data_3UPG # _entry.id 3UPG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3UPG pdb_00003upg 10.2210/pdb3upg/pdb RCSB RCSB069045 ? ? WWPDB D_1000069045 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3UPG _pdbx_database_status.recvd_initial_deposition_date 2011-11-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Prasanth, P.' 1 'Putcha, B.K.' 2 'Arockiasamy, A.' 3 'Krishnaswamy, S.' 4 # _citation.id primary _citation.title 'Crystal structure of osmoporin (OmpC) loop deletion mutant: an Outer membrane protein from Salmonella typhi.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Prasanth, P.' 1 ? primary 'Putcha, B.K.' 2 ? primary 'Arockiasamy, A.' 3 ? primary 'Krishnaswamy, S.' 4 ? # _cell.entry_id 3UPG _cell.length_a 115.149 _cell.length_b 115.149 _cell.length_c 216.736 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3UPG _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Outer membrane protein C' 37296.180 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 4 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Porin ompC' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AEIYNKDGNKLDLFGKVDGLHYFSDDKGSDGDQTYMRIGFKGETQVNDQLTGYGQWEYQIQGNQTEGSNDSWTRVAFAGL KFADAGSFDYGRNYGVTYDVTSWTDVLPEFGGDTYGADNFMQQRGNGYATYRNTDFFGLVDGLDFALQYQGKNGSLLNQN GDGYGGSLTYAIGEGFSVGGAITTSKRTADQNNTANARLYGNGDRATVYTGGLKYDANNIYLAAQYSQTYNATRFGTSGF ANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDISNGYGASYGDQDIVKYVDVGATYYFNKNMSTYVDYKINLLDKNDFTR DAGINTDDIVALGLVYQF ; _entity_poly.pdbx_seq_one_letter_code_can ;AEIYNKDGNKLDLFGKVDGLHYFSDDKGSDGDQTYMRIGFKGETQVNDQLTGYGQWEYQIQGNQTEGSNDSWTRVAFAGL KFADAGSFDYGRNYGVTYDVTSWTDVLPEFGGDTYGADNFMQQRGNGYATYRNTDFFGLVDGLDFALQYQGKNGSLLNQN GDGYGGSLTYAIGEGFSVGGAITTSKRTADQNNTANARLYGNGDRATVYTGGLKYDANNIYLAAQYSQTYNATRFGTSGF ANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDISNGYGASYGDQDIVKYVDVGATYYFNKNMSTYVDYKINLLDKNDFTR DAGINTDDIVALGLVYQF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 ILE n 1 4 TYR n 1 5 ASN n 1 6 LYS n 1 7 ASP n 1 8 GLY n 1 9 ASN n 1 10 LYS n 1 11 LEU n 1 12 ASP n 1 13 LEU n 1 14 PHE n 1 15 GLY n 1 16 LYS n 1 17 VAL n 1 18 ASP n 1 19 GLY n 1 20 LEU n 1 21 HIS n 1 22 TYR n 1 23 PHE n 1 24 SER n 1 25 ASP n 1 26 ASP n 1 27 LYS n 1 28 GLY n 1 29 SER n 1 30 ASP n 1 31 GLY n 1 32 ASP n 1 33 GLN n 1 34 THR n 1 35 TYR n 1 36 MET n 1 37 ARG n 1 38 ILE n 1 39 GLY n 1 40 PHE n 1 41 LYS n 1 42 GLY n 1 43 GLU n 1 44 THR n 1 45 GLN n 1 46 VAL n 1 47 ASN n 1 48 ASP n 1 49 GLN n 1 50 LEU n 1 51 THR n 1 52 GLY n 1 53 TYR n 1 54 GLY n 1 55 GLN n 1 56 TRP n 1 57 GLU n 1 58 TYR n 1 59 GLN n 1 60 ILE n 1 61 GLN n 1 62 GLY n 1 63 ASN n 1 64 GLN n 1 65 THR n 1 66 GLU n 1 67 GLY n 1 68 SER n 1 69 ASN n 1 70 ASP n 1 71 SER n 1 72 TRP n 1 73 THR n 1 74 ARG n 1 75 VAL n 1 76 ALA n 1 77 PHE n 1 78 ALA n 1 79 GLY n 1 80 LEU n 1 81 LYS n 1 82 PHE n 1 83 ALA n 1 84 ASP n 1 85 ALA n 1 86 GLY n 1 87 SER n 1 88 PHE n 1 89 ASP n 1 90 TYR n 1 91 GLY n 1 92 ARG n 1 93 ASN n 1 94 TYR n 1 95 GLY n 1 96 VAL n 1 97 THR n 1 98 TYR n 1 99 ASP n 1 100 VAL n 1 101 THR n 1 102 SER n 1 103 TRP n 1 104 THR n 1 105 ASP n 1 106 VAL n 1 107 LEU n 1 108 PRO n 1 109 GLU n 1 110 PHE n 1 111 GLY n 1 112 GLY n 1 113 ASP n 1 114 THR n 1 115 TYR n 1 116 GLY n 1 117 ALA n 1 118 ASP n 1 119 ASN n 1 120 PHE n 1 121 MET n 1 122 GLN n 1 123 GLN n 1 124 ARG n 1 125 GLY n 1 126 ASN n 1 127 GLY n 1 128 TYR n 1 129 ALA n 1 130 THR n 1 131 TYR n 1 132 ARG n 1 133 ASN n 1 134 THR n 1 135 ASP n 1 136 PHE n 1 137 PHE n 1 138 GLY n 1 139 LEU n 1 140 VAL n 1 141 ASP n 1 142 GLY n 1 143 LEU n 1 144 ASP n 1 145 PHE n 1 146 ALA n 1 147 LEU n 1 148 GLN n 1 149 TYR n 1 150 GLN n 1 151 GLY n 1 152 LYS n 1 153 ASN n 1 154 GLY n 1 155 SER n 1 156 LEU n 1 157 LEU n 1 158 ASN n 1 159 GLN n 1 160 ASN n 1 161 GLY n 1 162 ASP n 1 163 GLY n 1 164 TYR n 1 165 GLY n 1 166 GLY n 1 167 SER n 1 168 LEU n 1 169 THR n 1 170 TYR n 1 171 ALA n 1 172 ILE n 1 173 GLY n 1 174 GLU n 1 175 GLY n 1 176 PHE n 1 177 SER n 1 178 VAL n 1 179 GLY n 1 180 GLY n 1 181 ALA n 1 182 ILE n 1 183 THR n 1 184 THR n 1 185 SER n 1 186 LYS n 1 187 ARG n 1 188 THR n 1 189 ALA n 1 190 ASP n 1 191 GLN n 1 192 ASN n 1 193 ASN n 1 194 THR n 1 195 ALA n 1 196 ASN n 1 197 ALA n 1 198 ARG n 1 199 LEU n 1 200 TYR n 1 201 GLY n 1 202 ASN n 1 203 GLY n 1 204 ASP n 1 205 ARG n 1 206 ALA n 1 207 THR n 1 208 VAL n 1 209 TYR n 1 210 THR n 1 211 GLY n 1 212 GLY n 1 213 LEU n 1 214 LYS n 1 215 TYR n 1 216 ASP n 1 217 ALA n 1 218 ASN n 1 219 ASN n 1 220 