data_3US5 # _entry.id 3US5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.365 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3US5 pdb_00003us5 10.2210/pdb3us5/pdb RCSB RCSB069141 ? ? WWPDB D_1000069141 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 422574 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.SG_entry Y _pdbx_database_status.entry_id 3US5 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-11-23 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Joint Center for Structural Genomics (JCSG)' 1 'Partnership for T-Cell Biology (TCELL)' 2 # _citation.id primary _citation.title 'Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 1.38 A resolution' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Joint Center for Structural Genomics (JCSG)' 1 ? primary 'Partnership for T-Cell Biology' 2 ? # _cell.entry_id 3US5 _cell.length_a 43.433 _cell.length_b 48.974 _cell.length_c 56.298 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3US5 _symmetry.Int_Tables_number 19 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Poly(U)-binding-splicing factor PUF60' 13527.543 1 ? ? 'RRM 3 domain residues 443-559' ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 171 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;60 kDa poly(U)-binding-splicing factor, FUSE-binding protein-interacting repressor, FBP-interacting repressor, Ro-binding protein 1, RoBP1, Siah-binding protein 1, Siah-BP1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSGSSARH(MSE)V(MSE)QKLLRKQESTV(MSE)VLRN(MSE)VDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGE EEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSI ASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 422574 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 SER n 1 5 SER n 1 6 ALA n 1 7 ARG n 1 8 HIS n 1 9 MSE n 1 10 VAL n 1 11 MSE n 1 12 GLN n 1 13 LYS n 1 14 LEU n 1 15 LEU n 1 16 ARG n 1 17 LYS n 1 18 GLN n 1 19 GLU n 1 20 SER n 1 21 THR n 1 22 VAL n 1 23 MSE n 1 24 VAL n 1 25 LEU n 1 26 ARG n 1 27 ASN n 1 28 MSE n 1 29 VAL n 1 30 ASP n 1 31 PRO n 1 32 LYS n 1 33 ASP n 1 34 ILE n 1 35 ASP n 1 36 ASP n 1 37 ASP n 1 38 LEU n 1 39 GLU n 1 40 GLY n 1 41 GLU n 1 42 VAL n 1 43 THR n 1 44 GLU n 1 45 GLU n 1 46 CYS n 1 47 GLY n 1 48 LYS n 1 49 PHE n 1 50 GLY n 1 51 ALA n 1 52 VAL n 1 53 ASN n 1 54 ARG n 1 55 VAL n 1 56 ILE n 1 57 ILE n 1 58 TYR n 1 59 GLN n 1 60 GLU n 1 61 LYS n 1 62 GLN n 1 63 GLY n 1 64 GLU n 1 65 GLU n 1 66 GLU n 1 67 ASP n 1 68 ALA n 1 69 GLU n 1 70 ILE n 1 71 ILE n 1 72 VAL n 1 73 LYS n 1 74 ILE n 1 75 PHE n 1 76 VAL n 1 77 GLU n 1 78 PHE n 1 79 SER n 1 80 ILE n 1 81 ALA n 1 82 SER n 1 83 GLU n 1 84 THR n 1 85 HIS n 1 86 LYS n 1 87 ALA n 1 88 ILE n 1 89 GLN n 1 90 ALA n 1 91 LEU n 1 92 ASN n 1 93 GLY n 1 94 ARG n 1 95 TRP n 1 96 PHE n 1 97 ALA n 1 98 GLY n 1 99 ARG n 1 100 LYS n 1 101 VAL n 1 102 VAL n 1 103 ALA n 1 104 GLU n 1 105 VAL n 1 106 TYR n 1 107 ASP n 1 108 GLN n 1 109 GLU n 1 110 ARG n 1 111 PHE n 1 112 ASP n 1 113 ASN n 1 114 SER n 1 115 ASP n 1 116 LEU n 1 117 SER n 1 118 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BC011265, FIR, PUF60, ROBPI, SIAHBP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia Coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HK100 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PUF60_HUMAN _struct_ref.pdbx_db_accession Q9UHX1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIA SETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA ; _struct_ref.pdbx_align_begin 443 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3US5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UHX1 _struct_ref_seq.db_align_beg 443 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 559 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 443 _struct_ref_seq.pdbx_auth_seq_align_end 559 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3US5 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9UHX1 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 3US5 # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 44.42 _exptl_crystal.description 'REFLECTIONS IN RESOLUTION BINS 3.71-3.63, 2.28-2.22, AND 1.94-1.90 WERE EXCLUDED DURING DATA INTEGRATION BECAUSE OF ICE RINGS.' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details '2.40M ammonium sulfate, 0.1M TRIS pH 8.0, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.details 'KOHZU: Double Crystal Si(111)' _diffrn_detector.pdbx_collection_date 2011-10-15 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double Crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.pdbx_wavelength 0.9793 _diffrn_source.pdbx_wavelength_list ? _diffrn_source.pdbx_synchrotron_site ALS # _reflns.entry_id 3US5 _reflns.d_resolution_high 1.38 _reflns.d_resolution_low 36.950 _reflns.number_all 24223 _reflns.number_obs 24223 _reflns.pdbx_netI_over_sigmaI 9.300 _reflns.pdbx_Rsym_value 0.102 _reflns.pdbx_redundancy 6.900 _reflns.percent_possible_obs 95.400 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.pdbx_Rmerge_I_obs ? _reflns.B_iso_Wilson_estimate 13.374 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.380 1.450 ? 25286 ? 0.011 0.6 1.064 ? 7.000 ? 3638 100.000 1 1 1.450 1.540 ? 24020 ? 0.011 1.1 0.604 ? 7.000 ? 3442 100.000 2 1 1.540 1.650 ? 22714 ? 0.011 2.0 0.355 ? 7.000 ? 3252 100.000 3 1 1.650 1.780 ? 21255 ? 0.011 3.2 0.220 ? 7.000 ? 3050 100.000 4 1 1.780 1.950 ? 15366 ? 0.011 4.4 0.154 ? 7.000 ? 2206 78.700 5 1 1.950 2.180 ? 17631 ? 0.011 6.5 0.102 ? 6.900 ? 2549 100.000 6 1 2.180 2.520 ? 12223 ? 0.011 7.1 0.089 ? 6.800 ? 1790 79.000 7 1 2.520 3.090 ? 12917 ? 0.011 8.6 0.074 ? 6.600 ? 1951 100.000 8 1 3.090 4.360 ? 9364 ? 0.011 10.9 0.056 ? 6.500 ? 1440 93.900 9 1 4.360 36.950 ? 5902 ? 0.011 12.5 0.048 ? 6.500 ? 905 99.800 10 1 # _refine.entry_id 3US5 _refine.ls_d_res_high 1.3800 _refine.ls_d_res_low 36.950 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 95.1800 _refine.ls_number_reflns_obs 24119 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1444 _refine.ls_R_factor_R_work 0.1425 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.1813 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_number_reflns_R_free 1213 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 18.1125 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.0600 _refine.aniso_B[2][2] 0.4400 _refine.aniso_B[3][3] -0.5100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9730 _refine.correlation_coeff_Fo_to_Fc_free 0.9650 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.0600 _refine.pdbx_overall_ESU_R_Free 0.0570 _refine.overall_SU_ML 0.0340 _refine.overall_SU_B 1.8700 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 51.900 _refine.B_iso_min 7.840 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.400 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 923 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 171 _refine_hist.number_atoms_total 1095 _refine_hist.d_res_high 1.3800 _refine_hist.d_res_low 36.950 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 956 0.015 0.022 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 644 0.002 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1293 1.499 1.947 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 1575 0.932 3.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 125 5.369 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 51 36.419 25.294 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 176 10.899 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 7 8.791 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 144 0.106 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 1096 0.006 0.020 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 190 0.001 0.020 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 595 1.673 1.500 ? ? 'X-RAY DIFFRACTION' r_mcbond_other 246 0.620 1.500 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 958 2.561 2.000 ? ? 'X-RAY DIFFRACTION' r_scbond_it 361 3.915 3.000 ? ? 'X-RAY DIFFRACTION' r_scangle_it 331 5.878 4.500 ? ? 'X-RAY DIFFRACTION' r_rigid_bond_restr 1600 1.576 3.000 ? ? 'X-RAY DIFFRACTION' r_sphericity_free 174 13.874 5.000 ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded 1585 6.948 5.000 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 1.3800 _refine_ls_shell.d_res_low 1.4160 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 99.7800 _refine_ls_shell.number_reflns_R_work 1733 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2400 _refine_ls_shell.R_factor_R_free 0.3060 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 105 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1838 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3US5 _struct.title 'Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 1.38 A resolution' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;Canonical RBD, RRM, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, Partnership for T-Cell Biology, TCELL, RNA BINDING PROTEIN ; _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.entry_id 3US5 # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'CRYSTAL PACKING ANALYSIS SUPPORTS THE ASSIGNMENT OF A MONOMER AS A SIGNIFICANT OLIGOMERIZATION STATE.' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 3 ? HIS A 8 ? GLY A 444 HIS A 449 1 ? 6 HELX_P HELX_P2 2 MSE A 11 ? LEU A 15 ? MSE A 452 LEU A 456 5 ? 5 HELX_P HELX_P3 3 ASP A 37 ? GLY A 47 ? ASP A 478 GLY A 488 1 ? 11 HELX_P HELX_P4 4 ILE A 80 ? ASN A 92 ? ILE A 521 ASN A 533 1 ? 13 HELX_P HELX_P5 5 ASP A 107 ? ASN A 113 ? ASP A 548 ASN A 554 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A HIS 8 C ? ? ? 1_555 A MSE 9 N ? ? A HIS 449 A MSE 450 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A MSE 9 C ? ? ? 1_555 A VAL 10 N ? ? A MSE 450 A VAL 451 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A VAL 10 C ? ? ? 1_555 A MSE 11 N ? ? A VAL 451 A MSE 452 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale4 covale both ? A MSE 11 C ? ? ? 1_555 A GLN 12 N ? ? A MSE 452 A GLN 453 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale5 covale both ? A VAL 22 C ? ? ? 1_555 A MSE 23 N ? ? A VAL 463 A MSE 464 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A MSE 23 C ? ? ? 1_555 A VAL 24 N ? ? A MSE 464 A VAL 465 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale7 covale both ? A ASN 27 C ? ? ? 1_555 A MSE 28 N ? ? A ASN 468 A MSE 469 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale8 covale both ? A MSE 28 C ? ? ? 1_555 A VAL 29 N ? ? A MSE 469 A VAL 470 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 52 ? LYS A 61 ? VAL A 493 LYS A 502 A 2 ILE A 70 ? PHE A 78 ? ILE A 511 PHE A 519 A 3 VAL A 22 ? ARG A 26 ? VAL A 463 ARG A 467 A 4 VAL A 102 ? TYR A 106 ? VAL A 543 TYR A 547 B 1 TRP A 95 ? PHE A 96 ? TRP A 536 PHE A 537 B 2 ARG A 99 ? LYS A 100 ? ARG A 540 LYS A 541 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 58 ? N TYR A 499 O LYS A 73 ? O LYS A 514 A 2 3 O ILE A 74 ? O ILE A 515 N LEU A 25 ? N LEU A 466 A 3 4 N ARG A 26 ? N ARG A 467 O VAL A 102 ? O VAL A 543 B 1 2 N PHE A 96 ? N PHE A 537 O ARG A 99 ? O ARG A 540 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CL _struct_site.pdbx_auth_seq_id 600 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE CL A 600' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 85 ? HIS A 526 . ? 1_555 ? 2 AC1 3 GLY A 98 ? GLY A 539 . ? 4_465 ? 3 AC1 3 HOH C . ? HOH A 686 . ? 1_555 ? # _atom_sites.entry_id 3US5 _atom_sites.fract_transf_matrix[1][1] 0.023024 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020419 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017763 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 SER 2 443 443 SER SER A . n A 1 3 GLY 3 444 444 GLY GLY A . n A 1 4 SER 4 445 445 SER SER A . n A 1 5 SER 5 446 446 SER SER A . n A 1 6 ALA 6 447 447 ALA ALA A . n A 1 7 ARG 7 448 448 ARG ARG A . n A 1 8 HIS 8 449 449 HIS HIS A . n A 1 9 MSE 9 450 450 MSE MSE A . n A 1 10 VAL 10 451 451 VAL VAL A . n A 1 11 MSE 11 452 452 MSE MSE A . n A 1 12 GLN 12 453 453 GLN GLN A . n A 1 13 LYS 13 454 454 LYS LYS A . n A 1 14 LEU 14 455 455 LEU LEU A . n A 1 15 LEU 15 456 456 LEU LEU A . n A 1 16 ARG 16 457 457 ARG ARG A . n A 1 17 LYS 17 458 458 LYS LYS A . n A 1 18 GLN 18 459 459 GLN GLN A . n A 1 19 GLU 19 460 460 GLU GLU A . n A 1 20 SER 20 461 461 SER SER A . n A 1 21 THR 21 462 462 THR THR A . n A 1 22 VAL 22 463 463 VAL VAL A . n A 1 23 MSE 23 464 464 MSE MSE A . n A 1 24 VAL 24 465 465 VAL VAL A . n A 1 25 LEU 25 466 466 LEU LEU A . n A 1 26 ARG 26 467 467 ARG ARG A . n A 1 27 ASN 27 468 468 ASN ASN A . n A 1 28 MSE 28 469 469 MSE MSE A . n A 1 29 VAL 29 470 470 VAL VAL A . n A 1 30 ASP 30 471 471 ASP ASP A . n A 1 31 PRO 31 472 472 PRO PRO A . n A 1 32 LYS 32 473 473 LYS LYS A . n A 1 33 ASP 33 474 474 ASP ASP A . n A 1 34 ILE 34 475 475 ILE ILE A . n A 1 35 ASP 35 476 476 ASP ASP A . n A 1 36 ASP 36 477 477 ASP ASP A . n A 1 37 ASP 37 478 478 ASP ASP A . n A 1 38 LEU 38 479 479 LEU LEU A . n A 1 39 GLU 39 480 480 GLU GLU A . n A 1 40 GLY 40 481 481 GLY GLY A . n A 1 41 GLU 41 482 482 GLU GLU A . n A 1 42 VAL 42 483 483 VAL VAL A . n A 1 43 THR 43 484 484 THR THR A . n A 1 44 GLU 44 485 485 GLU GLU A . n A 1 45 GLU 45 486 486 GLU GLU A . n A 1 46 CYS 46 487 487 CYS CYS A . n A 1 47 GLY 47 488 488 GLY GLY A . n A 1 48 LYS 48 489 489 LYS LYS A . n A 1 49 PHE 49 490 490 PHE PHE A . n A 1 50 GLY 50 491 491 GLY GLY A . n A 1 51 ALA 51 492 492 ALA ALA A . n A 1 52 VAL 52 493 493 VAL VAL A . n A 1 53 ASN 53 494 494 ASN ASN A . n A 1 54 ARG 54 495 495 ARG ARG A . n A 1 55 VAL 55 496 496 VAL VAL A . n A 1 56 ILE 56 497 497 ILE ILE A . n A 1 57 ILE 57 498 498 ILE ILE A . n A 1 58 TYR 58 499 499 TYR TYR A . n A 1 59 GLN 59 500 500 GLN GLN A . n A 1 60 GLU 60 501 501 GLU GLU A . n A 1 61 LYS 61 502 502 LYS LYS A . n A 1 62 GLN 62 503 503 GLN GLN A . n A 1 63 GLY 63 504 504 GLY GLY A . n A 1 64 GLU 64 505 505 GLU GLU A . n A 1 65 GLU 65 506 506 GLU GLU A . n A 1 66 GLU 66 507 507 GLU GLU A . n A 1 67 ASP 67 508 508 ASP ASP A . n A 1 68 ALA 68 509 509 ALA ALA A . n A 1 69 GLU 69 510 510 GLU GLU A . n A 1 70 ILE 70 511 511 ILE ILE A . n A 1 71 ILE 71 512 512 ILE ILE A . n A 1 72 VAL 72 513 513 VAL VAL A . n A 1 73 LYS 73 514 514 LYS LYS A . n A 1 74 ILE 74 515 515 ILE ILE A . n A 1 75 PHE 75 516 516 PHE PHE A . n A 1 76 VAL 76 517 517 VAL VAL A . n A 1 77 GLU 77 518 518 GLU GLU A . n A 1 78 PHE 78 519 519 PHE PHE A . n A 1 79 SER 79 520 520 SER SER A . n A 1 80 ILE 80 521 521 ILE ILE A . n A 1 81 ALA 81 522 522 ALA ALA A . n A 1 82 SER 82 523 523 SER SER A . n A 1 83 GLU 83 524 524 GLU GLU A . n A 1 84 THR 84 525 525 THR THR A . n A 1 85 HIS 85 526 526 HIS HIS A . n A 1 86 LYS 86 527 527 LYS LYS A . n A 1 87 ALA 87 528 528 ALA ALA A . n A 1 88 ILE 88 529 529 ILE ILE A . n A 1 89 GLN 89 530 530 GLN GLN A . n A 1 90 ALA 90 531 531 ALA ALA A . n A 1 91 LEU 91 532 532 LEU LEU A . n A 1 92 ASN 92 533 533 ASN ASN A . n A 1 93 GLY 93 534 534 GLY GLY A . n A 1 94 ARG 94 535 535 ARG ARG A . n A 1 95 TRP 95 536 536 TRP TRP A . n A 1 96 PHE 96 537 537 PHE PHE A . n A 1 97 ALA 97 538 538 ALA ALA A . n A 1 98 GLY 98 539 539 GLY GLY A . n A 1 99 ARG 99 540 540 ARG ARG A . n A 1 100 LYS 100 541 541 LYS LYS A . n A 1 101 VAL 101 542 542 VAL VAL A . n A 1 102 VAL 102 543 543 VAL VAL A . n A 1 103 ALA 103 544 544 ALA ALA A . n A 1 104 GLU 104 545 545 GLU GLU A . n A 1 105 VAL 105 546 546 VAL VAL A . n A 1 106 TYR 106 547 547 TYR TYR A . n A 1 107 ASP 107 548 548 ASP ASP A . n A 1 108 GLN 108 549 549 GLN GLN A . n A 1 109 GLU 109 550 550 GLU GLU A . n A 1 110 ARG 110 551 551 ARG ARG A . n A 1 111 PHE 111 552 552 PHE PHE A . n A 1 112 ASP 112 553 553 ASP ASP A . n A 1 113 ASN 113 554 554 ASN ASN A . n A 1 114 SER 114 555 555 SER SER A . n A 1 115 ASP 115 556 556 ASP ASP A . n A 1 116 LEU 116 557 557 LEU LEU A . n A 1 117 SER 117 558 558 SER SER A . n A 1 118 ALA 118 559 559 ALA ALA A . n # loop_ _pdbx_SG_project.project_name _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center PSI:Biology 'Joint Center for Structural Genomics' 1 JCSG PSI:Biology 'Partnership for T-Cell Biology' 2 TCELL # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 600 600 CL CL A . C 3 HOH 1 601 601 HOH HOH A . C 3 HOH 2 602 602 HOH HOH A . C 3 HOH 3 603 603 HOH HOH A . C 3 HOH 4 604 604 HOH HOH A . C 3 HOH 5 605 605 HOH HOH A . C 3 HOH 6 606 606 HOH HOH A . C 3 HOH 7 607 607 HOH HOH A . C 3 HOH 8 608 608 HOH HOH A . C 3 HOH 9 609 609 HOH HOH A . C 3 HOH 10 610 610 HOH HOH A . C 3 HOH 11 611 611 HOH HOH A . C 3 HOH 12 612 612 HOH HOH A . C 3 HOH 13 613 613 HOH HOH A . C 3 HOH 14 614 614 HOH HOH A . C 3 HOH 15 615 615 HOH HOH A . C 3 HOH 16 616 616 HOH HOH A . C 3 HOH 17 617 617 HOH HOH A . C 3 HOH 18 618 618 HOH HOH A . C 3 HOH 19 619 619 HOH HOH A . C 3 HOH 20 620 620 HOH HOH A . C 3 HOH 21 621 621 HOH HOH A . C 3 HOH 22 622 622 HOH HOH A . C 3 HOH 23 623 623 HOH HOH A . C 3 HOH 24 624 624 HOH HOH A . C 3 HOH 25 625 625 HOH HOH A . C 3 HOH 26 626 626 HOH HOH A . C 3 HOH 27 627 627 HOH HOH A . C 3 HOH 28 628 628 HOH HOH A . C 3 HOH 29 629 629 HOH HOH A . C 3 HOH 30 630 630 HOH HOH A . C 3 HOH 31 631 631 HOH HOH A . C 3 HOH 32 632 632 HOH HOH A . C 3 HOH 33 633 633 HOH HOH A . C 3 HOH 34 634 634 HOH HOH A . C 3 HOH 35 635 635 HOH HOH A . C 3 HOH 36 636 636 HOH HOH A . C 3 HOH 37 637 637 HOH HOH A . C 3 HOH 38 638 638 HOH HOH A . C 3 HOH 39 639 639 HOH HOH A . C 3 HOH 40 640 640 HOH HOH A . C 3 HOH 41 641 641 HOH HOH A . C 3 HOH 42 642 642 HOH HOH A . C 3 HOH 43 643 643 HOH HOH A . C 3 HOH 44 644 644 HOH HOH A . C 3 HOH 45 645 645 HOH HOH A . C 3 HOH 46 646 646 HOH HOH A . C 3 HOH 47 647 647 HOH HOH A . C 3 HOH 48 648 648 HOH HOH A . C 3 HOH 49 649 649 HOH HOH A . C 3 HOH 50 650 650 HOH HOH A . C 3 HOH 51 651 651 HOH HOH A . C 3 HOH 52 652 652 HOH HOH A . C 3 HOH 53 653 653 HOH HOH A . C 3 HOH 54 654 654 HOH HOH A . C 3 HOH 55 655 655 HOH HOH A . C 3 HOH 56 656 656 HOH HOH A . C 3 HOH 57 657 657 HOH HOH A . C 3 HOH 58 658 658 HOH HOH A . C 3 HOH 59 659 659 HOH HOH A . C 3 HOH 60 660 660 HOH HOH A . C 3 HOH 61 661 661 HOH HOH A . C 3 HOH 62 662 662 HOH HOH A . C 3 HOH 63 663 663 HOH HOH A . C 3 HOH 64 664 664 HOH HOH A . C 3 HOH 65 665 665 HOH HOH A . C 3 HOH 66 666 666 HOH HOH A . C 3 HOH 67 667 667 HOH HOH A . C 3 HOH 68 668 668 HOH HOH A . C 3 HOH 69 669 669 HOH HOH A . C 3 HOH 70 670 670 HOH HOH A . C 3 HOH 71 671 671 HOH HOH A . C 3 HOH 72 672 672 HOH HOH A . C 3 HOH 73 673 673 HOH HOH A . C 3 HOH 74 674 674 HOH HOH A . C 3 HOH 75 675 675 HOH HOH A . C 3 HOH 76 676 676 HOH HOH A . C 3 HOH 77 677 677 HOH HOH A . C 3 HOH 78 678 678 HOH HOH A . C 3 HOH 79 679 679 HOH HOH A . C 3 HOH 80 680 680 HOH HOH A . C 3 HOH 81 681 681 HOH HOH A . C 3 HOH 82 682 682 HOH HOH A . C 3 HOH 83 683 683 HOH HOH A . C 3 HOH 84 684 684 HOH HOH A . C 3 HOH 85 685 685 HOH HOH A . C 3 HOH 86 686 686 HOH HOH A . C 3 HOH 87 687 687 HOH HOH A . C 3 HOH 88 688 688 HOH HOH A . C 3 HOH 89 689 689 HOH HOH A . C 3 HOH 90 690 690 HOH HOH A . C 3 HOH 91 691 691 HOH HOH A . C 3 HOH 92 692 692 HOH HOH A . C 3 HOH 93 693 693 HOH HOH A . C 3 HOH 94 694 694 HOH HOH A . C 3 HOH 95 695 695 HOH HOH A . C 3 HOH 96 696 696 HOH HOH A . C 3 HOH 97 697 697 HOH HOH A . C 3 HOH 98 698 698 HOH HOH A . C 3 HOH 99 699 699 HOH HOH A . C 3 HOH 100 700 700 HOH HOH A . C 3 HOH 101 701 701 HOH HOH A . C 3 HOH 102 702 702 HOH HOH A . C 3 HOH 103 703 703 HOH HOH A . C 3 HOH 104 704 704 HOH HOH A . C 3 HOH 105 705 705 HOH HOH A . C 3 HOH 106 706 706 HOH HOH A . C 3 HOH 107 707 707 HOH HOH A . C 3 HOH 108 708 708 HOH HOH A . C 3 HOH 109 709 709 HOH HOH A . C 3 HOH 110 710 710 HOH HOH A . C 3 HOH 111 711 711 HOH HOH A . C 3 HOH 112 712 712 HOH HOH A . C 3 HOH 113 713 713 HOH HOH A . C 3 HOH 114 714 714 HOH HOH A . C 3 HOH 115 715 715 HOH HOH A . C 3 HOH 116 716 716 HOH HOH A . C 3 HOH 117 717 717 HOH HOH A . C 3 HOH 118 718 718 HOH HOH A . C 3 HOH 119 719 719 HOH HOH A . C 3 HOH 120 720 720 HOH HOH A . C 3 HOH 121 721 721 HOH HOH A . C 3 HOH 122 722 722 HOH HOH A . C 3 HOH 123 723 723 HOH HOH A . C 3 HOH 124 724 724 HOH HOH A . C 3 HOH 125 725 725 HOH HOH A . C 3 HOH 126 726 726 HOH HOH A . C 3 HOH 127 727 727 HOH HOH A . C 3 HOH 128 728 728 HOH HOH A . C 3 HOH 129 729 729 HOH HOH A . C 3 HOH 130 730 730 HOH HOH A . C 3 HOH 131 731 731 HOH HOH A . C 3 HOH 132 732 732 HOH HOH A . C 3 HOH 133 733 733 HOH HOH A . C 3 HOH 134 734 734 HOH HOH A . C 3 HOH 135 735 735 HOH HOH A . C 3 HOH 136 736 736 HOH HOH A . C 3 HOH 137 737 737 HOH HOH A . C 3 HOH 138 738 738 HOH HOH A . C 3 HOH 139 739 739 HOH HOH A . C 3 HOH 140 740 740 HOH HOH A . C 3 HOH 141 741 741 HOH HOH A . C 3 HOH 142 742 742 HOH HOH A . C 3 HOH 143 743 743 HOH HOH A . C 3 HOH 144 744 744 HOH HOH A . C 3 HOH 145 745 745 HOH HOH A . C 3 HOH 146 746 746 HOH HOH A . C 3 HOH 147 747 747 HOH HOH A . C 3 HOH 148 748 748 HOH HOH A . C 3 HOH 149 749 749 HOH HOH A . C 3 HOH 150 750 750 HOH HOH A . C 3 HOH 151 751 751 HOH HOH A . C 3 HOH 152 752 752 HOH HOH A . C 3 HOH 153 753 753 HOH HOH A . C 3 HOH 154 754 754 HOH HOH A . C 3 HOH 155 755 755 HOH HOH A . C 3 HOH 156 756 756 HOH HOH A . C 3 HOH 157 757 757 HOH HOH A . C 3 HOH 158 758 758 HOH HOH A . C 3 HOH 159 759 759 HOH HOH A . C 3 HOH 160 760 760 HOH HOH A . C 3 HOH 161 761 761 HOH HOH A . C 3 HOH 162 762 762 HOH HOH A . C 3 HOH 163 763 763 HOH HOH A . C 3 HOH 164 764 764 HOH HOH A . C 3 HOH 165 765 765 HOH HOH A . C 3 HOH 166 766 766 HOH HOH A . C 3 HOH 167 767 767 HOH HOH A . C 3 HOH 168 768 768 HOH HOH A . C 3 HOH 169 769 769 HOH HOH A . C 3 HOH 170 770 770 HOH HOH A . C 3 HOH 171 771 771 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 9 A MSE 450 ? MET SELENOMETHIONINE 2 A MSE 11 A MSE 452 ? MET SELENOMETHIONINE 3 A MSE 23 A MSE 464 ? MET SELENOMETHIONINE 4 A MSE 28 A MSE 469 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-01-11 2 'Structure model' 1 1 2012-08-29 3 'Structure model' 1 2 2017-11-08 4 'Structure model' 1 3 2023-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' database_2 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.name' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _phasing.method SAD # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 MolProbity 3beta29 ? package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building' http://kinemage.biochem.duke.edu/molprobity/ ? ? 2 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 3 SOLVE . ? program 'Tom Terwilliger' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 4 SCALA 3.3.20 ? package 'Phil Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' ? ? ? 5 REFMAC 5.5.0110 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 6 MOSFLM . ? ? ? ? 'data reduction' ? ? ? # _pdbx_entry_details.entry_id 3US5 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THIS CONSTRUCT WAS EXPRESSED WITH AN N-TERMINAL PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY RESIDUES 443-559 OF THE TARGET SEQUENCE. THE SEQUENCE NUMBERING MATCHES ISOFORM 1 OF UNIPROT-KB ENTRY Q9UHX1. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 458 ? CG ? A LYS 17 CG 2 1 Y 1 A LYS 458 ? CD ? A LYS 17 CD 3 1 Y 1 A LYS 458 ? CE ? A LYS 17 CE 4 1 Y 1 A LYS 458 ? NZ ? A LYS 17 NZ 5 1 Y 1 A LYS 473 ? CG ? A LYS 32 CG 6 1 Y 1 A LYS 473 ? CD ? A LYS 32 CD 7 1 Y 1 A LYS 473 ? CE ? A LYS 32 CE 8 1 Y 1 A LYS 473 ? NZ ? A LYS 32 NZ 9 1 Y 1 A ASP 477 ? CG ? A ASP 36 CG 10 1 Y 1 A ASP 477 ? OD1 ? A ASP 36 OD1 11 1 Y 1 A ASP 477 ? OD2 ? A ASP 36 OD2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH #