diffrn_reflns.av_sigmaI_over_netI 29.23 _diffrn_reflns.pdbx_redundancy 3.70 _diffrn_reflns.pdbx_percent_possible_obs 98.20 _diffrn_reflns.number 32987 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 6.25 100.00 ? ? 0.018 ? 0.688 3.50 94.30 1 4.96 6.25 ? ? 0.027 ? 0.891 3.60 97.40 1 4.33 4.96 ? ? 0.037 ? 1.398 3.70 98.70 1 3.94 4.33 ? ? 0.045 ? 1.312 3.70 98.30 1 3.65 3.94 ? ? 0.048 ? 1.000 3.70 99.00 1 3.44 3.65 ? ? 0.062 ? 0.837 3.70 98.70 1 3.27 3.44 ? ? 0.104 ? 0.849 3.70 99.20 1 3.12 3.27 ? ? 0.164 ? 0.795 3.70 98.30 1 3.00 3.12 ? ? 0.245 ? 0.816 3.70 99.20 1 2.90 3.00 ? ? 0.366 ? 0.745 3.70 99.10 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -28.7912 1.6050 -3.2648 1.4824 1.7136 1.5847 -0.2964 -0.9593 -0.8304 6.7035 5.5050 4.0334 4.7742 -4.5256 -4.4215 0.1057 0.0670 0.6659 0.0594 -0.4221 0.4264 -0.1729 0.5199 -0.7989 'X-RAY DIFFRACTION' 2 ? refined -37.6128 -9.4057 -4.0906 1.0151 0.5401 0.4046 0.2186 -0.2400 -0.0869 9.9651 1.8336 1.5445 4.2438 -3.8920 -1.6859 -0.4098 0.1393 0.4351 -1.5840 1.4922 -0.0056 1.1977 -1.8563 -0.2206 'X-RAY DIFFRACTION' 3 ? refined -24.7017 -25.0226 -5.5665 0.6675 0.7446 0.2428 0.1941 -0.3608 0.0603 0.0205 4.8839 5.6843 0.0184 0.4395 -2.3942 -0.0699 -1.2250 -0.2741 1.4465 0.3630 -0.9218 -0.5876 0.9716 1.6643 'X-RAY DIFFRACTION' 4 ? refined -29.5143 -25.5386 -11.2663 0.8337 0.5988 0.5678 0.0859 -0.1409 -0.0061 5.8451 6.5934 5.7983 -1.5144 3.7105 0.0051 0.0703 -0.1223 -0.0211 1.0301 -0.0351 0.1082 -1.0253 0.3991 0.4630 'X-RAY DIFFRACTION' 5 ? refined -26.8437 -22.8972 2.2458 0.6052 0.9765 0.5663 0.1153 -0.1677 -0.0640 6.8752 8.2059 2.0975 -1.8375 2.8778 -0.7157 -1.0964 0.7289 0.1741 -1.1766 -0.1323 0.2533 1.0953 -0.7135 0.4134 'X-RAY DIFFRACTION' 6 ? refined -34.8282 -27.2217 -0.5685 0.9505 0.7352 0.6710 0.4025 -0.0226 0.0138 1.8747 5.4878 2.3589 0.9629 0.9824 -1.4258 -0.7633 0.9773 -0.0028 -0.7901 -0.1215 1.4500 0.1678 0.3947 0.0952 'X-RAY DIFFRACTION' 7 ? refined -41.4048 -30.1204 -7.8448 0.7917 1.0075 1.2468 -0.0349 -0.3119 -0.4072 7.8822 1.7995 7.6834 0.9234 -1.7223 -3.7296 -0.5112 -0.9529 0.4806 -0.5692 -0.0685 2.2456 -1.0146 0.6297 -1.5877 'X-RAY DIFFRACTION' 8 ? refined -29.0747 -10.9930 3.2196 1.3603 1.0525 0.4764 -0.1402 -0.3800 -0.1570 9.2925 8.3642 2.0351 3.9345 -1.9449 -8.0756 -1.6977 -0.5413 -2.1342 0.1123 2.3092 0.0906 -1.2025 -2.4291 1.7156 'X-RAY DIFFRACTION' 9 ? refined -23.1925 -10.1500 -4.3791 1.1799 0.5002 0.6432 0.2723 -0.5661 -0.1242 2.9862 4.2104 6.8610 1.2329 4.3472 0.3749 -0.6696 -0.8811 -2.4740 -0.0475 0.7984 -0.0014 0.3808 -1.8769 -1.6423 'X-RAY DIFFRACTION' 10 ? refined -29.4691 -9.1203 -23.0729 0.8428 0.5643 0.8644 0.1271 0.0383 0.0537 3.6291 2.5387 6.9991 -0.6283 3.9442 -0.3769 -0.2110 -0.1979 0.3247 0.5626 -0.2572 -0.4742 -0.2592 0.6056 0.7651 'X-RAY DIFFRACTION' 11 ? refined -30.1361 -9.9248 -15.0765 0.7835 0.6764 0.6650 0.1237 0.1372 -0.0163 8.0151 7.0669 5.4798 -4.4911 3.9569 -0.7530 -0.1829 0.2665 -0.0430 -0.3339 -1.1605 -0.7997 -0.7107 0.2744 0.4635 'X-RAY DIFFRACTION' 12 ? refined -33.2825 0.9877 -14.2062 0.8343 0.6080 0.5867 0.0808 -0.0978 -0.1519 4.3399 5.4148 8.5799 0.0777 0.1698 -0.0201 -0.5856 0.1106 0.4733 -0.7511 0.9870 0.3746 0.8942 -1.7243 -0.8038 'X-RAY DIFFRACTION' 13 ? refined -24.1953 0.2829 -17.7726 0.8231 0.6449 0.7826 0.0284 -0.2726 0.0959 7.4858 3.6764 6.2608 -0.0717 -1.7640 -2.2088 0.0733 0.0385 -0.0464 -1.1939 -0.4999 -0.9529 1.9250 0.0927 2.0206 'X-RAY DIFFRACTION' 14 ? refined -16.7287 -5.1893 -22.4794 0.6111 1.3466 1.3017 0.0898 0.0295 0.0807 5.8755 7.9157 5.0091 0.8457 -0.4246 -1.4106 0.6989 -0.1999 -0.5733 0.3241 0.0577 -1.8834 -0.2548 0.5463 2.8379 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 B 54 B 58 ;chain 'B' and (resseq 54:58) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 B 59 B 71 ;chain 'B' and (resseq 59:71) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 B 72 B 82 ;chain 'B' and (resseq 72:82) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 B 83 B 112 ;chain 'B' and (resseq 83:112) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 B 113 B 132 ;chain 'B' and (resseq 113:132) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 B 133 B 145 ;chain 'B' and (resseq 133:145) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 B 146 B 156 ;chain 'B' and (resseq 146:156) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 54 A 63 ;chain 'A' and (resseq 54:63) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 64 A 71 ;chain 'A' and (resseq 64:71) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 A 72 A 99 ;chain 'A' and (resseq 72:99) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 11 11 A 100 A 112 ;chain 'A' and (resseq 100:112) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 12 12 A 113 A 132 ;chain 'A' and (resseq 113:132) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 13 13 A 133 A 145 ;chain 'A' and (resseq 133:145) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 14 14 A 146 A 156 ;chain 'A' and (resseq 146:156) ; ? ? ? ? ? # _phasing.method MIRAS # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 SOLVE . ? program 'Tom Terwilliger' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 4 PHENIX 1.7.1_743 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 5 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH B TYR 104 ? ? OH A TYR 104 ? ? 1.54 2 1 O A ALA 117 ? ? CG2 A VAL 122 ? ? 1.97 3 1 O A HOH 3 ? ? O A HOH 7 ? ? 