data_3VBW # _entry.id 3VBW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3VBW RCSB RCSB069850 WWPDB D_1000069850 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3VBQ . unspecified PDB 3VBT . unspecified PDB 3VBV . unspecified PDB 3VBX . unspecified PDB 3VBY . unspecified PDB 3VC4 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3VBW _pdbx_database_status.recvd_initial_deposition_date 2012-01-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Liu, J.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Implications of promiscuous Pim-1 kinase fragment inhibitor hydrophobic interactions for fragment-based drug design.' _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 55 _citation.page_first 2641 _citation.page_last 2648 _citation.year 2012 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22339127 _citation.pdbx_database_id_DOI 10.1021/jm2014698 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Good, A.C.' 1 primary 'Liu, J.' 2 primary 'Hirth, B.' 3 primary 'Asmussen, G.' 4 primary 'Xiang, Y.' 5 primary 'Biemann, H.P.' 6 primary 'Bishop, K.A.' 7 primary 'Fremgen, T.' 8 primary 'Fitzgerald, M.' 9 primary 'Gladysheva, T.' 10 primary 'Jain, A.' 11 primary 'Jancsics, K.' 12 primary 'Metz, M.' 13 primary 'Papoulis, A.' 14 primary 'Skerlj, R.' 15 primary 'Stepp, J.D.' 16 primary 'Wei, R.R.' 17 # _cell.entry_id 3VBW _cell.length_a 97.000 _cell.length_b 97.000 _cell.length_c 81.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3VBW _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase pim-1' 34481.094 1 2.7.11.1 ? 'unp residues 120-404' ? 2 non-polymer syn 1,3-dioxo-2,3-dihydro-1H-indene-2-carbonitrile 171.152 1 ? ? ? ? 3 water nat water 18.015 73 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLL DWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDF GSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLI RWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSKAAALEHHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLL DWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDF GSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLI RWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSKAAALEHHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLU n 1 4 LYS n 1 5 GLU n 1 6 PRO n 1 7 LEU n 1 8 GLU n 1 9 SER n 1 10 GLN n 1 11 TYR n 1 12 GLN n 1 13 VAL n 1 14 GLY n 1 15 PRO n 1 16 LEU n 1 17 LEU n 1 18 GLY n 1 19 SER n 1 20 GLY n 1 21 GLY n 1 22 PHE n 1 23 GLY n 1 24 SER n 1 25 VAL n 1 26 TYR n 1 27 SER n 1 28 GLY n 1 29 ILE n 1 30 ARG n 1 31 VAL n 1 32 SER n 1 33 ASP n 1 34 ASN n 1 35 LEU n 1 36 PRO n 1 37 VAL n 1 38 ALA n 1 39 ILE n 1 40 LYS n 1 41 HIS n 1 42 VAL n 1 43 GLU n 1 44 LYS n 1 45 ASP n 1 46 ARG n 1 47 ILE n 1 48 SER n 1 49 ASP n 1 50 TRP n 1 51 GLY n 1 52 GLU n 1 53 LEU n 1 54 PRO n 1 55 ASN n 1 56 GLY n 1 57 THR n 1 58 ARG n 1 59 VAL n 1 60 PRO n 1 61 MET n 1 62 GLU n 1 63 VAL n 1 64 VAL n 1 65 LEU n 1 66 LEU n 1 67 LYS n 1 68 LYS n 1 69 VAL n 1 70 SER n 1 71 SER n 1 72 GLY n 1 73 PHE n 1 74 SER n 1 75 GLY n 1 76 VAL n 1 77 ILE n 1 78 ARG n 1 79 LEU n 1 80 LEU n 1 81 ASP n 1 82 TRP n 1 83 PHE n 1 84 GLU n 1 85 ARG n 1 86 PRO n 1 87 ASP n 1 88 SER n 1 89 PHE n 1 90 VAL n 1 91 LEU n 1 92 ILE n 1 93 LEU n 1 94 GLU n 1 95 ARG n 1 96 PRO n 1 97 GLU n 1 98 PRO n 1 99 VAL n 1 100 GLN n 1 101 ASP n 1 102 LEU n 1 103 PHE n 1 104 ASP n 1 105 PHE n 1 106 ILE n 1 107 THR n 1 108 GLU n 1 109 ARG n 1 110 GLY n 1 111 ALA n 1 112 LEU n 1 113 GLN n 1 114 GLU n 1 115 GLU n 1 116 LEU n 1 117 ALA n 1 118 ARG n 1 119 SER n 1 120 PHE n 1 121 PHE n 1 122 TRP n 1 123 GLN n 1 124 VAL n 1 125 LEU n 1 126 GLU n 1 127 ALA n 1 128 VAL n 1 129 ARG n 1 130 HIS n 1 131 CYS n 1 132 HIS n 1 133 ASN n 1 134 CYS n 1 135 GLY n 1 136 VAL n 1 137 LEU n 1 138 HIS n 1 139 ARG n 1 140 ASP n 1 141 ILE n 1 142 LYS n 1 143 ASP n 1 144 GLU n 1 145 ASN n 1 146 ILE n 1 147 LEU n 1 148 ILE n 1 149 ASP n 1 150 LEU n 1 151 ASN n 1 152 ARG n 1 153 GLY n 1 154 GLU n 1 155 LEU n 1 156 LYS n 1 157 LEU n 1 158 ILE n 1 159 ASP n 1 160 PHE n 1 161 GLY n 1 162 SER n 1 163 GLY n 1 164 ALA n 1 165 LEU n 1 166 LEU n 1 167 LYS n 1 168 ASP n 1 169 THR n 1 170 VAL n 1 171 TYR n 1 172 THR n 1 173 ASP n 1 174 PHE n 1 175 ASP n 1 176 GLY n 1 177 THR n 1 178 ARG n 1 179 VAL n 1 180 TYR n 1 181 SER n 1 182 PRO n 1 183 PRO n 1 184 GLU n 1 185 TRP n 1 186 ILE n 1 187 ARG n 1 188 TYR n 1 189 HIS n 1 190 ARG n 1 191 TYR n 1 192 HIS n 1 193 GLY n 1 194 ARG n 1 195 SER n 1 196 ALA n 1 197 ALA n 1 198 VAL n 1 199 TRP n 1 200 SER n 1 201 LEU n 1 202 GLY n 1 203 ILE n 1 204 LEU n 1 205 LEU n 1 206 TYR n 1 207 ASP n 1 208 MET n 1 209 VAL n 1 210 CYS n 1 211 GLY n 1 212 ASP n 1 213 ILE n 1 214 PRO n 1 215 PHE n 1 216 GLU n 1 217 HIS n 1 218 ASP n 1 219 GLU n 1 220 GLU n 1 221 ILE n 1 222 ILE n 1 223 ARG n 1 224 GLY n 1 225 GLN n 1 226 VAL n 1 227 PHE n 1 228 PHE n 1 229 ARG n 1 230 GLN n 1 231 ARG n 1 232 VAL n 1 233 SER n 1 234 SER n 1 235 GLU n 1 236 CYS n 1 237 GLN n 1 238 HIS n 1 239 LEU n 1 240 ILE n 1 241 ARG n 1 242 TRP n 1 243 CYS n 1 244 LEU n 1 245 ALA n 1 246 LEU n 1 247 ARG n 1 248 PRO n 1 249 SER n 1 250 ASP n 1 251 ARG n 1 252 PRO n 1 253 THR n 1 254 PHE n 1 255 GLU n 1 256 GLU n 1 257 ILE n 1 258 GLN n 1 259 ASN n 1 260 HIS n 1 261 PRO n 1 262 TRP n 1 263 MET n 1 264 GLN n 1 265 ASP n 1 266 VAL n 1 267 LEU n 1 268 LEU n 1 269 PRO n 1 270 GLN n 1 271 GLU n 1 272 THR n 1 273 ALA n 1 274 GLU n 1 275 ILE n 1 276 HIS n 1 277 LEU n 1 278 HIS n 1 279 SER n 1 280 LEU n 1 281 SER n 1 282 PRO n 1 283 GLY n 1 284 PRO n 1 285 SER n 1 286 LYS n 1 287 ALA n 1 288 ALA n 1 289 ALA n 1 290 LEU n 1 291 GLU n 1 292 HIS n 1 293 HIS n 1 294 HIS n 1 295 HIS n 1 296 HIS n 1 297 HIS n 1 298 HIS n 1 299 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIM1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PIM1_HUMAN _struct_ref.pdbx_db_accession P11309 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLD WFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFG SGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIR WCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; _struct_ref.pdbx_align_begin 120 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3VBW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 286 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11309 _struct_ref_seq.db_align_beg 120 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 404 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 29 _struct_ref_seq.pdbx_auth_seq_align_end 313 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3VBW MET A 1 ? UNP P11309 ? ? 'INITIATING METHIONINE' 28 1 1 3VBW ALA A 287 ? UNP P11309 ? ? 'EXPRESSION TAG' 314 2 1 3VBW ALA A 288 ? UNP P11309 ? ? 'EXPRESSION TAG' 315 3 1 3VBW ALA A 289 ? UNP P11309 ? ? 'EXPRESSION TAG' 316 4 1 3VBW LEU A 290 ? UNP P11309 ? ? 'EXPRESSION TAG' 317 5 1 3VBW GLU A 291 ? UNP P11309 ? ? 'EXPRESSION TAG' 318 6 1 3VBW HIS A 292 ? UNP P11309 ? ? 'EXPRESSION TAG' 319 7 1 3VBW HIS A 293 ? UNP P11309 ? ? 'EXPRESSION TAG' 320 8 1 3VBW HIS A 294 ? UNP P11309 ? ? 'EXPRESSION TAG' 321 9 1 3VBW HIS A 295 ? UNP P11309 ? ? 'EXPRESSION TAG' 322 10 1 3VBW HIS A 296 ? UNP P11309 ? ? 'EXPRESSION TAG' 323 11 1 3VBW HIS A 297 ? UNP P11309 ? ? 'EXPRESSION TAG' 324 12 1 3VBW HIS A 298 ? UNP P11309 ? ? 'EXPRESSION TAG' 325 13 1 3VBW HIS A 299 ? UNP P11309 ? ? 