ILE n 1 221 TYR n 1 222 LEU n 1 223 ALA n 1 224 ALA n 1 225 GLN n 1 226 TYR n 1 227 SER n 1 228 GLN n 1 229 THR n 1 230 TYR n 1 231 ASN n 1 232 ALA n 1 233 THR n 1 234 ARG n 1 235 PHE n 1 236 GLY n 1 237 THR n 1 238 SER n 1 239 GLY n 1 240 PHE n 1 241 ALA n 1 242 ASN n 1 243 LYS n 1 244 ALA n 1 245 GLN n 1 246 ASN n 1 247 PHE n 1 248 GLU n 1 249 VAL n 1 250 VAL n 1 251 ALA n 1 252 GLN n 1 253 TYR n 1 254 GLN n 1 255 PHE n 1 256 ASP n 1 257 PHE n 1 258 GLY n 1 259 LEU n 1 260 ARG n 1 261 PRO n 1 262 SER n 1 263 VAL n 1 264 ALA n 1 265 TYR n 1 266 LEU n 1 267 GLN n 1 268 SER n 1 269 LYS n 1 270 GLY n 1 271 LYS n 1 272 ASP n 1 273 ILE n 1 274 SER n 1 275 ASN n 1 276 GLY n 1 277 TYR n 1 278 GLY n 1 279 ALA n 1 280 SER n 1 281 TYR n 1 282 GLY n 1 283 ASP n 1 284 GLN n 1 285 ASP n 1 286 ILE n 1 287 VAL n 1 288 LYS n 1 289 TYR n 1 290 VAL n 1 291 ASP n 1 292 VAL n 1 293 GLY n 1 294 ALA n 1 295 THR n 1 296 TYR n 1 297 TYR n 1 298 PHE n 1 299 ASN n 1 300 LYS n 1 301 ASN n 1 302 MET n 1 303 SER n 1 304 THR n 1 305 TYR n 1 306 VAL n 1 307 ASP n 1 308 TYR n 1 309 LYS n 1 310 ILE n 1 311 ASN n 1 312 LEU n 1 313 LEU n 1 314 ASP n 1 315 LYS n 1 316 ASN n 1 317 ASP n 1 318 PHE n 1 319 THR n 1 320 ARG n 1 321 ASP n 1 322 ALA n 1 323 GLY n 1 324 ILE n 1 325 ASN n 1 326 THR n 1 327 ASP n 1 328 ASP n 1 329 ILE n 1 330 VAL n 1 331 ALA n 1 332 LEU n 1 333 GLY n 1 334 LEU n 1 335 VAL n 1 336 TYR n 1 337 GLN n 1 338 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ompC, STM2267' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Ty21a _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella enterica subsp. enterica serovar Typhimurium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 90371 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-21b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OMPC_SALTY _struct_ref.pdbx_db_accession P0A263 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEIYNKDGNKLDLFGKVDGLHYFSDDKGSDGDQTYMRIGFKGETQVNDQLTGYGQWEYQIQGNQTEGSNDSWTRVAFAGL KFADAGSFDYGRNYGVTYDVTSWTDVLPEFGGDTYGADNFMQQRGNGYATYRNTDFFGLVDGLDFALQYQGKNGSVSGEN TNGRSLLNQNGDGYGGSLTYAIGEGFSVGGAITTSKRTADQNNTANARLYGNGDRATVYTGGLKYDANNIYLAAQYSQTY NATRFGTSNGSNPSTSYGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDISNGYGASYGDQDIVKYVDVGATYYFNKN MSTYVDYKINLLDKNDFTRDAGINTDDIVALGLVYQF ; _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3UPG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 338 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A263 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 378 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 338 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3UPG ? A ? ? UNP P0A263 VAL 177 deletion ? 1 1 3UPG ? A ? ? UNP P0A263 SER 178 deletion ? 2 1 3UPG ? A ? ? UNP P0A263 GLY 179 deletion ? 3 1 3UPG ? A ? ? UNP P0A263 GLU 180 deletion ? 4 1 3UPG ? A ? ? UNP P0A263 ASN 181 deletion ? 5 1 3UPG ? A ? ? UNP P0A263 THR 182 deletion ? 6 1 3UPG ? A ? ? UNP P0A263 ASN 183 deletion ? 7 1 3UPG ? A ? ? UNP P0A263 GLY 184 deletion ? 8 1 3UPG ? A ? ? UNP P0A263 ARG 185 deletion ? 9 1 3UPG ? A ? ? UNP P0A263 SER 186 deletion ? 10 1 3UPG ? A ? ? UNP P0A263 ASN 270 deletion ? 11 1 3UPG ? A ? ? UNP P0A263 GLY 271 deletion ? 12 1 3UPG ? A ? ? UNP P0A263 SER 272 deletion ? 13 1 3UPG ? A ? ? UNP P0A263 ASN 273 deletion ? 14 1 3UPG ? A ? ? UNP P0A263 PRO 274 deletion ? 15 1 3UPG ? A ? ? UNP P0A263 SER 275 deletion ? 16 1 3UPG ? A ? ? UNP P0A263 THR 276 deletion ? 17 1 3UPG ? A ? ? UNP P0A263 SER 277 deletion ? 18 1 3UPG ? A ? ? UNP P0A263 TYR 278 deletion ? 19 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3UPG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 5.56 _exptl_crystal.density_percent_sol 77.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.temp 298.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.1 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '20% Polyethylene glycol 3350, 0.2M Calcium chloride dihydrate, pH 5.1, Microbatch, temperature 298.15K' # _diffrn.id 1 _diffrn.ambient_temp 77.03 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2009-06-28 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97869 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97869 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 3UPG _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 108.37 _reflns.d_resolution_high 3.20 _reflns.number_obs 14582 _reflns.number_all 14709 _reflns.percent_possible_obs 99.1 _reflns.pdbx_Rmerge_I_obs 0.144 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.21 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 3.20 _reflns_shell.d_res_low 3.31 _reflns_shell.percent_possible_all 97.2 _reflns_shell.Rmerge_I_obs 0.455 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.25 _reflns_shell.pdbx_redundancy 5.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3UPG _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 13846 _refine.ls_number_reflns_all 14709 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 3.20 _refine.ls_percent_reflns_obs 99.14 _refine.ls_R_factor_obs 0.28953 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.28772 _refine.ls_R_factor_R_free 0.32456 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 730 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.820 _refine.correlation_coeff_Fo_to_Fc_free 0.858 _refine.B_iso_mean 91.449 _refine.aniso_B[1][1] 5.28 _refine.aniso_B[2][2] 5.28 _refine.aniso_B[3][3] -7.92 _refine.aniso_B[1][2] 2.64 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 2JN1' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model Overall _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.730 _refine.pdbx_overall_ESU_R_Free 0.446 _refine.overall_SU_ML 0.459 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 62.001 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2406 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 2449 _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.022 ? 2459 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.701 1.921 ? 3330 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 9.818 5.000 ? 308 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 41.073 25.074 ? 136 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 24.267 15.000 ? 351 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 24.824 15.000 ? 8 'X-RAY DIFFRACTION' ? r_chiral_restr 0.109 0.200 ? 337 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 1985 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.792 1.500 ? 1512 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.493 2.000 ? 2382 'X-RAY DIFFRACTION' ? r_scbond_it 1.502 3.000 ? 947 'X-RAY DIFFRACTION' ? r_scangle_it 2.560 4.500 ? 948 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 3.200 _refine_ls_shell.d_res_low 3.283 _refine_ls_shell.number_reflns_R_work 968 _refine_ls_shell.R_factor_R_work 0.380 _refine_ls_shell.percent_reflns_obs 97.42 _refine_ls_shell.R_factor_R_free 0.468 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 50 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 3UPG _struct.title 'Loop deletion mutant of Salmonella typhi osmoporin (OmpC):an Outer Membrane Protein.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3UPG _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'Beta Barrel, Transport protein, Non specific Porin, Osmoporin, Outer Membrane, Membrane Protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 97 ? SER A 102 ? THR A 97 SER A 102 1 ? 6 HELX_P HELX_P2 2 TRP A 103 ? ASP A 105 ? TRP A 103 ASP A 105 5 ? 3 HELX_P HELX_P3 3 ASN A 316 ? ALA A 322 ? ASN A 316 ALA A 322 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 135 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 135 A CA 401 1_555 ? ? ? ? ? ? ? 2.755 ? ? metalc2 metalc ? ? A ASP 328 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 328 A CA 402 1_555 ? ? ? ? ? ? ? 3.189 ? ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 401 A HOH 637 1_555 ? ? ? ? ? ? ? 2.167 ? ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 401 A HOH 638 1_555 ? ? ? ? ? ? ? 2.191 ? ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 402 A HOH 635 1_555 ? ? ? ? ? ? ? 2.647 ? ? metalc6 metalc ? ? C CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 402 A HOH 636 1_555 ? ? ? ? ? ? ? 1.961 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 19 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel B 7 8 ? anti-parallel B 8 9 ? anti-parallel B 9 10 ? anti-parallel B 10 11 ? anti-parallel B 11 12 ? anti-parallel B 12 13 ? anti-parallel B 13 14 ? anti-parallel B 14 15 ? anti-parallel B 15 16 ? anti-parallel B 16 17 ? anti-parallel B 17 18 ? anti-parallel B 18 19 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 2 ? LYS A 6 ? GLU A 2 LYS A 6 A 2 ASN A 9 ? ASP A 12 ? ASN A 9 ASP A 12 A 3 TYR A 35 ? GLN A 45 ? TYR A 35 GLN A 45 A 4 GLY A 15 ? PHE A 23 ? GLY A 15 PHE A 23 A 5 GLY A 31 ? ASP A 32 ? GLY A 31 ASP A 32 B 1 GLU A 2 ? LYS A 6 ? GLU A 2 LYS A 6 B 2 ASN A 9 ? ASP A 12 ? ASN A 9 ASP A 12 B 3 TYR A 35 ? GLN A 45 ? TYR A 35 GLN A 45 B 4 LEU A 50 ? GLN A 61 ? LEU A 50 GLN A 61 B 5 SER A 71 ? PHE A 82 ? SER A 71 PHE A 82 B 6 SER A 87 ? ARG A 92 ? SER A 87 ARG A 92 B 7 ALA A 129 ? ASN A 133 ? ALA A 129 ASN A 133 B 8 LEU A 143 ? GLN A 150 ? LEU A 143 GLN A 150 B 9 GLY A 163 ? TYR A 170 ? GLY A 163 TYR A 170 B 10 PHE A 176 ? THR A 184 ? PHE A 176 THR A 184 B 11 THR A 207 ? ALA A 217 ? THR A 207 ALA A 217 B 12 ILE A 220 ? GLN A 228 ? ILE A 220 GLN A 228 B 13 GLN A 245 ? TYR A 253 ? GLN A 245 TYR A 253 B 14 ARG A 260 ? LYS A 269 ? ARG A 260 LYS A 269 B 15 ASP A 285 ? ASN A 299 ? ASP A 285 ASN A 299 B 16 MET A 302 ? ASN A 311 ? MET A 302 ASN A 311 B 17 ILE A 329 ? TYR A 336 ? ILE A 329 TYR A 336 B 18 GLY A 15 ? PHE A 23 ? GLY A 15 PHE A 23 B 19 GLY A 31 ? ASP A 32 ? GLY A 31 ASP A 32 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 3 ? N ILE A 3 O LEU A 11 ? O LEU A 11 A 2 3 N ASP A 12 ? N ASP A 12 O LYS A 41 ? O LYS A 41 A 3 4 O ARG A 37 ? O ARG A 37 N LYS A 16 ? N LYS A 16 A 4 5 N TYR A 22 ? N TYR A 22 O GLY A 31 ? O GLY A 31 B 1 2 N ILE A 3 ? N ILE A 3 O LEU A 11 ? O LEU A 11 B 2 3 N ASP A 12 ? N ASP A 12 O LYS A 41 ? O LYS A 41 B 3 4 N ILE A 38 ? N ILE A 38 O TYR A 58 ? O TYR A 58 B 4 5 N GLU A 57 ? N GLU A 57 O ARG A 74 ? O ARG A 74 B 5 6 N ALA A 76 ? N ALA A 76 O ARG A 92 ? O ARG A 92 B 6 7 N SER A 87 ? N SER A 87 O ARG A 132 ? O ARG A 132 B 7 8 N ASN A 133 ? N ASN A 133 O PHE A 145 ? O PHE A 145 B 8 9 N ALA A 146 ? N ALA A 146 O SER A 167 ? O SER A 167 B 9 10 N LEU A 168 ? N LEU A 168 O GLY A 180 ? O GLY A 180 B 10 11 N THR A 183 ? N THR A 183 O VAL A 208 ? O VAL A 208 B 11 12 N TYR A 209 ? N TYR A 209 O GLN A 228 ? O GLN A 228 B 12 13 N GLN A 225 ? N GLN A 225 O GLU A 248 ? O GLU A 248 B 13 14 N VAL A 249 ? N VAL A 249 O TYR A 265 ? O TYR A 265 B 14 15 N SER A 262 ? N SER A 262 O GLY A 293 ? O GLY A 293 B 15 16 N TYR A 296 ? N TYR A 296 O THR A 304 ? O THR A 304 B 16 17 N LYS A 309 ? N LYS A 309 O ILE A 329 ? O ILE A 329 B 17 18 O LEU A 334 ? O LEU A 334 N GLY A 19 ? N GLY A 19 B 18 19 N TYR A 22 ? N TYR A 22 O GLY A 31 ? O GLY A 31 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 401 ? 4 'BINDING SITE FOR RESIDUE CA A 401' AC2 Software A CA 402 ? 5 'BINDING SITE FOR RESIDUE CA A 402' AC3 Software A CL 403 ? 2 'BINDING SITE FOR RESIDUE CL A 403' AC4 Software A CL 404 ? 5 'BINDING SITE FOR RESIDUE CL A 404' AC5 Software A CL 405 ? 3 'BINDING SITE FOR RESIDUE CL A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 135 ? ASP A 135 . ? 1_555 ? 2 AC1 4 ASP A 144 ? ASP A 144 . ? 1_555 ? 3 AC1 4 HOH G . ? HOH A 637 . ? 1_555 ? 4 AC1 4 HOH G . ? HOH A 638 . ? 1_555 ? 5 AC2 5 ASN A 311 ? ASN A 311 . ? 1_555 ? 6 AC2 5 THR A 326 ? THR A 326 . ? 1_555 ? 7 AC2 5 ASP A 328 ? ASP A 328 . ? 1_555 ? 8 AC2 5 HOH G . ? HOH A 635 . ? 1_555 ? 9 AC2 5 HOH G . ? HOH A 636 . ? 1_555 ? 10 AC3 2 THR A 114 ? THR A 114 . ? 1_555 ? 11 AC3 2 ASN A 119 ? ASN A 119 . ? 1_555 ? 12 AC4 5 ARG A 37 ? ARG A 37 . ? 1_555 ? 13 AC4 5 GLN A 59 ? GLN A 59 . ? 1_555 ? 14 AC4 5 TRP A 72 ? TRP A 72 . ? 1_555 ? 15 AC4 5 ARG A 74 ? ARG A 74 . ? 1_555 ? 16 AC4 5 ARG A 124 ? ARG A 124 . ? 1_555 ? 17 AC5 3 ASN A 69 ? ASN A 69 . ? 3_655 ? 18 AC5 3 ASN A 69 ? ASN A 69 . ? 1_555 ? 19 AC5 3 ASN A 69 ? ASN A 69 . ? 2_545 ? # _database_PDB_matrix.entry_id 3UPG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3UPG _atom_sites.fract_transf_matrix[1][1] 0.008684 _atom_sites.fract_transf_matrix[1][2] 0.005014 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010028 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004614 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 TRP 103 103 103 TRP TRP A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 TYR 149 149 149 TYR TYR A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ASN 153 153 ? ? ? A . n A 1 154 GLY 154 154 ? ? ? A . n A 1 155 SER 155 155 ? ? ? A . n A 1 156 LEU 156 156 ? ? ? A . n A 1 157 LEU 157 157 ? ? ? A . n A 1 158 ASN 158 158 ? ? ? A . n A 1 159 GLN 159 159 ? ? ? A . n A 1 160 ASN 160 160 ? ? ? A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 TYR 170 170 170 TYR TYR A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 ARG 187 187 ? ? ? A . n A 1 188 THR 188 188 ? ? ? A . n A 1 189 ALA 189 189 ? ? ? A . n A 1 190 ASP 190 190 ? ? ? A . n A 1 191 GLN 191 191 ? ? ? A . n A 1 192 ASN 192 192 ? ? ? A . n A 1 193 ASN 193 193 ? ? ? A . n A 1 194 THR 194 194 ? ? ? A . n A 1 195 ALA 195 195 ? ? ? A . n A 1 196 ASN 196 196 ? ? ? A . n A 1 197 ALA 197 197 ? ? ? A . n A 1 198 ARG 198 198 ? ? ? A . n A 1 199 LEU 199 199 ? ? ? A . n A 1 200 TYR 200 200 ? ? ? A . n A 1 201 GLY 201 201 ? ? ? A . n A 1 202 ASN 202 202 ? ? ? A . n A 1 203 GLY 203 203 ? ? ? A . n A 1 204 ASP 204 204 ? ? ? A . n A 1 205 ARG 205 205 ? ? ? A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 TYR 209 209 209 TYR TYR A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 ASN 218 218 218 ASN ASN A . n A 1 219 ASN 219 219 219 ASN ASN A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 TYR 221 221 221 TYR TYR A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 GLN 225 225 225 GLN GLN A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 GLN 228 228 228 GLN GLN A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 ASN 231 231 231 ASN ASN A . n A 1 232 ALA 232 232 232 ALA ALA A . n A 1 233 THR 233 233 233 THR THR A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 PHE 235 235 235 PHE PHE A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 LYS 243 243 243 LYS LYS A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 GLN 245 245 245 GLN GLN A . n A 1 246 ASN 246 246 246 ASN ASN A . n A 1 247 PHE 247 247 247 PHE PHE A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 VAL 250 250 250 VAL VAL A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 TYR 253 253 253 TYR TYR A . n A 1 254 GLN 254 254 254 GLN GLN A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 PHE 257 257 257 PHE PHE A . n A 1 258 GLY 258 258 258 GLY GLY A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 ARG 260 260 260 ARG ARG A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 VAL 263 263 263 VAL VAL A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 TYR 265 265 265 TYR TYR A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 GLN 267 267 267 GLN GLN A . n A 1 268 SER 268 268 268 SER SER A . n A 1 269 LYS 269 269 269 LYS LYS A . n A 1 270 GLY 270 270 270 GLY GLY A . n A 1 271 LYS 271 271 271 LYS LYS A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 SER 274 274 274 SER SER A . n A 1 275 ASN 275 275 275 ASN ASN A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 TYR 277 277 277 TYR TYR A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 SER 280 280 280 SER SER A . n A 1 281 TYR 281 281 281 TYR TYR A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 GLN 284 284 284 GLN GLN A . n A 1 285 ASP 285 285 285 ASP ASP A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 VAL 287 287 287 VAL VAL A . n A 1 288 LYS 288 288 288 LYS LYS A . n A 1 289 TYR 289 289 289 TYR TYR A . n A 1 290 VAL 290 290 290 VAL VAL A . n A 1 291 ASP 291 291 291 ASP ASP A . n A 1 292 VAL 292 292 292 VAL VAL A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 ALA 294 294 294 ALA ALA A . n A 1 295 THR 295 295 295 THR THR A . n A 1 296 TYR 296 296 296 TYR TYR A . n A 1 297 TYR 297 297 297 TYR TYR A . n A 1 298 PHE 298 298 298 PHE PHE A . n A 1 299 ASN 299 299 299 ASN ASN A . n A 1 300 LYS 300 300 300 LYS LYS A . n A 1 301 ASN 301 301 301 ASN ASN A . n A 1 302 MET 302 302 302 MET MET A . n A 1 303 SER 303 303 303 SER SER A . n A 1 304 THR 304 304 304 THR THR A . n A 1 305 TYR 305 305 305 TYR TYR A . n A 1 306 VAL 306 306 306 VAL VAL A . n A 1 307 ASP 307 307 307 ASP ASP A . n A 1 308 TYR 308 308 308 TYR TYR A . n A 1 309 LYS 309 309 309 LYS LYS A . n A 1 310 ILE 310 310 310 ILE ILE A . n A 1 311 ASN 311 311 311 ASN ASN A . n A 1 312 LEU 312 312 312 LEU LEU A . n A 1 313 LEU 313 313 313 LEU LEU A . n A 1 314 ASP 314 314 314 ASP ASP A . n A 1 315 LYS 315 315 315 LYS LYS A . n A 1 316 ASN 316 316 316 ASN ASN A . n A 1 317 ASP 317 317 317 ASP ASP A . n A 1 318 PHE 318 318 318 PHE PHE A . n A 1 319 THR 319 319 319 THR THR A . n A 1 320 ARG 320 320 320 ARG ARG A . n A 1 321 ASP 321 321 321 ASP ASP A . n A 1 322 ALA 322 322 322 ALA ALA A . n A 1 323 GLY 323 323 323 GLY GLY A . n A 1 324 ILE 324 324 324 ILE ILE A . n A 1 325 ASN 325 325 325 ASN ASN A . n A 1 326 THR 326 326 326 THR THR A . n A 1 327 ASP 327 327 327 ASP ASP A . n A 1 328 ASP 328 328 328 ASP ASP A . n A 1 329 ILE 329 329 329 ILE ILE A . n A 1 330 VAL 330 330 330 VAL VAL A . n A 1 331 ALA 331 331 331 ALA ALA A . n A 1 332 LEU 332 332 332 LEU LEU A . n A 1 333 GLY 333 333 333 GLY GLY A . n A 1 334 LEU 334 334 334 LEU LEU A . n A 1 335 VAL 335 335 335 VAL VAL A . n A 1 336 TYR 336 336 336 TYR TYR A . n A 1 337 GLN 337 337 337 GLN GLN A . n A 1 338 PHE 338 338 338 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 401 401 CA CA A . C 2 CA 1 402 402 CA CA A . D 3 CL 1 403 501 CL CL A . E 3 CL 1 404 502 CL CL A . F 3 CL 1 405 503 CL CL A . G 4 HOH 1 601 601 HOH HOH A . G 4 HOH 2 602 602 HOH HOH A . G 4 HOH 3 603 603 HOH HOH A . G 4 HOH 4 604 604 HOH HOH A . G 4 HOH 5 605 605 HOH HOH A . G 4 HOH 6 606 606 HOH HOH A . G 4 HOH 7 607 607 HOH HOH A . G 4 HOH 8 608 608 HOH HOH A . G 4 HOH 9 609 609 HOH HOH A . G 4 HOH 10 610 610 HOH HOH A . G 4 HOH 11 611 611 HOH HOH A . G 4 HOH 12 612 612 HOH HOH A . G 4 HOH 13 613 613 HOH HOH A . G 4 HOH 14 614 614 HOH HOH A . G 4 HOH 15 615 615 HOH HOH A . G 4 HOH 16 616 616 HOH HOH A . G 4 HOH 17 617 617 HOH HOH A . G 4 HOH 18 618 618 HOH HOH A . G 4 HOH 19 619 619 HOH HOH A . G 4 HOH 20 620 620 HOH HOH A . G 4 HOH 21 621 621 HOH HOH A . G 4 HOH 22 622 622 HOH HOH A . G 4 HOH 23 623 623 HOH HOH A . G 4 HOH 24 624 624 HOH HOH A . G 4 HOH 25 625 625 HOH HOH A . G 4 HOH 26 626 626 HOH HOH A . G 4 HOH 27 627 627 HOH HOH A . G 4 HOH 28 628 628 HOH HOH A . G 4 HOH 29 629 629 HOH HOH A . G 4 HOH 30 630 630 HOH HOH A . G 4 HOH 31 631 631 HOH HOH A . G 4 HOH 32 632 632 HOH HOH A . G 4 HOH 33 633 633 HOH HOH A . G 4 HOH 34 634 634 HOH HOH A . G 4 HOH 35 635 635 HOH HOH A . G 4 HOH 36 636 636 HOH HOH A . G 4 HOH 37 637 637 HOH HOH A . G 4 HOH 38 638 638 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9320 ? 1 MORE -179 ? 1 'SSA (A^2)' 38500 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -y,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 57.5745000000 0.8660254038 -0.5000000000 0.0000000000 -99.7219592204 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038 0.0000000000 115.1490000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 405 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 135 ? A ASP 135 ? 1_555 CA ? B CA . ? A CA 401 ? 1_555 O ? G HOH . ? A HOH 637 ? 1_555 130.4 ? 2 OD1 ? A ASP 135 ? A ASP 135 ? 1_555 CA ? B CA . ? A CA 401 ? 1_555 O ? G HOH . ? A HOH 638 ? 1_555 139.7 ? 3 O ? G HOH . ? A HOH 637 ? 1_555 CA ? B CA . ? A CA 401 ? 1_555 O ? G HOH . ? A HOH 638 ? 1_555 74.8 ? 4 OD1 ? A ASP 328 ? A ASP 328 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 635 ? 1_555 53.0 ? 5 OD1 ? A ASP 328 ? A ASP 328 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 636 ? 1_555 93.8 ? 6 O ? G HOH . ? A HOH 635 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 636 ? 1_555 122.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-11-28 2 'Structure model' 1 1 2023-11-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn 7 2 'Structure model' struct_ref_seq_dif 8 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.value' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 2 'Structure model' '_struct_ref_seq_dif.details' 31 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 56.9813 _pdbx_refine_tls.origin_y -10.9717 _pdbx_refine_tls.origin_z -27.6936 _pdbx_refine_tls.T[1][1] 0.4942 _pdbx_refine_tls.T[2][2] 0.1786 _pdbx_refine_tls.T[3][3] 0.0116 _pdbx_refine_tls.T[1][2] 0.0413 _pdbx_refine_tls.T[1][3] -0.0373 _pdbx_refine_tls.T[2][3] -0.1268 _pdbx_refine_tls.L[1][1] 1.3521 _pdbx_refine_tls.L[2][2] 0.9963 _pdbx_refine_tls.L[3][3] 1.2737 _pdbx_refine_tls.L[1][2] 0.4833 _pdbx_refine_tls.L[1][3] -0.3639 _pdbx_refine_tls.L[2][3] 0.4479 _pdbx_refine_tls.S[1][1] -0.0327 _pdbx_refine_tls.S[1][2] -0.2054 _pdbx_refine_tls.S[1][3] -0.0711 _pdbx_refine_tls.S[2][1] 0.0092 _pdbx_refine_tls.S[2][2] -0.0549 _pdbx_refine_tls.S[2][3] -0.0151 _pdbx_refine_tls.S[3][1] -0.2575 _pdbx_refine_tls.S[3][2] 0.0317 _pdbx_refine_tls.S[3][3] 0.0876 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 338 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.5.0109 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TYR 209 ? ? OG A SER 227 ? ? 1.61 2 1 O A VAL 46 ? ? O A LEU 50 ? ? 1.88 3 1 O A SER 280 ? ? N A GLY 282 ? ? 2.11 4 1 O A ALA 181 ? ? O A HOH 610 ? ? 2.13 5 1 O A TYR 164 ? ? O A HOH 605 ? ? 2.16 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASN _pdbx_validate_rmsd_angle.auth_seq_id_1 47 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASN _pdbx_validate_rmsd_angle.auth_seq_id_2 47 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASN _pdbx_validate_rmsd_angle.auth_seq_id_3 47 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 92.89 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -18.11 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 26 ? ? -38.46 113.01 2 1 SER A 29 ? ? -123.43 -78.45 3 1 ASP A 30 ? ? -34.61 119.56 4 1 ASN A 47 ? ? 176.41 -158.68 5 1 TRP A 56 ? ? -172.39 128.36 6 1 ALA A 83 ? ? -52.59 106.54 7 1 ASP A 84 ? ? 89.80 -13.72 8 1 GLU A 109 ? ? -123.37 -69.10 9 1 ASP A 113 ? ? 48.84 -31.49 10 1 ASN A 119 ? ? -92.08 58.07 11 1 MET A 121 ? ? 125.00 -46.32 12 1 GLN A 123 ? ? -114.66 -130.46 13 1 ARG A 124 ? ? -64.10 -172.76 14 1 PHE A 136 ? ? 31.18 69.24 15 1 LEU A 139 ? ? -83.44 -72.69 16 1 ASP A 162 ? ? -44.26 152.07 17 1 ILE A 172 ? ? -69.35 81.59 18 1 GLU A 174 ? ? 38.58 -126.50 19 1 ALA A 217 ? ? -141.25 -158.63 20 1 ASN A 218 ? ? -24.70 90.78 21 1 ASN A 219 ? ? 31.79 16.81 22 1 TYR A 230 ? ? -89.42 -84.08 23 1 THR A 233 ? ? 29.68 -140.03 24 1 ARG A 234 ? ? -9.12 84.95 25 1 LEU A 259 ? ? 170.13 121.89 26 1 ASP A 272 ? ? 2.81 90.22 27 1 ALA A 279 ? ? 66.13 -53.23 28 1 SER A 280 ? ? 70.00 -35.51 29 1 TYR A 281 ? ? 29.91 -27.43 30 1 PHE A 298 ? ? -67.89 -77.10 31 1 LYS A 315 ? ? -59.91 103.79 32 1 ARG A 320 ? ? -36.18 -82.50 33 1 GLN A 337 ? ? -101.82 -163.46 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLN A 45 ? ? VAL A 46 ? ? 149.70 2 1 VAL A 46 ? ? ASN A 47 ? ? 77.57 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id VAL _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 46 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 15.88 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 147 ? CD1 ? A LEU 147 CD1 2 1 Y 1 A LEU 147 ? CD2 ? A LEU 147 CD2 3 1 Y 1 A PHE 240 ? CG ? A PHE 240 CG 4 1 Y 1 A PHE 240 ? CD1 ? A PHE 240 CD1 5 1 Y 1 A PHE 240 ? CD2 ? A PHE 240 CD2 6 1 Y 1 A PHE 240 ? CE1 ? A PHE 240 CE1 7 1 Y 1 A PHE 240 ? CE2 ? A PHE 240 CE2 8 1 Y 1 A PHE 240 ? CZ ? A PHE 240 CZ 9 1 Y 1 A LYS 243 ? CG ? A LYS 243 CG 10 1 Y 1 A LYS 243 ? CD ? A LYS 243 CD 11 1 Y 1 A LYS 243 ? CE ? A LYS 243 CE 12 1 Y 1 A LYS 243 ? NZ ? A LYS 243 NZ 13 1 Y 1 A LYS 269 ? CG ? A LYS 269 CG 14 1 Y 1 A LYS 269 ? CD ? A LYS 269 CD 15 1 Y 1 A LYS 269 ? CE ? A LYS 269 CE 16 1 Y 1 A LYS 269 ? NZ ? A LYS 269 NZ 17 1 Y 1 A TYR 277 ? CG ? A TYR 277 CG 18 1 Y 1 A TYR 277 ? CD1 ? A TYR 277 CD1 19 1 Y 1 A TYR 277 ? CD2 ? A TYR 277 CD2 20 1 Y 1 A TYR 277 ? CE1 ? A TYR 277 CE1 21 1 Y 1 A TYR 277 ? CE2 ? A TYR 277 CE2 22 1 Y 1 A TYR 277 ? CZ ? A TYR 277 CZ 23 1 Y 1 A TYR 277 ? OH ? A TYR 277 OH 24 1 Y 1 A LYS 300 ? CG ? A LYS 300 CG 25 1 Y 1 A LYS 300 ? CD ? A LYS 300 CD 26 1 Y 1 A LYS 300 ? CE ? A LYS 300 CE 27 1 Y 1 A LYS 300 ? NZ ? A LYS 300 NZ 28 1 Y 1 A LYS 315 ? CE ? A LYS 315 CE 29 1 Y 1 A LYS 315 ? NZ ? A LYS 315 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 153 ? A ASN 153 2 1 Y 1 A GLY 154 ? A GLY 154 3 1 Y 1 A SER 155 ? A SER 155 4 1 Y 1 A LEU 156 ? A LEU 156 5 1 Y 1 A LEU 157 ? A LEU 157 6 1 Y 1 A ASN 158 ? A ASN 158 7 1 Y 1 A GLN 159 ? A GLN 159 8 1 Y 1 A ASN 160 ? A ASN 160 9 1 Y 1 A ARG 187 ? A ARG 187 10 1 Y 1 A THR 188 ? A THR 188 11 1 Y 1 A ALA 189 ? A ALA 189 12 1 Y 1 A ASP 190 ? A ASP 190 13 1 Y 1 A GLN 191 ? A GLN 191 14 1 Y 1 A ASN 192 ? A ASN 192 15 1 Y 1 A ASN 193 ? A ASN 193 16 1 Y 1 A THR 194 ? A THR 194 17 1 Y 1 A ALA 195 ? A ALA 195 18 1 Y 1 A ASN 196 ? A ASN 196 19 1 Y 1 A ALA 197 ? A ALA 197 20 1 Y 1 A ARG 198 ? A ARG 198 21 1 Y 1 A LEU 199 ? A LEU 199 22 1 Y 1 A TYR 200 ? A TYR 200 23 1 Y 1 A GLY 201 ? A GLY 201 24 1 Y 1 A ASN 202 ? A ASN 202 25 1 Y 1 A GLY 203 ? A GLY 203 26 1 Y 1 A ASP 204 ? A ASP 204 27 1 Y 1 A ARG 205 ? A ARG 205 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CL CL CL N N 75 GLN N N N N 76 GLN CA C N S 77 GLN C C N N 78 GLN O O N N 79 GLN CB C N N 80 GLN CG C N N 81 GLN CD C N N 82 GLN OE1 O N N 83 GLN NE2 N N N 84 GLN OXT O N N 85 GLN H H N N 86 GLN H2 H N N 87 GLN HA H N N 88 GLN HB2 H N N 89 GLN HB3 H N N 90 GLN HG2 H N N 91 GLN HG3 H N N 92 GLN HE21 H N N 93 GLN HE22 H N N 94 GLN HXT H N N 95 GLU N N N N 96 GLU CA C N S 97 GLU C C N N 98 GLU O O N N 99 GLU CB C N N 100 GLU CG C N N 101 GLU CD C N N 102 GLU OE1 O N N 103 GLU OE2 O N N 104 GLU OXT O N N 105 GLU H H N N 106 GLU H2 H N N 107 GLU HA H N N 108 GLU HB2 H N N 109 GLU HB3 H N N 110 GLU HG2 H N N 111 GLU HG3 H N N 112 GLU HE2 H N N 113 GLU HXT H N N 114 GLY N N N N 115 GLY CA C N N 116 GLY C C N N 117 GLY O O N N 118 GLY OXT O N N 119 GLY H H N N 120 GLY H2 H N N 121 GLY HA2 H N N 122 GLY HA3 H N N 123 GLY HXT H N N 124 HIS N N N N 125 HIS CA C N S 126 HIS C C N N 127 HIS O O N N 128 HIS CB C N N 129 HIS CG C Y N 130 HIS ND1 N Y N 131 HIS CD2 C Y N 132 HIS CE1 C Y N 133 HIS NE2 N Y N 134 HIS OXT O N N 135 HIS H H N N 136 HIS H2 H N N 137 HIS HA H N N 138 HIS HB2 H N N 139 HIS HB3 H N N 140 HIS HD1 H N N 141 HIS HD2 H N N 142 HIS HE1 H N N 143 HIS HE2 H N N 144 HIS HXT H N N 145 HOH O O N N 146 HOH H1 H N N 147 HOH H2 H N N 148 ILE N N N N 149 ILE CA C N S 150 ILE C C N N 151 ILE O O N N 152 ILE CB C N S 153 ILE CG1 C N N 154 ILE CG2 C N N 155 ILE CD1 C N N 156 ILE OXT O N N 157 ILE H H N N 158 ILE H2 H N N 159 ILE HA H N N 160 ILE HB H N N 161 ILE HG12 H N N 162 ILE HG13 H N N 163 ILE HG21 H N N 164 ILE HG22 H N N 165 ILE HG23 H N N 166 ILE HD11 H N N 167 ILE HD12 H N N 168 ILE HD13 H N N 169 ILE HXT H N N 170 LEU N N N N 171 LEU CA C N S 172 LEU C C N N 173 LEU O O N N 174 LEU CB C N N 175 LEU CG C N N 176 LEU CD1 C N N 177 LEU CD2 C N N 178 LEU OXT O N N 179 LEU H H N N 180 LEU H2 H N N 181 LEU HA H N N 182 LEU HB2 H N N 183 LEU HB3 H N N 184 LEU HG H N N 185 LEU HD11 H N N 186 LEU HD12 H N N 187 LEU HD13 H N N 188 LEU HD21 H N N 189 LEU HD22 H N N 190 LEU HD23 H N N 191 LEU HXT H N N 192 LYS N N N N 193 LYS CA C N S 194 LYS C C N N 195 LYS O O N N 196 LYS CB C N N 197 LYS CG C N N 198 LYS CD C N N 199 LYS CE C N N 200 LYS NZ N N N 201 LYS OXT O N N 202 LYS H H N N 203 LYS H2 H N N 204 LYS HA H N N 205 LYS HB2 H N N 206 LYS HB3 H N N 207 LYS HG2 H N N 208 LYS HG3 H N N 209 LYS HD2 H N N 210 LYS HD3 H N N 211 LYS HE2 H N N 212 LYS HE3 H N N 213 LYS HZ1 H N N 214 LYS HZ2 H N N 215 LYS HZ3 H N N 216 LYS HXT H N N 217 MET N N N N 218 MET CA C N S 219 MET C C N N 220 MET O O N N 221 MET CB C N N 222 MET CG C N N 223 MET SD S N N 224 MET CE C N N 225 MET OXT O N N 226 MET H H N N 227 MET H2 H N N 228 MET HA H N N 229 MET HB2 H N N 230 MET HB3 H N N 231 MET HG2 H N N 232 MET HG3 H N N 233 MET HE1 H N N 234 MET HE2 H N N 235 MET HE3 H N N 236 MET HXT H N N 237 PHE N N N N 238 PHE CA C N S 239 PHE C C N N 240 PHE O O N N 241 PHE CB C N N 242 PHE CG C Y N 243 PHE CD1 C Y N 244 PHE CD2 C Y N 245 PHE CE1 C Y N 246 PHE CE2 C Y N 247 PHE CZ C Y N 248 PHE OXT O N N 249 PHE H H N N 250 PHE H2 H N N 251 PHE HA H N N 252 PHE HB2 H N N 253 PHE HB3 H N N 254 PHE HD1 H N N 255 PHE HD2 H N N 256 PHE HE1 H N N 257 PHE HE2 H N N 258 PHE HZ H N N 259 PHE HXT H N N 260 PRO N N N N 261 PRO CA C N S 262 PRO C C N N 263 PRO O O N N 264 PRO CB C N N 265 PRO CG C N N 266 PRO CD C N N 267 PRO OXT O N N 268 PRO H H N N 269 PRO HA H N N 270 PRO HB2 H N N 271 PRO HB3 H N N 272 PRO HG2 H N N 273 PRO HG3 H N N 274 PRO HD2 H N N 275 PRO HD3 H N N 276 PRO HXT H N N 277 SER N N N N 278 SER CA C N S 279 SER C C N N 280 SER O O N N 281 SER CB C N N 282 SER OG O N N 283 SER OXT O N N 284 SER H H N N 285 SER H2 H N N 286 SER HA H N N 287 SER HB2 H N N 288 SER HB3 H N N 289 SER HG H N N 290 SER HXT H N N 291 THR N N N N 292 THR CA C N S 293 THR C C N N 294 THR O O N N 295 THR CB C N R 296 THR OG1 O N N 297 THR CG2 C N N 298 THR OXT O N N 299 THR H H N N 300 THR H2 H N N 301 THR HA H N N 302 THR HB H N N 303 THR HG1 H N N 304 THR HG21 H N N 305 THR HG22 H N N 306 THR HG23 H N N 307 THR HXT H N N 308 TRP N N N N 309 TRP CA C N S 310 TRP C C N N 311 TRP O O N N 312 TRP CB C N N 313 TRP CG C Y N 314 TRP CD1 C Y N 315 TRP CD2 C Y N 316 TRP NE1 N Y N 317 TRP CE2 C Y N 318 TRP CE3 C Y N 319 TRP CZ2 C Y N 320 TRP CZ3 C Y N 321 TRP CH2 C Y N 322 TRP OXT O N N 323 TRP H H N N 324 TRP H2 H N N 325 TRP HA H N N 326 TRP HB2 H N N 327 TRP HB3 H N N 328 TRP HD1 H N N 329 TRP HE1 H N N 330 TRP HE3 H N N 331 TRP HZ2 H N N 332 TRP HZ3 H N N 333 TRP HH2 H N N 334 TRP HXT H N N 335 TYR N N N N 336 TYR CA C N S 337 TYR C C N N 338 TYR O O N N 339 TYR CB C N N 340 TYR CG C Y N 341 TYR CD1 C Y N 342 TYR CD2 C Y N 343 TYR CE1 C Y N 344 TYR CE2 C Y N 345 TYR CZ C Y N 346 TYR OH O N N 347 TYR OXT O N N 348 TYR H H N N 349 TYR H2 H N N 350 TYR HA H N N 351 TYR HB2 H N N 352 TYR HB3 H N N 353 TYR HD1 H N N 354 TYR HD2 H N N 355 TYR HE1 H N N 356 TYR HE2 H N N 357 TYR HH H N N 358 TYR HXT H N N 359 VAL N N N N 360 VAL CA C N S 361 VAL C C N N 362 VAL O O N N 363 VAL CB C N N 364 VAL CG1 C N N 365 VAL CG2 C N N 366 VAL OXT O N N 367 VAL H H N N 368 VAL H2 H N N 369 VAL HA H N N 370 VAL HB H N N 371 VAL HG11 H N N 372 VAL HG12 H N N 373 VAL HG13 H N N 374 VAL HG21 H N N 375 VAL HG22 H N N 376 VAL HG23 H N N 377 VAL HXT H N N 378 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'CHLORIDE ION' CL 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2JN1 _pdbx_initial_refinement_model.details 'PDB ENTRY 2JN1' #