1.98 4 1 OG A SER 145 ? ? OD1 A ASP 148 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NE2 _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 GLN _pdbx_validate_symm_contact.auth_seq_id_1 83 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ASP _pdbx_validate_symm_contact.auth_seq_id_2 111 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_444 _pdbx_validate_symm_contact.dist 2.14 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB B CYS 82 ? ? SG B CYS 82 ? ? 1.698 1.812 -0.114 0.016 N 2 1 CB B CYS 85 ? ? SG B CYS 85 ? ? 1.705 1.812 -0.107 0.016 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN B 67 ? ? 86.66 9.59 2 1 MET B 68 ? ? -118.61 -86.30 3 1 ASN A 61 ? ? 159.06 -87.32 4 1 VAL A 66 ? ? 47.99 -124.97 5 1 ASN A 67 ? ? 110.13 157.80 6 1 LYS A 134 ? ? 81.80 2.98 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B ARG 54 ? CG ? A ARG 26 CG 2 1 Y 1 B ARG 54 ? CD ? A ARG 26 CD 3 1 Y 1 B ARG 54 ? NE ? A ARG 26 NE 4 1 Y 1 B ARG 54 ? CZ ? A ARG 26 CZ 5 1 Y 1 B ARG 54 ? NH1 ? A ARG 26 NH1 6 1 Y 1 B ARG 54 ? NH2 ? A ARG 26 NH2 7 1 Y 1 B LEU 55 ? CB ? A LEU 27 CB 8 1 Y 1 B LEU 55 ? CG ? A LEU 27 CG 9 1 Y 1 B LEU 55 ? CD1 ? A LEU 27 CD1 10 1 Y 1 B LEU 55 ? CD2 ? A LEU 27 CD2 11 1 Y 1 B GLN 56 ? CG ? A GLN 28 CG 12 1 Y 1 B GLN 56 ? CD ? A GLN 28 CD 13 1 Y 1 B GLN 56 ? OE1 ? A GLN 28 OE1 14 1 Y 1 B GLN 56 ? NE2 ? A GLN 28 NE2 15 1 Y 1 B GLN 57 ? CG ? A GLN 29 CG 16 1 Y 1 B GLN 57 ? CD ? A GLN 29 CD 17 1 Y 1 B GLN 57 ? OE1 ? A GLN 29 OE1 18 1 Y 1 B GLN 57 ? NE2 ? A GLN 29 NE2 19 1 Y 1 B ASN 58 ? CG ? A ASN 30 CG 20 1 Y 1 B ASN 58 ? OD1 ? A ASN 30 OD1 21 1 Y 1 B ASN 58 ? ND2 ? A ASN 30 ND2 22 1 Y 1 B ILE 62 ? CB ? A ILE 34 CB 23 1 Y 1 B ILE 62 ? CG1 ? A ILE 34 CG1 24 1 Y 1 B ILE 62 ? CG2 ? A ILE 34 CG2 25 1 Y 1 B ILE 62 ? CD1 ? A ILE 34 CD1 26 1 Y 1 B ILE 63 ? CG1 ? A ILE 35 CG1 27 1 Y 1 B ILE 63 ? CG2 ? A ILE 35 CG2 28 1 Y 1 B ILE 63 ? CD1 ? A ILE 35 CD1 29 1 Y 1 B ASN 64 ? CG ? A ASN 36 CG 30 1 Y 1 B ASN 64 ? OD1 ? A ASN 36 OD1 31 1 Y 1 B ASN 64 ? ND2 ? A ASN 36 ND2 32 1 Y 1 B ASN 67 ? CB ? A ASN 39 CB 33 1 Y 1 B ASN 67 ? CG ? A ASN 39 CG 34 1 Y 1 B ASN 67 ? OD1 ? A ASN 39 OD1 35 1 Y 1 B ASN 67 ? ND2 ? A ASN 39 ND2 36 1 Y 1 B MET 68 ? CG ? A MET 40 CG 37 1 Y 1 B MET 68 ? SD ? A MET 40 SD 38 1 Y 1 B MET 68 ? CE ? A MET 40 CE 39 1 Y 1 A ARG 54 ? CG ? B ARG 26 CG 40 1 Y 1 A ARG 54 ? CD ? B ARG 26 CD 41 1 Y 1 A ARG 54 ? NE ? B ARG 26 NE 42 1 Y 1 A ARG 54 ? CZ ? B ARG 26 CZ 43 1 Y 1 A ARG 54 ? NH1 ? B ARG 26 NH1 44 1 Y 1 A ARG 54 ? NH2 ? B ARG 26 NH2 45 1 Y 1 A LEU 55 ? CG ? B LEU 27 CG 46 1 Y 1 A LEU 55 ? CD1 ? B LEU 27 CD1 47 1 Y 1 A LEU 55 ? CD2 ? B LEU 27 CD2 48 1 Y 1 A GLN 56 ? CB ? B GLN 28 CB 49 1 Y 1 A GLN 56 ? CG ? B GLN 28 CG 50 1 Y 1 A GLN 56 ? CD ? B GLN 28 CD 51 1 Y 1 A GLN 56 ? OE1 ? B GLN 28 OE1 52 1 Y 1 A GLN 56 ? NE2 ? B GLN 28 NE2 53 1 Y 1 A GLN 57 ? CB ? B GLN 29 CB 54 1 Y 1 A GLN 57 ? CG ? B GLN 29 CG 55 1 Y 1 A GLN 57 ? CD ? B GLN 29 CD 56 1 Y 1 A GLN 57 ? OE1 ? B GLN 29 OE1 57 1 Y 1 A GLN 57 ? NE2 ? B GLN 29 NE2 58 1 Y 1 A ASN 58 ? CB ? B ASN 30 CB 59 1 Y 1 A ASN 58 ? CG ? B ASN 30 CG 60 1 Y 1 A ASN 58 ? OD1 ? B ASN 30 OD1 61 1 Y 1 A ASN 58 ? ND2 ? B ASN 30 ND2 62 1 Y 1 A SER 60 ? CB ? B SER 32 CB 63 1 Y 1 A SER 60 ? OG ? B SER 32 OG 64 1 Y 1 A ASN 61 ? CB ? B ASN 33 CB 65 1 Y 1 A ASN 61 ? CG ? B ASN 33 CG 66 1 Y 1 A ASN 61 ? OD1 ? B ASN 33 OD1 67 1 Y 1 A ASN 61 ? ND2 ? B ASN 33 ND2 68 1 Y 1 A ILE 62 ? CB ? B ILE 34 CB 69 1 Y 1 A ILE 62 ? CG1 ? B ILE 34 CG1 70 1 Y 1 A ILE 62 ? CG2 ? B ILE 34 CG2 71 1 Y 1 A ILE 62 ? CD1 ? B ILE 34 CD1 72 1 Y 1 A ILE 63 ? CB ? B ILE 35 CB 73 1 Y 1 A ILE 63 ? CG1 ? B ILE 35 CG1 74 1 Y 1 A ILE 63 ? CG2 ? B ILE 35 CG2 75 1 Y 1 A ILE 63 ? CD1 ? B ILE 35 CD1 76 1 Y 1 A VAL 66 ? CB ? B VAL 38 CB 77 1 Y 1 A VAL 66 ? CG1 ? B VAL 38 CG1 78 1 Y 1 A VAL 66 ? CG2 ? B VAL 38 CG2 79 1 Y 1 A ASN 67 ? CB ? B ASN 39 CB 80 1 Y 1 A ASN 67 ? CG ? B ASN 39 CG 81 1 Y 1 A ASN 67 ? OD1 ? B ASN 39 OD1 82 1 Y 1 A ASN 67 ? ND2 ? B ASN 39 ND2 83 1 Y 1 A MET 68 ? CG ? B MET 40 CG 84 1 Y 1 A MET 68 ? SD ? B MET 40 SD 85 1 Y 1 A MET 68 ? CE ? B MET 40 CE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B SER 29 ? A SER 1 2 1 Y 1 B THR 30 ? A THR 2 3 1 Y 1 B ASN 31 ? A ASN 3 4 1 Y 1 B ASP 32 ? A ASP 4 5 1 Y 1 B ASP 33 ? A ASP 5 6 1 Y 1 B PRO 34 ? A PRO 6 7 1 Y 1 B LEU 35 ? A LEU 7 8 1 Y 1 B THR 36 ? A THR 8 9 1 Y 1 B PRO 37 ? A PRO 9 10 1 Y 1 B LEU 38 ? A LEU 10 11 1 Y 1 B ASN 39 ? A ASN 11 12 1 Y 1 B ARG 40 ? A ARG 12 13 1 Y 1 B PHE 41 ? A PHE 13 14 1 Y 1 B ASP 42 ? A ASP 14 15 1 Y 1 B LYS 43 ? A LYS 15 16 1 Y 1 B TYR 44 ? A TYR 16 17 1 Y 1 B TYR 45 ? A TYR 17 18 1 Y 1 B LEU 46 ? A LEU 18 19 1 Y 1 B ARG 47 ? A ARG 19 20 1 Y 1 B MET 48 ? A MET 20 21 1 Y 1 B PHE 49 ? A PHE 21 22 1 Y 1 B LYS 50 ? A LYS 22 23 1 Y 1 B LYS 51 ? A LYS 23 24 1 Y 1 B VAL 52 ? A VAL 24 25 1 Y 1 B PRO 53 ? A PRO 25 26 1 Y 1 A SER 29 ? B SER 1 27 1 Y 1 A THR 30 ? B THR 2 28 1 Y 1 A ASN 31 ? B ASN 3 29 1 Y 1 A ASP 32 ? B ASP 4 30 1 Y 1 A ASP 33 ? B ASP 5 31 1 Y 1 A PRO 34 ? B PRO 6 32 1 Y 1 A LEU 35 ? B LEU 7 33 1 Y 1 A THR 36 ? B THR 8 34 1 Y 1 A PRO 37 ? B PRO 9 35 1 Y 1 A LEU 38 ? B LEU 10 36 1 Y 1 A ASN 39 ? B ASN 11 37 1 Y 1 A ARG 40 ? B ARG 12 38 1 Y 1 A PHE 41 ? B PHE 13 39 1 Y 1 A ASP 42 ? B ASP 14 40 1 Y 1 A LYS 43 ? B LYS 15 41 1 Y 1 A TYR 44 ? B TYR 16 42 1 Y 1 A TYR 45 ? B TYR 17 43 1 Y 1 A LEU 46 ? B LEU 18 44 1 Y 1 A ARG 47 ? B ARG 19 45 1 Y 1 A MET 48 ? B MET 20 46 1 Y 1 A PHE 49 ? B PHE 21 47 1 Y 1 A LYS 50 ? B LYS 22 48 1 Y 1 A LYS 51 ? B LYS 23 49 1 Y 1 A VAL 52 ? B VAL 24 50 1 Y 1 A PRO 53 ? B PRO 25 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #