data_3UP7 # _entry.id 3UP7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3UP7 RCSB RCSB069036 WWPDB D_1000069036 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 3UNJ unspecified . PDB 3UNK unspecified . PDB 3UNZ unspecified . PDB 3UO4 unspecified . PDB 3UO5 unspecified . PDB 3UO6 unspecified . PDB 3UOD unspecified . PDB 3UOH unspecified . PDB 3UOJ unspecified . PDB 3UOK unspecified . PDB 3UOL unspecified . PDB 3UP2 unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3UP7 _pdbx_database_status.recvd_initial_deposition_date 2011-11-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Martin, M.P.' 1 'Zhu, J.-Y.' 2 'Schonbrunn, E.' 3 # _citation.id primary _citation.title 'Development of o-Chlorophenyl Substituted Pyrimidines as Exceptionally Potent Aurora Kinase Inhibitors.' _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 55 _citation.page_first 7392 _citation.page_last 7416 _citation.year 2012 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22803810 _citation.pdbx_database_id_DOI 10.1021/jm300334d # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lawrence, H.R.' 1 primary 'Martin, M.P.' 2 primary 'Luo, Y.' 3 primary 'Pireddu, R.' 4 primary 'Yang, H.' 5 primary 'Gevariya, H.' 6 primary 'Ozcan, S.' 7 primary 'Zhu, J.Y.' 8 primary 'Kendig, R.' 9 primary 'Rodriguez, M.' 10 primary 'Elias, R.' 11 primary 'Cheng, J.Q.' 12 primary 'Sebti, S.M.' 13 primary 'Schonbrunn, E.' 14 primary 'Lawrence, N.J.' 15 # _cell.entry_id 3UP7 _cell.length_a 82.580 _cell.length_b 82.580 _cell.length_c 172.360 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3UP7 _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 32359.123 1 2.7.11.1 T287D 'RESIDUES 123-401' ? 2 non-polymer syn '2-({2-[(4-carboxyphenyl)amino]pyrimidin-4-yl}amino)benzoic acid' 350.328 1 ? ? ? ? 3 water nat water 18.015 14 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2, Aurora/IPL1-related kinase 1, ARK-1, Aurora-related kinase 1, hARK1, Breast tumor-amplified kinase, Serine/threonine-protein kinase 15, Serine/threonine-protein kinase 6, Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRDTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASK ; _entity_poly.pdbx_seq_one_letter_code_can ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRDTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 LYS n 1 4 ARG n 1 5 GLN n 1 6 TRP n 1 7 ALA n 1 8 LEU n 1 9 GLU n 1 10 ASP n 1 11 PHE n 1 12 GLU n 1 13 ILE n 1 14 GLY n 1 15 ARG n 1 16 PRO n 1 17 LEU n 1 18 GLY n 1 19 LYS n 1 20 GLY n 1 21 LYS n 1 22 PHE n 1 23 GLY n 1 24 ASN n 1 25 VAL n 1 26 TYR n 1 27 LEU n 1 28 ALA n 1 29 ARG n 1 30 GLU n 1 31 LYS n 1 32 GLN n 1 33 SER n 1 34 LYS n 1 35 PHE n 1 36 ILE n 1 37 LEU n 1 38 ALA n 1 39 LEU n 1 40 LYS n 1 41 VAL n 1 42 LEU n 1 43 PHE n 1 44 LYS n 1 45 ALA n 1 46 GLN n 1 47 LEU n 1 48 GLU n 1 49 LYS n 1 50 ALA n 1 51 GLY n 1 52 VAL n 1 53 GLU n 1 54 HIS n 1 55 GLN n 1 56 LEU n 1 57 ARG n 1 58 ARG n 1 59 GLU n 1 60 VAL n 1 61 GLU n 1 62 ILE n 1 63 GLN n 1 64 SER n 1 65 HIS n 1 66 LEU n 1 67 ARG n 1 68 HIS n 1 69 PRO n 1 70 ASN n 1 71 ILE n 1 72 LEU n 1 73 ARG n 1 74 LEU n 1 75 TYR n 1 76 GLY n 1 77 TYR n 1 78 PHE n 1 79 HIS n 1 80 ASP n 1 81 ALA n 1 82 THR n 1 83 ARG n 1 84 VAL n 1 85 TYR n 1 86 LEU n 1 87 ILE n 1 88 LEU n 1 89 GLU n 1 90 TYR n 1 91 ALA n 1 92 PRO n 1 93 LEU n 1 94 GLY n 1 95 THR n 1 96 VAL n 1 97 TYR n 1 98 ARG n 1 99 GLU n 1 100 LEU n 1 101 GLN n 1 102 LYS n 1 103 LEU n 1 104 SER n 1 105 LYS n 1 106 PHE n 1 107 ASP n 1 108 GLU n 1 109 GLN n 1 110 ARG n 1 111 THR n 1 112 ALA n 1 113 THR n 1 114 TYR n 1 115 ILE n 1 116 THR n 1 117 GLU n 1 118 LEU n 1 119 ALA n 1 120 ASN n 1 121 ALA n 1 122 LEU n 1 123 SER n 1 124 TYR n 1 125 CYS n 1 126 HIS n 1 127 SER n 1 128 LYS n 1 129 ARG n 1 130 VAL n 1 131 ILE n 1 132 HIS n 1 133 ARG n 1 134 ASP n 1 135 ILE n 1 136 LYS n 1 137 PRO n 1 138 GLU n 1 139 ASN n 1 140 LEU n 1 141 LEU n 1 142 LEU n 1 143 GLY n 1 144 SER n 1 145 ALA n 1 146 GLY n 1 147 GLU n 1 148 LEU n 1 149 LYS n 1 150 ILE n 1 151 ALA n 1 152 ASP n 1 153 PHE n 1 154 GLY n 1 155 TRP n 1 156 SER n 1 157 VAL n 1 158 HIS n 1 159 ALA n 1 160 PRO n 1 161 SER n 1 162 SER n 1 163 ARG n 1 164 ARG n 1 165 ASP n 1 166 THR n 1 167 LEU n 1 168 CYS n 1 169 GLY n 1 170 THR n 1 171 LEU n 1 172 ASP n 1 173 TYR n 1 174 LEU n 1 175 PRO n 1 176 PRO n 1 177 GLU n 1 178 MET n 1 179 ILE n 1 180 GLU n 1 181 GLY n 1 182 ARG n 1 183 MET n 1 184 HIS n 1 185 ASP n 1 186 GLU n 1 187 LYS n 1 188 VAL n 1 189 ASP n 1 190 LEU n 1 191 TRP n 1 192 SER n 1 193 LEU n 1 194 GLY n 1 195 VAL n 1 196 LEU n 1 197 CYS n 1 198 TYR n 1 199 GLU n 1 200 PHE n 1 201 LEU n 1 202 VAL n 1 203 GLY n 1 204 LYS n 1 205 PRO n 1 206 PRO n 1 207 PHE n 1 208 GLU n 1 209 ALA n 1 210 ASN n 1 211 THR n 1 212 TYR n 1 213 GLN n 1 214 GLU n 1 215 THR n 1 216 TYR n 1 217 LYS n 1 218 ARG n 1 219 ILE n 1 220 SER n 1 221 ARG n 1 222 VAL n 1 223 GLU n 1 224 PHE n 1 225 THR n 1 226 PHE n 1 227 PRO n 1 228 ASP n 1 229 PHE n 1 230 VAL n 1 231 THR n 1 232 GLU n 1 233 GLY n 1 234 ALA n 1 235 ARG n 1 236 ASP n 1 237 LEU n 1 238 ILE n 1 239 SER n 1 240 ARG n 1 241 LEU n 1 242 LEU n 1 243 LYS n 1 244 HIS n 1 245 ASN n 1 246 PRO n 1 247 SER n 1 248 GLN n 1 249 ARG n 1 250 PRO n 1 251 MET n 1 252 LEU n 1 253 ARG n 1 254 GLU n 1 255 VAL n 1 256 LEU n 1 257 GLU n 1 258 HIS n 1 259 PRO n 1 260 TRP n 1 261 ILE n 1 262 THR n 1 263 ALA n 1 264 ASN n 1 265 SER n 1 266 SER n 1 267 LYS n 1 268 PRO n 1 269 SER n 1 270 ASN n 1 271 CYS n 1 272 GLN n 1 273 ASN n 1 274 LYS n 1 275 GLU n 1 276 SER n 1 277 ALA n 1 278 SER n 1 279 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'TUNER(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a-MBP _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASK ; _struct_ref.pdbx_align_begin 123 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3UP7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 279 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 123 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 401 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 123 _struct_ref_seq.pdbx_auth_seq_align_end 401 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3UP7 _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 165 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O14965 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 287 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 287 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0C9 non-polymer . '2-({2-[(4-carboxyphenyl)amino]pyrimidin-4-yl}amino)benzoic acid' ? 'C18 H14 N4 O4' 350.328 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3UP7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.62 _exptl_crystal.density_percent_sol 53.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details ;10 mg/mL AURORA A protein, 1 mM YL1-038-09, 10 % (v/v) PEG 3350, 25 mM phosphate(Na/K pH 7.4), 100 mM sodium tartrate pH 7.0 VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 291K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.pdbx_collection_date 2010-06-02 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator MIRRORS _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.54178 _diffrn_source.pdbx_wavelength_list 1.54178 # _reflns.entry_id 3UP7 _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20 _reflns.d_resolution_high 3.05 _reflns.number_obs 7101 _reflns.number_all ? _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rsym_value 0.050 _reflns.pdbx_netI_over_sigmaI 31.67 _reflns.B_iso_Wilson_estimate . _reflns.pdbx_redundancy 4.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.05 _reflns_shell.d_res_low 3.10 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.371 _reflns_shell.pdbx_Rsym_value 0.345 _reflns_shell.meanI_over_sigI_obs 4.7 _reflns_shell.pdbx_redundancy 5.0 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3UP7 _refine.ls_number_reflns_obs 7101 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 3220591.81 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.61 _refine.ls_d_res_high 3.05 _refine.ls_percent_reflns_obs 99.8 _refine.ls_R_factor_obs 0.233 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.233 _refine.ls_R_factor_R_free 0.292 _refine.ls_R_factor_R_free_error 0.016 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.5 _refine.ls_number_reflns_R_free 320 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 56.6 _refine.aniso_B[1][1] -1.68 _refine.aniso_B[2][2] -1.68 _refine.aniso_B[3][3] 3.36 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.35 _refine.solvent_model_param_bsol 32.6123 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'BULK SOLVENT MODEL USED' _refine.pdbx_starting_model 'PDB ENTRY 3FDN' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3UP7 _refine_analyze.Luzzati_coordinate_error_obs 0.39 _refine_analyze.Luzzati_sigma_a_obs 0.48 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.50 _refine_analyze.Luzzati_sigma_a_free 0.54 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2172 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 2212 _refine_hist.d_res_high 3.05 _refine_hist.d_res_low 19.61 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id c_bond_d 0.011 ? ? ? ? 'X-RAY DIFFRACTION' c_bond_d_na ? ? ? ? ? 'X-RAY DIFFRACTION' c_bond_d_prot ? ? ? ? ? 'X-RAY DIFFRACTION' c_angle_d ? ? ? ? ? 'X-RAY DIFFRACTION' c_angle_d_na ? ? ? ? ? 'X-RAY DIFFRACTION' c_angle_d_prot ? ? ? ? ? 'X-RAY DIFFRACTION' c_angle_deg 1.7 ? ? ? ? 'X-RAY DIFFRACTION' c_angle_deg_na ? ? ? ? ? 'X-RAY DIFFRACTION' c_angle_deg_prot ? ? ? ? ? 'X-RAY DIFFRACTION' c_dihedral_angle_d 21.8 ? ? ? ? 'X-RAY DIFFRACTION' c_dihedral_angle_d_na ? ? ? ? ? 'X-RAY DIFFRACTION' c_dihedral_angle_d_prot ? ? ? ? ? 'X-RAY DIFFRACTION' c_improper_angle_d 1.05 ? ? ? ? 'X-RAY DIFFRACTION' c_improper_angle_d_na ? ? ? ? ? 'X-RAY DIFFRACTION' c_improper_angle_d_prot ? ? ? ? ? 'X-RAY DIFFRACTION' c_mcbond_it 1.14 1.50 ? ? ? 'X-RAY DIFFRACTION' c_mcangle_it 2.11 2.00 ? ? ? 'X-RAY DIFFRACTION' c_scbond_it 1.51 2.00 ? ? ? 'X-RAY DIFFRACTION' c_scangle_it 2.41 2.50 ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_restr_ncs.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_restr_ncs.dom_id 1 _refine_ls_restr_ncs.ncs_model_details NONE _refine_ls_restr_ncs.rms_dev_position ? _refine_ls_restr_ncs.weight_position ? _refine_ls_restr_ncs.rms_dev_B_iso ? _refine_ls_restr_ncs.weight_B_iso ? _refine_ls_restr_ncs.pdbx_ordinal 1 _refine_ls_restr_ncs.pdbx_type . _refine_ls_restr_ncs.pdbx_auth_asym_id . _refine_ls_restr_ncs.pdbx_ens_id 1 _refine_ls_restr_ncs.pdbx_number ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 3.05 _refine_ls_shell.d_res_low 3.24 _refine_ls_shell.number_reflns_R_work 1099 _refine_ls_shell.R_factor_R_work 0.320 _refine_ls_shell.percent_reflns_obs 99.9 _refine_ls_shell.R_factor_R_free 0.382 _refine_ls_shell.R_factor_R_free_error 0.053 _refine_ls_shell.percent_reflns_R_free 4.5 _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct_ncs_dom.id 1 _struct_ncs_dom.details ? _struct_ncs_dom.pdbx_ens_id 1 # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 3UP7 _struct.title 'Aurora A in complex with YL1-038-09' _struct.pdbx_descriptor 'Aurora kinase A (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3UP7 _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text 'protein kinase, Aurora A, inhibitor, DFG-in, TRANSFERASE-TRANSFERASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 7 ? GLU A 9 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 2 LYS A 44 ? LYS A 49 ? LYS A 166 LYS A 171 1 ? 6 HELX_P HELX_P3 3 VAL A 52 ? LEU A 66 ? VAL A 174 LEU A 188 1 ? 15 HELX_P HELX_P4 4 THR A 95 ? SER A 104 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 5 ASP A 107 ? LYS A 128 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P6 6 ASP A 152 ? SER A 156 ? ASP A 274 SER A 278 5 ? 5 HELX_P HELX_P7 7 PRO A 175 ? GLU A 180 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P8 8 LYS A 187 ? GLY A 203 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P9 9 THR A 211 ? ARG A 221 ? THR A 333 ARG A 343 1 ? 11 HELX_P HELX_P10 10 THR A 231 ? LEU A 242 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P11 11 ASN A 245 ? ARG A 249 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P12 12 MET A 251 ? HIS A 258 ? MET A 373 HIS A 380 1 ? 8 HELX_P HELX_P13 13 PRO A 259 ? THR A 262 ? PRO A 381 THR A 384 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 159 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 281 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 160 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 282 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.23 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 11 ? GLY A 18 ? PHE A 133 GLY A 140 A 2 GLY A 23 ? GLU A 30 ? GLY A 145 GLU A 152 A 3 ILE A 36 ? LEU A 42 ? ILE A 158 LEU A 164 A 4 VAL A 84 ? LEU A 88 ? VAL A 206 LEU A 210 A 5 LEU A 74 ? HIS A 79 ? LEU A 196 HIS A 201 B 1 VAL A 130 ? ILE A 131 ? VAL A 252 ILE A 253 B 2 VAL A 157 ? HIS A 158 ? VAL A 279 HIS A 280 C 1 LEU A 140 ? LEU A 142 ? LEU A 262 LEU A 264 C 2 LEU A 148 ? ILE A 150 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 14 ? N GLY A 136 O LEU A 27 ? O LEU A 149 A 2 3 N TYR A 26 ? N TYR A 148 O LEU A 39 ? O LEU A 161 A 3 4 N ALA A 38 ? N ALA A 160 O LEU A 88 ? O LEU A 210 A 4 5 O TYR A 85 ? O TYR A 207 N PHE A 78 ? N PHE A 200 B 1 2 N ILE A 131 ? N ILE A 253 O VAL A 157 ? O VAL A 279 C 1 2 N LEU A 141 ? N LEU A 263 O LYS A 149 ? O LYS A 271 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE 0C9 A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ARG A 15 ? ARG A 137 . ? 1_555 ? 2 AC1 11 GLY A 18 ? GLY A 140 . ? 1_555 ? 3 AC1 11 LYS A 19 ? LYS A 141 . ? 1_555 ? 4 AC1 11 VAL A 25 ? VAL A 147 . ? 1_555 ? 5 AC1 11 ALA A 38 ? ALA A 160 . ? 1_555 ? 6 AC1 11 LYS A 40 ? LYS A 162 . ? 1_555 ? 7 AC1 11 GLU A 89 ? GLU A 211 . ? 1_555 ? 8 AC1 11 ALA A 91 ? ALA A 213 . ? 1_555 ? 9 AC1 11 GLY A 94 ? GLY A 216 . ? 1_555 ? 10 AC1 11 ARG A 98 ? ARG A 220 . ? 1_555 ? 11 AC1 11 ASP A 152 ? ASP A 274 . ? 1_555 ? # _database_PDB_matrix.entry_id 3UP7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3UP7 _atom_sites.fract_transf_matrix[1][1] 0.012109 _atom_sites.fract_transf_matrix[1][2] 0.006991 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013983 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005802 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 123 ? ? ? A . n A 1 2 LYS 2 124 124 LYS LYS A . n A 1 3 LYS 3 125 125 LYS LYS A . n A 1 4 ARG 4 126 126 ARG ARG A . n A 1 5 GLN 5 127 127 GLN GLN A . n A 1 6 TRP 6 128 128 TRP TRP A . n A 1 7 ALA 7 129 129 ALA ALA A . n A 1 8 LEU 8 130 130 LEU LEU A . n A 1 9 GLU 9 131 131 GLU GLU A . n A 1 10 ASP 10 132 132 ASP ASP A . n A 1 11 PHE 11 133 133 PHE PHE A . n A 1 12 GLU 12 134 134 GLU GLU A . n A 1 13 ILE 13 135 135 ILE ILE A . n A 1 14 GLY 14 136 136 GLY GLY A . n A 1 15 ARG 15 137 137 ARG ARG A . n A 1 16 PRO 16 138 138 PRO PRO A . n A 1 17 LEU 17 139 139 LEU LEU A . n A 1 18 GLY 18 140 140 GLY GLY A . n A 1 19 LYS 19 141 141 LYS LYS A . n A 1 20 GLY 20 142 142 GLY GLY A . n A 1 21 LYS 21 143 143 LYS LYS A . n A 1 22 PHE 22 144 144 PHE PHE A . n A 1 23 GLY 23 145 145 GLY GLY A . n A 1 24 ASN 24 146 146 ASN ASN A . n A 1 25 VAL 25 147 147 VAL VAL A . n A 1 26 TYR 26 148 148 TYR TYR A . n A 1 27 LEU 27 149 149 LEU LEU A . n A 1 28 ALA 28 150 150 ALA ALA A . n A 1 29 ARG 29 151 151 ARG ARG A . n A 1 30 GLU 30 152 152 GLU GLU A . n A 1 31 LYS 31 153 153 LYS LYS A . n A 1 32 GLN 32 154 154 GLN GLN A . n A 1 33 SER 33 155 155 SER SER A . n A 1 34 LYS 34 156 156 LYS LYS A . n A 1 35 PHE 35 157 157 PHE PHE A . n A 1 36 ILE 36 158 158 ILE ILE A . n A 1 37 LEU 37 159 159 LEU LEU A . n A 1 38 ALA 38 160 160 ALA ALA A . n A 1 39 LEU 39 161 161 LEU LEU A . n A 1 40 LYS 40 162 162 LYS LYS A . n A 1 41 VAL 41 163 163 VAL VAL A . n A 1 42 LEU 42 164 164 LEU LEU A . n A 1 43 PHE 43 165 165 PHE PHE A . n A 1 44 LYS 44 166 166 LYS LYS A . n A 1 45 ALA 45 167 167 ALA ALA A . n A 1 46 GLN 46 168 168 GLN GLN A . n A 1 47 LEU 47 169 169 LEU LEU A . n A 1 48 GLU 48 170 170 GLU GLU A . n A 1 49 LYS 49 171 171 LYS LYS A . n A 1 50 ALA 50 172 172 ALA ALA A . n A 1 51 GLY 51 173 173 GLY GLY A . n A 1 52 VAL 52 174 174 VAL VAL A . n A 1 53 GLU 53 175 175 GLU GLU A . n A 1 54 HIS 54 176 176 HIS HIS A . n A 1 55 GLN 55 177 177 GLN GLN A . n A 1 56 LEU 56 178 178 LEU LEU A . n A 1 57 ARG 57 179 179 ARG ARG A . n A 1 58 ARG 58 180 180 ARG ARG A . n A 1 59 GLU 59 181 181 GLU GLU A . n A 1 60 VAL 60 182 182 VAL VAL A . n A 1 61 GLU 61 183 183 GLU GLU A . n A 1 62 ILE 62 184 184 ILE ILE A . n A 1 63 GLN 63 185 185 GLN GLN A . n A 1 64 SER 64 186 186 SER SER A . n A 1 65 HIS 65 187 187 HIS HIS A . n A 1 66 LEU 66 188 188 LEU LEU A . n A 1 67 ARG 67 189 189 ARG ARG A . n A 1 68 HIS 68 190 190 HIS HIS A . n A 1 69 PRO 69 191 191 PRO PRO A . n A 1 70 ASN 70 192 192 ASN ASN A . n A 1 71 ILE 71 193 193 ILE ILE A . n A 1 72 LEU 72 194 194 LEU LEU A . n A 1 73 ARG 73 195 195 ARG ARG A . n A 1 74 LEU 74 196 196 LEU LEU A . n A 1 75 TYR 75 197 197 TYR TYR A . n A 1 76 GLY 76 198 198 GLY GLY A . n A 1 77 TYR 77 199 199 TYR TYR A . n A 1 78 PHE 78 200 200 PHE PHE A . n A 1 79 HIS 79 201 201 HIS HIS A . n A 1 80 ASP 80 202 202 ASP ASP A . n A 1 81 ALA 81 203 203 ALA ALA A . n A 1 82 THR 82 204 204 THR THR A . n A 1 83 ARG 83 205 205 ARG ARG A . n A 1 84 VAL 84 206 206 VAL VAL A . n A 1 85 TYR 85 207 207 TYR TYR A . n A 1 86 LEU 86 208 208 LEU LEU A . n A 1 87 ILE 87 209 209 ILE ILE A . n A 1 88 LEU 88 210 210 LEU LEU A . n A 1 89 GLU 89 211 211 GLU GLU A . n A 1 90 TYR 90 212 212 TYR TYR A . n A 1 91 ALA 91 213 213 ALA ALA A . n A 1 92 PRO 92 214 214 PRO PRO A . n A 1 93 LEU 93 215 215 LEU LEU A . n A 1 94 GLY 94 216 216 GLY GLY A . n A 1 95 THR 95 217 217 THR THR A . n A 1 96 VAL 96 218 218 VAL VAL A . n A 1 97 TYR 97 219 219 TYR TYR A . n A 1 98 ARG 98 220 220 ARG ARG A . n A 1 99 GLU 99 221 221 GLU GLU A . n A 1 100 LEU 100 222 222 LEU LEU A . n A 1 101 GLN 101 223 223 GLN GLN A . n A 1 102 LYS 102 224 224 LYS LYS A . n A 1 103 LEU 103 225 225 LEU LEU A . n A 1 104 SER 104 226 226 SER SER A . n A 1 105 LYS 105 227 227 LYS LYS A . n A 1 106 PHE 106 228 228 PHE PHE A . n A 1 107 ASP 107 229 229 ASP ASP A . n A 1 108 GLU 108 230 230 GLU GLU A . n A 1 109 GLN 109 231 231 GLN GLN A . n A 1 110 ARG 110 232 232 ARG ARG A . n A 1 111 THR 111 233 233 THR THR A . n A 1 112 ALA 112 234 234 ALA ALA A . n A 1 113 THR 113 235 235 THR THR A . n A 1 114 TYR 114 236 236 TYR TYR A . n A 1 115 ILE 115 237 237 ILE ILE A . n A 1 116 THR 116 238 238 THR THR A . n A 1 117 GLU 117 239 239 GLU GLU A . n A 1 118 LEU 118 240 240 LEU LEU A . n A 1 119 ALA 119 241 241 ALA ALA A . n A 1 120 ASN 120 242 242 ASN ASN A . n A 1 121 ALA 121 243 243 ALA ALA A . n A 1 122 LEU 122 244 244 LEU LEU A . n A 1 123 SER 123 245 245 SER SER A . n A 1 124 TYR 124 246 246 TYR TYR A . n A 1 125 CYS 125 247 247 CYS CYS A . n A 1 126 HIS 126 248 248 HIS HIS A . n A 1 127 SER 127 249 249 SER SER A . n A 1 128 LYS 128 250 250 LYS LYS A . n A 1 129 ARG 129 251 251 ARG ARG A . n A 1 130 VAL 130 252 252 VAL VAL A . n A 1 131 ILE 131 253 253 ILE ILE A . n A 1 132 HIS 132 254 254 HIS HIS A . n A 1 133 ARG 133 255 255 ARG ARG A . n A 1 134 ASP 134 256 256 ASP ASP A . n A 1 135 ILE 135 257 257 ILE ILE A . n A 1 136 LYS 136 258 258 LYS LYS A . n A 1 137 PRO 137 259 259 PRO PRO A . n A 1 138 GLU 138 260 260 GLU GLU A . n A 1 139 ASN 139 261 261 ASN ASN A . n A 1 140 LEU 140 262 262 LEU LEU A . n A 1 141 LEU 141 263 263 LEU LEU A . n A 1 142 LEU 142 264 264 LEU LEU A . n A 1 143 GLY 143 265 265 GLY GLY A . n A 1 144 SER 144 266 266 SER SER A . n A 1 145 ALA 145 267 267 ALA ALA A . n A 1 146 GLY 146 268 268 GLY GLY A . n A 1 147 GLU 147 269 269 GLU GLU A . n A 1 148 LEU 148 270 270 LEU LEU A . n A 1 149 LYS 149 271 271 LYS LYS A . n A 1 150 ILE 150 272 272 ILE ILE A . n A 1 151 ALA 151 273 273 ALA ALA A . n A 1 152 ASP 152 274 274 ASP ASP A . n A 1 153 PHE 153 275 275 PHE PHE A . n A 1 154 GLY 154 276 276 GLY GLY A . n A 1 155 TRP 155 277 277 TRP TRP A . n A 1 156 SER 156 278 278 SER SER A . n A 1 157 VAL 157 279 279 VAL VAL A . n A 1 158 HIS 158 280 280 HIS HIS A . n A 1 159 ALA 159 281 281 ALA ALA A . n A 1 160 PRO 160 282 282 PRO PRO A . n A 1 161 SER 161 283 283 SER SER A . n A 1 162 SER 162 284 284 SER SER A . n A 1 163 ARG 163 285 285 ARG ARG A . n A 1 164 ARG 164 286 286 ARG ARG A . n A 1 165 ASP 165 287 287 ASP ASP A . n A 1 166 THR 166 288 288 THR THR A . n A 1 167 LEU 167 289 289 LEU LEU A . n A 1 168 CYS 168 290 290 CYS CYS A . n A 1 169 GLY 169 291 291 GLY GLY A . n A 1 170 THR 170 292 292 THR THR A . n A 1 171 LEU 171 293 293 LEU LEU A . n A 1 172 ASP 172 294 294 ASP ASP A . n A 1 173 TYR 173 295 295 TYR TYR A . n A 1 174 LEU 174 296 296 LEU LEU A . n A 1 175 PRO 175 297 297 PRO PRO A . n A 1 176 PRO 176 298 298 PRO PRO A . n A 1 177 GLU 177 299 299 GLU GLU A . n A 1 178 MET 178 300 300 MET MET A . n A 1 179 ILE 179 301 301 ILE ILE A . n A 1 180 GLU 180 302 302 GLU GLU A . n A 1 181 GLY 181 303 303 GLY GLY A . n A 1 182 ARG 182 304 304 ARG ARG A . n A 1 183 MET 183 305 305 MET MET A . n A 1 184 HIS 184 306 306 HIS HIS A . n A 1 185 ASP 185 307 307 ASP ASP A . n A 1 186 GLU 186 308 308 GLU GLU A . n A 1 187 LYS 187 309 309 LYS LYS A . n A 1 188 VAL 188 310 310 VAL VAL A . n A 1 189 ASP 189 311 311 ASP ASP A . n A 1 190 LEU 190 312 312 LEU LEU A . n A 1 191 TRP 191 313 313 TRP TRP A . n A 1 192 SER 192 314 314 SER SER A . n A 1 193 LEU 193 315 315 LEU LEU A . n A 1 194 GLY 194 316 316 GLY GLY A . n A 1 195 VAL 195 317 317 VAL VAL A . n A 1 196 LEU 196 318 318 LEU LEU A . n A 1 197 CYS 197 319 319 CYS CYS A . n A 1 198 TYR 198 320 320 TYR TYR A . n A 1 199 GLU 199 321 321 GLU GLU A . n A 1 200 PHE 200 322 322 PHE PHE A . n A 1 201 LEU 201 323 323 LEU LEU A . n A 1 202 VAL 202 324 324 VAL VAL A . n A 1 203 GLY 203 325 325 GLY GLY A . n A 1 204 LYS 204 326 326 LYS LYS A . n A 1 205 PRO 205 327 327 PRO PRO A . n A 1 206 PRO 206 328 328 PRO PRO A . n A 1 207 PHE 207 329 329 PHE PHE A . n A 1 208 GLU 208 330 330 GLU GLU A . n A 1 209 ALA 209 331 331 ALA ALA A . n A 1 210 ASN 210 332 332 ASN ASN A . n A 1 211 THR 211 333 333 THR THR A . n A 1 212 TYR 212 334 334 TYR TYR A . n A 1 213 GLN 213 335 335 GLN GLN A . n A 1 214 GLU 214 336 336 GLU GLU A . n A 1 215 THR 215 337 337 THR THR A . n A 1 216 TYR 216 338 338 TYR TYR A . n A 1 217 LYS 217 339 339 LYS LYS A . n A 1 218 ARG 218 340 340 ARG ARG A . n A 1 219 ILE 219 341 341 ILE ILE A . n A 1 220 SER 220 342 342 SER SER A . n A 1 221 ARG 221 343 343 ARG ARG A . n A 1 222 VAL 222 344 344 VAL VAL A . n A 1 223 GLU 223 345 345 GLU GLU A . n A 1 224 PHE 224 346 346 PHE PHE A . n A 1 225 THR 225 347 347 THR THR A . n A 1 226 PHE 226 348 348 PHE PHE A . n A 1 227 PRO 227 349 349 PRO PRO A . n A 1 228 ASP 228 350 350 ASP ASP A . n A 1 229 PHE 229 351 351 PHE PHE A . n A 1 230 VAL 230 352 352 VAL VAL A . n A 1 231 THR 231 353 353 THR THR A . n A 1 232 GLU 232 354 354 GLU GLU A . n A 1 233 GLY 233 355 355 GLY GLY A . n A 1 234 ALA 234 356 356 ALA ALA A . n A 1 235 ARG 235 357 357 ARG ARG A . n A 1 236 ASP 236 358 358 ASP ASP A . n A 1 237 LEU 237 359 359 LEU LEU A . n A 1 238 ILE 238 360 360 ILE ILE A . n A 1 239 SER 239 361 361 SER SER A . n A 1 240 ARG 240 362 362 ARG ARG A . n A 1 241 LEU 241 363 363 LEU LEU A . n A 1 242 LEU 242 364 364 LEU LEU A . n A 1 243 LYS 243 365 365 LYS LYS A . n A 1 244 HIS 244 366 366 HIS HIS A . n A 1 245 ASN 245 367 367 ASN ASN A . n A 1 246 PRO 246 368 368 PRO PRO A . n A 1 247 SER 247 369 369 SER SER A . n A 1 248 GLN 248 370 370 GLN GLN A . n A 1 249 ARG 249 371 371 ARG ARG A . n A 1 250 PRO 250 372 372 PRO PRO A . n A 1 251 MET 251 373 373 MET MET A . n A 1 252 LEU 252 374 374 LEU LEU A . n A 1 253 ARG 253 375 375 ARG ARG A . n A 1 254 GLU 254 376 376 GLU GLU A . n A 1 255 VAL 255 377 377 VAL VAL A . n A 1 256 LEU 256 378 378 LEU LEU A . n A 1 257 GLU 257 379 379 GLU GLU A . n A 1 258 HIS 258 380 380 HIS HIS A . n A 1 259 PRO 259 381 381 PRO PRO A . n A 1 260 TRP 260 382 382 TRP TRP A . n A 1 261 ILE 261 383 383 ILE ILE A . n A 1 262 THR 262 384 384 THR THR A . n A 1 263 ALA 263 385 385 ALA ALA A . n A 1 264 ASN 264 386 386 ASN ASN A . n A 1 265 SER 265 387 387 SER SER A . n A 1 266 SER 266 388 ? ? ? A . n A 1 267 LYS 267 389 ? ? ? A . n A 1 268 PRO 268 390 ? ? ? A . n A 1 269 SER 269 391 ? ? ? A . n A 1 270 ASN 270 392 ? ? ? A . n A 1 271 CYS 271 393 ? ? ? A . n A 1 272 GLN 272 394 ? ? ? A . n A 1 273 ASN 273 395 ? ? ? A . n A 1 274 LYS 274 396 ? ? ? A . n A 1 275 GLU 275 397 ? ? ? A . n A 1 276 SER 276 398 ? ? ? A . n A 1 277 ALA 277 399 ? ? ? A . n A 1 278 SER 278 400 ? ? ? A . n A 1 279 LYS 279 401 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 0C9 1 1 1 0C9 INH A . C 3 HOH 1 2 2 HOH HOH A . C 3 HOH 2 3 3 HOH HOH A . C 3 HOH 3 4 4 HOH HOH A . C 3 HOH 4 5 5 HOH HOH A . C 3 HOH 5 6 6 HOH HOH A . C 3 HOH 6 7 7 HOH HOH A . C 3 HOH 7 8 8 HOH HOH A . C 3 HOH 8 9 9 HOH HOH A . C 3 HOH 9 10 10 HOH HOH A . C 3 HOH 10 11 11 HOH HOH A . C 3 HOH 11 12 12 HOH HOH A . C 3 HOH 12 13 13 HOH HOH A . C 3 HOH 13 14 14 HOH HOH A . C 3 HOH 14 402 1 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 4 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-01-25 2 'Structure model' 1 1 2012-05-02 3 'Structure model' 1 2 2012-08-22 4 'Structure model' 1 3 2012-09-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal StructureStudio 'data collection' . ? 1 PHENIX 'model building' . ? 2 CNS refinement 1.3 ? 3 XDS 'data reduction' . ? 4 XDS 'data scaling' . ? 5 PHENIX phasing . ? 6 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE1 A GLU 336 ? ? 1_555 OE1 A GLU 336 ? ? 10_444 1.43 2 1 CG2 A VAL 279 ? ? 1_555 NH2 A ARG 286 ? ? 12_555 1.94 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 PRO _pdbx_validate_rmsd_bond.auth_seq_id_1 298 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 PRO _pdbx_validate_rmsd_bond.auth_seq_id_2 298 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.276 _pdbx_validate_rmsd_bond.bond_target_value 1.474 _pdbx_validate_rmsd_bond.bond_deviation -0.198 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.014 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A LYS 143 ? ? CA A LYS 143 ? ? C A LYS 143 ? ? 97.45 110.40 -12.95 2.00 N 2 1 N A LYS 143 ? ? CA A LYS 143 ? ? C A LYS 143 ? ? 132.77 111.00 21.77 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 130 ? ? -48.65 -19.96 2 1 LYS A 141 ? ? 65.69 -179.86 3 1 LYS A 143 ? ? -73.67 -71.74 4 1 GLU A 152 ? ? -68.21 98.78 5 1 LYS A 156 ? ? 78.09 -1.41 6 1 PHE A 165 ? ? -65.53 4.09 7 1 LYS A 166 ? ? 69.14 -60.40 8 1 LEU A 169 ? ? -92.68 -60.31 9 1 LYS A 171 ? ? -72.76 37.15 10 1 ALA A 172 ? ? -163.64 -0.02 11 1 GLU A 175 ? ? -29.12 -51.86 12 1 GLN A 177 ? ? -138.31 -30.74 13 1 GLN A 185 ? ? -49.92 -11.81 14 1 PHE A 200 ? ? -174.91 142.65 15 1 ASP A 202 ? ? -79.73 -163.39 16 1 SER A 226 ? ? 76.34 -55.50 17 1 ARG A 251 ? ? 43.88 19.60 18 1 ASP A 256 ? ? -156.15 49.33 19 1 PRO A 259 ? ? -67.00 3.47 20 1 PHE A 275 ? ? -79.21 24.67 21 1 CYS A 290 ? ? -38.78 -81.56 22 1 ASP A 294 ? ? -39.24 -30.76 23 1 THR A 384 ? ? -92.43 58.46 24 1 ALA A 385 ? ? -144.06 35.57 25 1 ASN A 386 ? ? -134.10 -140.23 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ARG _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 286 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 287 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -142.19 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 123 ? A SER 1 2 1 Y 1 A SER 388 ? A SER 266 3 1 Y 1 A LYS 389 ? A LYS 267 4 1 Y 1 A PRO 390 ? A PRO 268 5 1 Y 1 A SER 391 ? A SER 269 6 1 Y 1 A ASN 392 ? A ASN 270 7 1 Y 1 A CYS 393 ? A CYS 271 8 1 Y 1 A GLN 394 ? A GLN 272 9 1 Y 1 A ASN 395 ? A ASN 273 10 1 Y 1 A LYS 396 ? A LYS 274 11 1 Y 1 A GLU 397 ? A GLU 275 12 1 Y 1 A SER 398 ? A SER 276 13 1 Y 1 A ALA 399 ? A ALA 277 14 1 Y 1 A SER 400 ? A SER 278 15 1 Y 1 A LYS 401 ? A LYS 279 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-({2-[(4-carboxyphenyl)amino]pyrimidin-4-yl}amino)benzoic acid' 0C9 3 water HOH #