'EXPRESSION TAG' 326 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0FN non-polymer . 1,3-dioxo-2,3-dihydro-1H-indene-2-carbonitrile ? 'C10 H5 N O2' 171.152 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3VBW _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.19 _exptl_crystal.density_percent_sol 61.44 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.4 _exptl_crystal_grow.pdbx_details '0.1M Imidazole, 1M Na Acetate, pH 6.4, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3VBW _reflns.observed_criterion_sigma_I 0.1 _reflns.observed_criterion_sigma_F 0.1 _reflns.d_resolution_low 84 _reflns.d_resolution_high 2.48 _reflns.number_obs 14366 _reflns.number_all 14732 _reflns.percent_possible_obs 97.51 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 3VBW _refine.ls_number_reflns_obs 14366 _refine.ls_number_reflns_all 14732 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 84.00 _refine.ls_d_res_high 2.48 _refine.ls_percent_reflns_obs 97.51 _refine.ls_R_factor_obs 0.23218 _refine.ls_R_factor_all 0.29910 _refine.ls_R_factor_R_work 0.22899 _refine.ls_R_factor_R_free 0.29910 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 757 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.935 _refine.correlation_coeff_Fo_to_Fc_free 0.889 _refine.B_iso_mean 42.379 _refine.aniso_B[1][1] 0.66 _refine.aniso_B[2][2] 0.66 _refine.aniso_B[3][3] -0.99 _refine.aniso_B[1][2] 0.33 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.377 _refine.pdbx_overall_ESU_R_Free 0.301 _refine.overall_SU_ML 0.188 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 16.363 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2165 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 73 _refine_hist.number_atoms_total 2251 _refine_hist.d_res_high 2.48 _refine_hist.d_res_low 84.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.017 0.019 ? 2234 ? 'X-RAY DIFFRACTION' r_bond_other_d ? ? ? ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.931 1.954 ? 3030 ? 'X-RAY DIFFRACTION' r_angle_other_deg ? ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.797 5.000 ? 261 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 36.299 23.103 ? 116 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 16.680 15.000 ? 375 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 23.257 15.000 ? 21 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.129 0.200 ? 325 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.009 0.021 ? 1728 ? 'X-RAY DIFFRACTION' r_gen_planes_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.476 _refine_ls_shell.d_res_low 2.541 _refine_ls_shell.number_reflns_R_work 797 _refine_ls_shell.R_factor_R_work 0.300 _refine_ls_shell.percent_reflns_obs 77.50 _refine_ls_shell.R_factor_R_free 0.352 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 54 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3VBW _struct.title ;Exploitation of hydrogen bonding constraints and flat hydrophobic energy landscapes in Pim-1 kinase needle screening and inhibitor design ; _struct.pdbx_descriptor 'Serine/threonine-protein kinase pim-1 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3VBW _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text 'Pim1, TRANSFERASE-TRANSFERASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 45 ? ILE A 47 ? ASP A 72 ILE A 74 5 ? 3 HELX_P HELX_P2 2 MET A 61 ? SER A 70 ? MET A 88 SER A 97 1 ? 10 HELX_P HELX_P3 3 LEU A 102 ? GLY A 110 ? LEU A 129 GLY A 137 1 ? 9 HELX_P HELX_P4 4 GLN A 113 ? CYS A 134 ? GLN A 140 CYS A 161 1 ? 22 HELX_P HELX_P5 5 LYS A 142 ? GLU A 144 ? LYS A 169 GLU A 171 5 ? 3 HELX_P HELX_P6 6 THR A 177 ? SER A 181 ? THR A 204 SER A 208 5 ? 5 HELX_P HELX_P7 7 PRO A 182 ? HIS A 189 ? PRO A 209 HIS A 216 1 ? 8 HELX_P HELX_P8 8 HIS A 192 ? GLY A 211 ? HIS A 219 GLY A 238 1 ? 20 HELX_P HELX_P9 9 HIS A 217 ? GLY A 224 ? HIS A 244 GLY A 251 1 ? 8 HELX_P HELX_P10 10 SER A 233 ? LEU A 244 ? SER A 260 LEU A 271 1 ? 12 HELX_P HELX_P11 11 ARG A 247 ? ARG A 251 ? ARG A 274 ARG A 278 5 ? 5 HELX_P HELX_P12 12 THR A 253 ? ASN A 259 ? THR A 280 ASN A 286 1 ? 7 HELX_P HELX_P13 13 HIS A 260 ? GLN A 264 ? HIS A 287 GLN A 291 5 ? 5 HELX_P HELX_P14 14 LEU A 268 ? LEU A 277 ? LEU A 295 LEU A 304 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 73 A . ? PHE 100 A SER 74 A ? SER 101 A 1 -11.29 2 GLU 97 A . ? GLU 124 A PRO 98 A ? PRO 125 A 1 2.76 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 3 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 11 ? GLY A 18 ? TYR A 38 GLY A 45 A 2 SER A 24 ? ARG A 30 ? SER A 51 ARG A 57 A 3 PRO A 36 ? GLU A 43 ? PRO A 63 GLU A 70 A 4 SER A 88 ? GLU A 94 ? SER A 115 GLU A 121 A 5 LEU A 79 ? GLU A 84 ? LEU A 106 GLU A 111 B 1 TRP A 50 ? GLY A 51 ? TRP A 77 GLY A 78 B 2 VAL A 59 ? PRO A 60 ? VAL A 86 PRO A 87 C 1 VAL A 99 ? ASP A 101 ? VAL A 126 ASP A 128 C 2 ILE A 146 ? ASP A 149 ? ILE A 173 ASP A 176 C 3 GLU A 154 ? LEU A 157 ? GLU A 181 LEU A 184 D 1 VAL A 136 ? LEU A 137 ? VAL A 163 LEU A 164 D 2 ALA A 164 ? LEU A 165 ? ALA A 191 LEU A 192 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 14 ? N GLY A 41 O SER A 27 ? O SER A 54 A 2 3 N GLY A 28 ? N GLY A 55 O VAL A 37 ? O VAL A 64 A 3 4 N LYS A 40 ? N LYS A 67 O LEU A 91 ? O LEU A 118 A 4 5 O VAL A 90 ? O VAL A 117 N PHE A 83 ? N PHE A 110 B 1 2 N GLY A 51 ? N GLY A 78 O VAL A 59 ? O VAL A 86 C 1 2 N GLN A 100 ? N GLN A 127 O ILE A 148 ? O ILE A 175 C 2 3 N LEU A 147 ? N LEU A 174 O LYS A 156 ? O LYS A 183 D 1 2 N LEU A 137 ? N LEU A 164 O ALA A 164 ? O ALA A 191 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE 0FN A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 HOH C . ? HOH A 21 . ? 1_555 ? 2 AC1 11 LEU A 17 ? LEU A 44 . ? 1_555 ? 3 AC1 11 VAL A 25 ? VAL A 52 . ? 1_555 ? 4 AC1 11 ALA A 38 ? ALA A 65 . ? 1_555 ? 5 AC1 11 LYS A 40 ? LYS A 67 . ? 1_555 ? 6 AC1 11 ILE A 77 ? ILE A 104 . ? 1_555 ? 7 AC1 11 LEU A 93 ? LEU A 120 . ? 1_555 ? 8 AC1 11 GLU A 94 ? GLU A 121 . ? 1_555 ? 9 AC1 11 LEU A 147 ? LEU A 174 . ? 1_555 ? 10 AC1 11 ILE A 158 ? ILE A 185 . ? 1_555 ? 11 AC1 11 ASP A 159 ? ASP A 186 . ? 1_555 ? # _database_PDB_matrix.entry_id 3VBW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3VBW _atom_sites.fract_transf_matrix[1][1] 0.010309 _atom_sites.fract_transf_matrix[1][2] 0.005952 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011904 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012346 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 28 ? ? ? A . n A 1 2 LYS 2 29 ? ? ? A . n A 1 3 GLU 3 30 ? ? ? A . n A 1 4 LYS 4 31 ? ? ? A . n A 1 5 GLU 5 32 ? ? ? A . n A 1 6 PRO 6 33 ? ? ? A . n A 1 7 LEU 7 34 ? ? ? A . n A 1 8 GLU 8 35 35 GLU GLU A . n A 1 9 SER 9 36 36 SER SER A . n A 1 10 GLN 10 37 37 GLN GLN A . n A 1 11 TYR 11 38 38 TYR TYR A . n A 1 12 GLN 12 39 39 GLN GLN A . n A 1 13 VAL 13 40 40 VAL VAL A . n A 1 14 GLY 14 41 41 GLY GLY A . n A 1 15 PRO 15 42 42 PRO PRO A . n A 1 16 LEU 16 43 43 LEU LEU A . n A 1 17 LEU 17 44 44 LEU LEU A . n A 1 18 GLY 18 45 45 GLY GLY A . n A 1 19 SER 19 46 ? ? ? A . n A 1 20 GLY 20 47 ? ? ? A . n A 1 21 GLY 21 48 ? ? ? A . n A 1 22 PHE 22 49 ? ? ? A . n A 1 23 GLY 23 50 50 GLY GLY A . n A 1 24 SER 24 51 51 SER SER A . n A 1 25 VAL 25 52 52 VAL VAL A . n A 1 26 TYR 26 53 53 TYR TYR A . n A 1 27 SER 27 54 54 SER SER A . n A 1 28 GLY 28 55 55 GLY GLY A . n A 1 29 ILE 29 56 56 ILE ILE A . n A 1 30 ARG 30 57 57 ARG ARG A . n A 1 31 VAL 31 58 58 VAL VAL A . n A 1 32 SER 32 59 59 SER SER A . n A 1 33 ASP 33 60 60 ASP ASP A . n A 1 34 ASN 34 61 61 ASN ASN A . n A 1 35 LEU 35 62 62 LEU LEU A . n A 1 36 PRO 36 63 63 PRO PRO A . n A 1 37 VAL 37 64 64 VAL VAL A . n A 1 38 ALA 38 65 65 ALA ALA A . n A 1 39 ILE 39 66 66 ILE ILE A . n A 1 40 LYS 40 67 67 LYS LYS A . n A 1 41 HIS 41 68 68 HIS HIS A . n A 1 42 VAL 42 69 69 VAL VAL A . n A 1 43 GLU 43 70 70 GLU GLU A . n A 1 44 LYS 44 71 71 LYS LYS A . n A 1 45 ASP 45 72 72 ASP ASP A . n A 1 46 ARG 46 73 73 ARG ARG A . n A 1 47 ILE 47 74 74 ILE ILE A . n A 1 48 SER 48 75 75 SER SER A . n A 1 49 ASP 49 76 76 ASP ASP A . n A 1 50 TRP 50 77 77 TRP TRP A . n A 1 51 GLY 51 78 78 GLY GLY A . n A 1 52 GLU 52 79 79 GLU GLU A . n A 1 53 LEU 53 80 80 LEU LEU A . n A 1 54 PRO 54 81 ? ? ? A . n A 1 55 ASN 55 82 ? ? ? A . n A 1 56 GLY 56 83 ? ? ? A . n A 1 57 THR 57 84 84 THR THR A . n A 1 58 ARG 58 85 85 ARG ARG A . n A 1 59 VAL 59 86 86 VAL VAL A . n A 1 60 PRO 60 87 87 PRO PRO A . n A 1 61 MET 61 88 88 MET MET A . n A 1 62 GLU 62 89 89 GLU GLU A . n A 1 63 VAL 63 90 90 VAL VAL A . n A 1 64 VAL 64 91 91 VAL VAL A . n A 1 65 LEU 65 92 92 LEU LEU A . n A 1 66 LEU 66 93 93 LEU LEU A . n A 1 67 LYS 67 94 94 LYS LYS A . n A 1 68 LYS 68 95 95 LYS LYS A . n A 1 69 VAL 69 96 96 VAL VAL A . n A 1 70 SER 70 97 97 SER SER A . n A 1 71 SER 71 98 98 SER SER A . n A 1 72 GLY 72 99 99 GLY GLY A . n A 1 73 PHE 73 100 100 PHE PHE A . n A 1 74 SER 74 101 101 SER SER A . n A 1 75 GLY 75 102 102 GLY GLY A . n A 1 76 VAL 76 103 103 VAL VAL A . n A 1 77 ILE 77 104 104 ILE ILE A . n A 1 78 ARG 78 105 105 ARG ARG A . n A 1 79 LEU 79 106 106 LEU LEU A . n A 1 80 LEU 80 107 107 LEU LEU A . n A 1 81 ASP 81 108 108 ASP ASP A . n A 1 82 TRP 82 109 109 TRP TRP A . n A 1 83 PHE 83 110 110 PHE PHE A . n A 1 84 GLU 84 111 111 GLU GLU A . n A 1 85 ARG 85 112 112 ARG ARG A . n A 1 86 PRO 86 113 113 PRO PRO A . n A 1 87 ASP 87 114 114 ASP ASP A . n A 1 88 SER 88 115 115 SER SER A . n A 1 89 PHE 89 116 116 PHE PHE A . n A 1 90 VAL 90 117 117 VAL VAL A . n A 1 91 LEU 91 118 118 LEU LEU A . n A 1 92 ILE 92 119 119 ILE ILE A . n A 1 93 LEU 93 120 120 LEU LEU A . n A 1 94 GLU 94 121 121 GLU GLU A . n A 1 95 ARG 95 122 122 ARG ARG A . n A 1 96 PRO 96 123 123 PRO PRO A . n A 1 97 GLU 97 124 124 GLU GLU A . n A 1 98 PRO 98 125 125 PRO PRO A . n A 1 99 VAL 99 126 126 VAL VAL A . n A 1 100 GLN 100 127 127 GLN GLN A . n A 1 101 ASP 101 128 128 ASP ASP A . n A 1 102 LEU 102 129 129 LEU LEU A . n A 1 103 PHE 103 130 130 PHE PHE A . n A 1 104 ASP 104 131 131 ASP ASP A . n A 1 105 PHE 105 132 132 PHE PHE A . n A 1 106 ILE 106 133 133 ILE ILE A . n A 1 107 THR 107 134 134 THR THR A . n A 1 108 GLU 108 135 135 GLU GLU A . n A 1 109 ARG 109 136 136 ARG ARG A . n A 1 110 GLY 110 137 137 GLY GLY A . n A 1 111 ALA 111 138 138 ALA ALA A . n A 1 112 LEU 112 139 139 LEU LEU A . n A 1 113 GLN 113 140 140 GLN GLN A . n A 1 114 GLU 114 141 141 GLU GLU A . n A 1 115 GLU 115 142 142 GLU GLU A . n A 1 116 LEU 116 143 143 LEU LEU A . n A 1 117 ALA 117 144 144 ALA ALA A . n A 1 118 ARG 118 145 145 ARG ARG A . n A 1 119 SER 119 146 146 SER SER A . n A 1 120 PHE 120 147 147 PHE PHE A . n A 1 121 PHE 121 148 148 PHE PHE A . n A 1 122 TRP 122 149 149 TRP TRP A . n A 1 123 GLN 123 150 150 GLN GLN A . n A 1 124 VAL 124 151 151 VAL VAL A . n A 1 125 LEU 125 152 152 LEU LEU A . n A 1 126 GLU 126 153 153 GLU GLU A . n A 1 127 ALA 127 154 154 ALA ALA A . n A 1 128 VAL 128 155 155 VAL VAL A . n A 1 129 ARG 129 156 156 ARG ARG A . n A 1 130 HIS 130 157 157 HIS HIS A . n A 1 131 CYS 131 158 158 CYS CYS A . n A 1 132 HIS 132 159 159 HIS HIS A . n A 1 133 ASN 133 160 160 ASN ASN A . n A 1 134 CYS 134 161 161 CYS CYS A . n A 1 135 GLY 135 162 162 GLY GLY A . n A 1 136 VAL 136 163 163 VAL VAL A . n A 1 137 LEU 137 164 164 LEU LEU A . n A 1 138 HIS 138 165 165 HIS HIS A . n A 1 139 ARG 139 166 166 ARG ARG A . n A 1 140 ASP 140 167 167 ASP ASP A . n A 1 141 ILE 141 168 168 ILE ILE A . n A 1 142 LYS 142 169 169 LYS LYS A . n A 1 143 ASP 143 170 170 ASP ASP A . n A 1 144 GLU 144 171 171 GLU GLU A . n A 1 145 ASN 145 172 172 ASN ASN A . n A 1 146 ILE 146 173 173 ILE ILE A . n A 1 147 LEU 147 174 174 LEU LEU A . n A 1 148 ILE 148 175 175 ILE ILE A . n A 1 149 ASP 149 176 176 ASP ASP A . n A 1 150 LEU 150 177 177 LEU LEU A . n A 1 151 ASN 151 178 178 ASN ASN A . n A 1 152 ARG 152 179 179 ARG ARG A . n A 1 153 GLY 153 180 180 GLY GLY A . n A 1 154 GLU 154 181 181 GLU GLU A . n A 1 155 LEU 155 182 182 LEU LEU A . n A 1 156 LYS 156 183 183 LYS LYS A . n A 1 157 LEU 157 184 184 LEU LEU A . n A 1 158 ILE 158 185 185 ILE ILE A . n A 1 159 ASP 159 186 186 ASP ASP A . n A 1 160 PHE 160 187 187 PHE PHE A . n A 1 161 GLY 161 188 188 GLY GLY A . n A 1 162 SER 162 189 189 SER SER A . n A 1 163 GLY 163 190 190 GLY GLY A . n A 1 164 ALA 164 191 191 ALA ALA A . n A 1 165 LEU 165 192 192 LEU LEU A . n A 1 166 LEU 166 193 193 LEU LEU A . n A 1 167 LYS 167 194 194 LYS LYS A . n A 1 168 ASP 168 195 195 ASP ASP A . n A 1 169 THR 169 196 196 THR THR A . n A 1 170 VAL 170 197 197 VAL VAL A . n A 1 171 TYR 171 198 198 TYR TYR A . n A 1 172 THR 172 199 199 THR THR A . n A 1 173 ASP 173 200 200 ASP ASP A . n A 1 174 PHE 174 201 201 PHE PHE A . n A 1 175 ASP 175 202 202 ASP ASP A . n A 1 176 GLY 176 203 203 GLY GLY A . n A 1 177 THR 177 204 204 THR THR A . n A 1 178 ARG 178 205 205 ARG ARG A . n A 1 179 VAL 179 206 206 VAL VAL A . n A 1 180 TYR 180 207 207 TYR TYR A . n A 1 181 SER 181 208 208 SER SER A . n A 1 182 PRO 182 209 209 PRO PRO A . n A 1 183 PRO 183 210 210 PRO PRO A . n A 1 184 GLU 184 211 211 GLU GLU A . n A 1 185 TRP 185 212 212 TRP TRP A . n A 1 186 ILE 186 213 213 ILE ILE A . n A 1 187 ARG 187 214 214 ARG ARG A . n A 1 188 TYR 188 215 215 TYR TYR A . n A 1 189 HIS 189 216 216 HIS HIS A . n A 1 190 ARG 190 217 217 ARG ARG A . n A 1 191 TYR 191 218 218 TYR TYR A . n A 1 192 HIS 192 219 219 HIS HIS A . n A 1 193 GLY 193 220 220 GLY GLY A . n A 1 194 ARG 194 221 221 ARG ARG A . n A 1 195 SER 195 222 222 SER SER A . n A 1 196 ALA 196 223 223 ALA ALA A . n A 1 197 ALA 197 224 224 ALA ALA A . n A 1 198 VAL 198 225 225 VAL VAL A . n A 1 199 TRP 199 226 226 TRP TRP A . n A 1 200 SER 200 227 227 SER SER A . n A 1 201 LEU 201 228 228 LEU LEU A . n A 1 202 GLY 202 229 229 GLY GLY A . n A 1 203 ILE 203 230 230 ILE ILE A . n A 1 204 LEU 204 231 231 LEU LEU A . n A 1 205 LEU 205 232 232 LEU LEU A . n A 1 206 TYR 206 233 233 TYR TYR A . n A 1 207 ASP 207 234 234 ASP ASP A . n A 1 208 MET 208 235 235 MET MET A . n A 1 209 VAL 209 236 236 VAL VAL A . n A 1 210 CYS 210 237 237 CYS CYS A . n A 1 211 GLY 211 238 238 GLY GLY A . n A 1 212 ASP 212 239 239 ASP ASP A . n A 1 213 ILE 213 240 240 ILE ILE A . n A 1 214 PRO 214 241 241 PRO PRO A . n A 1 215 PHE 215 242 242 PHE PHE A . n A 1 216 GLU 216 243 243 GLU GLU A . n A 1 217 HIS 217 244 244 HIS HIS A . n A 1 218 ASP 218 245 245 ASP ASP A . n A 1 219 GLU 219 246 246 GLU GLU A . n A 1 220 GLU 220 247 247 GLU GLU A . n A 1 221 ILE 221 248 248 ILE ILE A . n A 1 222 ILE 222 249 249 ILE ILE A . n A 1 223 ARG 223 250 250 ARG ARG A . n A 1 224 GLY 224 251 251 GLY GLY A . n A 1 225 GLN 225 252 252 GLN GLN A . n A 1 226 VAL 226 253 253 VAL VAL A . n A 1 227 PHE 227 254 254 PHE PHE A . n A 1 228 PHE 228 255 255 PHE PHE A . n A 1 229 ARG 229 256 256 ARG ARG A . n A 1 230 GLN 230 257 257 GLN GLN A . n A 1 231 ARG 231 258 258 ARG ARG A . n A 1 232 VAL 232 259 259 VAL VAL A . n A 1 233 SER 233 260 260 SER SER A . n A 1 234 SER 234 261 261 SER SER A . n A 1 235 GLU 235 262 262 GLU GLU A . n A 1 236 CYS 236 263 263 CYS CYS A . n A 1 237 GLN 237 264 264 GLN GLN A . n A 1 238 HIS 238 265 265 HIS HIS A . n A 1 239 LEU 239 266 266 LEU LEU A . n A 1 240 ILE 240 267 267 ILE ILE A . n A 1 241 ARG 241 268 268 ARG ARG A . n A 1 242 TRP 242 269 269 TRP TRP A . n A 1 243 CYS 243 270 270 CYS CYS A . n A 1 244 LEU 244 271 271 LEU LEU A . n A 1 245 ALA 245 272 272 ALA ALA A . n A 1 246 LEU 246 273 273 LEU LEU A . n A 1 247 ARG 247 274 274 ARG ARG A . n A 1 248 PRO 248 275 275 PRO PRO A . n A 1 249 SER 249 276 276 SER SER A . n A 1 250 ASP 250 277 277 ASP ASP A . n A 1 251 ARG 251 278 278 ARG ARG A . n A 1 252 PRO 252 279 279 PRO PRO A . n A 1 253 THR 253 280 280 THR THR A . n A 1 254 PHE 254 281 281 PHE PHE A . n A 1 255 GLU 255 282 282 GLU GLU A . n A 1 256 GLU 256 283 283 GLU GLU A . n A 1 257 ILE 257 284 284 ILE ILE A . n A 1 258 GLN 258 285 285 GLN GLN A . n A 1 259 ASN 259 286 286 ASN ASN A . n A 1 260 HIS 260 287 287 HIS HIS A . n A 1 261 PRO 261 288 288 PRO PRO A . n A 1 262 TRP 262 289 289 TRP TRP A . n A 1 263 MET 263 290 290 MET MET A . n A 1 264 GLN 264 291 291 GLN GLN A . n A 1 265 ASP 265 292 292 ASP ASP A . n A 1 266 VAL 266 293 293 VAL VAL A . n A 1 267 LEU 267 294 294 LEU LEU A . n A 1 268 LEU 268 295 295 LEU LEU A . n A 1 269 PRO 269 296 296 PRO PRO A . n A 1 270 GLN 270 297 297 GLN GLN A . n A 1 271 GLU 271 298 298 GLU GLU A . n A 1 272 THR 272 299 299 THR THR A . n A 1 273 ALA 273 300 300 ALA ALA A . n A 1 274 GLU 274 301 301 GLU GLU A . n A 1 275 ILE 275 302 302 ILE ILE A . n A 1 276 HIS 276 303 303 HIS HIS A . n A 1 277 LEU 277 304 304 LEU LEU A . n A 1 278 HIS 278 305 305 HIS HIS A . n A 1 279 SER 279 306 ? ? ? A . n A 1 280 LEU 280 307 ? ? ? A . n A 1 281 SER 281 308 ? ? ? A . n A 1 282 PRO 282 309 ? ? ? A . n A 1 283 GLY 283 310 ? ? ? A . n A 1 284 PRO 284 311 ? ? ? A . n A 1 285 SER 285 312 ? ? ? A . n A 1 286 LYS 286 313 ? ? ? A . n A 1 287 ALA 287 314 ? ? ? A . n A 1 288 ALA 288 315 ? ? ? A . n A 1 289 ALA 289 316 ? ? ? A . n A 1 290 LEU 290 317 ? ? ? A . n A 1 291 GLU 291 318 ? ? ? A . n A 1 292 HIS 292 319 ? ? ? A . n A 1 293 HIS 293 320 ? ? ? A . n A 1 294 HIS 294 321 ? ? ? A . n A 1 295 HIS 295 322 ? ? ? A . n A 1 296 HIS 296 323 ? ? ? A . n A 1 297 HIS 297 324 ? ? ? A . n A 1 298 HIS 298 325 ? ? ? A . n A 1 299 HIS 299 326 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-03-21 2 'Structure model' 1 1 2012-05-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 31.0465 _pdbx_refine_tls.origin_y 27.0644 _pdbx_refine_tls.origin_z 0.4279 _pdbx_refine_tls.T[1][1] 0.0297 _pdbx_refine_tls.T[2][2] 0.0237 _pdbx_refine_tls.T[3][3] 0.0219 _pdbx_refine_tls.T[1][2] 0.0111 _pdbx_refine_tls.T[1][3] -0.0085 _pdbx_refine_tls.T[2][3] 0.0047 _pdbx_refine_tls.L[1][1] 1.4192 _pdbx_refine_tls.L[2][2] 1.1386 _pdbx_refine_tls.L[3][3] 1.4480 _pdbx_refine_tls.L[1][2] -0.2552 _pdbx_refine_tls.L[1][3] -0.4011 _pdbx_refine_tls.L[2][3] -0.0999 _pdbx_refine_tls.S[1][1] -0.0341 _pdbx_refine_tls.S[1][2] -0.0229 _pdbx_refine_tls.S[1][3] 0.0189 _pdbx_refine_tls.S[2][1] -0.0378 _pdbx_refine_tls.S[2][2] 0.0492 _pdbx_refine_tls.S[2][3] 0.0251 _pdbx_refine_tls.S[3][1] 0.0162 _pdbx_refine_tls.S[3][2] -0.1345 _pdbx_refine_tls.S[3][3] -0.0151 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 35 A 305 ? . . . . ? 'X-RAY DIFFRACTION' 2 1 A 1 A 1 ? . . . . ? 'X-RAY DIFFRACTION' 3 1 A 2 A 27 ? . . . . ? 'X-RAY DIFFRACTION' 4 1 A 327 A 375 ? . . . . ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 PRO _pdbx_validate_close_contact.auth_seq_id_1 241 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 359 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 159 ? ? CD2 A HIS 159 ? ? 1.408 1.354 0.054 0.009 N 2 1 CE2 A TRP 212 ? ? CD2 A TRP 212 ? ? 1.482 1.409 0.073 0.012 N 3 1 CG A HIS 216 ? ? CD2 A HIS 216 ? ? 1.415 1.354 0.061 0.009 N 4 1 CG A HIS 219 ? ? CD2 A HIS 219 ? ? 1.408 1.354 0.054 0.009 N 5 1 CG A HIS 265 ? ? CD2 A HIS 265 ? ? 1.412 1.354 0.058 0.009 N 6 1 CE2 A TRP 269 ? ? CD2 A TRP 269 ? ? 1.482 1.409 0.073 0.012 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 60 ? ? -146.16 21.15 2 1 GLU A 79 ? ? -175.61 -176.41 3 1 SER A 101 ? ? -179.96 -161.85 4 1 GLU A 124 ? ? -163.29 109.92 5 1 ARG A 166 ? ? 81.06 -4.45 6 1 ASP A 167 ? ? -140.14 44.19 7 1 ASP A 186 ? ? 67.98 79.40 8 1 ASP A 202 ? ? -142.47 33.12 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 28 ? A MET 1 2 1 Y 1 A LYS 29 ? A LYS 2 3 1 Y 1 A GLU 30 ? A GLU 3 4 1 Y 1 A LYS 31 ? A LYS 4 5 1 Y 1 A GLU 32 ? A GLU 5 6 1 Y 1 A PRO 33 ? A PRO 6 7 1 Y 1 A LEU 34 ? A LEU 7 8 1 Y 1 A SER 46 ? A SER 19 9 1 Y 1 A GLY 47 ? A GLY 20 10 1 Y 1 A GLY 48 ? A GLY 21 11 1 Y 1 A PHE 49 ? A PHE 22 12 1 Y 1 A PRO 81 ? A PRO 54 13 1 Y 1 A ASN 82 ? A ASN 55 14 1 Y 1 A GLY 83 ? A GLY 56 15 1 Y 1 A SER 306 ? A SER 279 16 1 Y 1 A LEU 307 ? A LEU 280 17 1 Y 1 A SER 308 ? A SER 281 18 1 Y 1 A PRO 309 ? A PRO 282 19 1 Y 1 A GLY 310 ? A GLY 283 20 1 Y 1 A PRO 311 ? A PRO 284 21 1 Y 1 A SER 312 ? A SER 285 22 1 Y 1 A LYS 313 ? A LYS 286 23 1 Y 1 A ALA 314 ? A ALA 287 24 1 Y 1 A ALA 315 ? A ALA 288 25 1 Y 1 A ALA 316 ? A ALA 289 26 1 Y 1 A LEU 317 ? A LEU 290 27 1 Y 1 A GLU 318 ? A GLU 291 28 1 Y 1 A HIS 319 ? A HIS 292 29 1 Y 1 A HIS 320 ? A HIS 293 30 1 Y 1 A HIS 321 ? A HIS 294 31 1 Y 1 A HIS 322 ? A HIS 295 32 1 Y 1 A HIS 323 ? A HIS 296 33 1 Y 1 A HIS 324 ? A HIS 297 34 1 Y 1 A HIS 325 ? A HIS 298 35 1 Y 1 A HIS 326 ? A HIS 299 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,3-dioxo-2,3-dihydro-1H-indene-2-carbonitrile 0FN 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 0FN 1 1 1 0FN 0FN A . C 3 HOH 1 2 2 HOH HOH A . C 3 HOH 2 4 4 HOH HOH A . C 3 HOH 3 5 5 HOH HOH A . C 3 HOH 4 6 6 HOH HOH A . C 3 HOH 5 7 7 HOH HOH A . C 3 HOH 6 8 8 HOH HOH A . C 3 HOH 7 9 9 HOH HOH A . C 3 HOH 8 11 11 HOH HOH A . C 3 HOH 9 12 12 HOH HOH A . C 3 HOH 10 13 13 HOH HOH A . C 3 HOH 11 14 14 HOH HOH A . C 3 HOH 12 15 15 HOH HOH A . C 3 HOH 13 16 16 HOH HOH A . C 3 HOH 14 17 17 HOH HOH A . C 3 HOH 15 18 18 HOH HOH A . C 3 HOH 16 19 19 HOH HOH A . C 3 HOH 17 20 20 HOH HOH A . C 3 HOH 18 21 21 HOH HOH A . C 3 HOH 19 22 22 HOH HOH A . C 3 HOH 20 23 23 HOH HOH A . C 3 HOH 21 24 24 HOH HOH A . C 3 HOH 22 25 25 HOH HOH A . C 3 HOH 23 26 26 HOH HOH A . C 3 HOH 24 27 27 HOH HOH A . C 3 HOH 25 327 1 HOH HOH A . C 3 HOH 26 328 28 HOH HOH A . C 3 HOH 27 329 29 HOH HOH A . C 3 HOH 28 330 30 HOH HOH A . C 3 HOH 29 331 31 HOH HOH A . C 3 HOH 30 332 32 HOH HOH A . C 3 HOH 31 333 33 HOH HOH A . C 3 HOH 32 334 34 HOH HOH A . C 3 HOH 33 335 35 HOH HOH A . C 3 HOH 34 336 36 HOH HOH A . C 3 HOH 35 337 37 HOH HOH A . C 3 HOH 36 338 38 HOH HOH A . C 3 HOH 37 339 39 HOH HOH A . C 3 HOH 38 340 40 HOH HOH A . C 3 HOH 39 341 41 HOH HOH A . C 3 HOH 40 342 42 HOH HOH A . C 3 HOH 41 343 43 HOH HOH A . C 3 HOH 42 344 44 HOH HOH A . C 3 HOH 43 345 45 HOH HOH A . C 3 HOH 44 346 46 HOH HOH A . C 3 HOH 45 347 47 HOH HOH A . C 3 HOH 46 348 48 HOH HOH A . C 3 HOH 47 349 49 HOH HOH A . C 3 HOH 48 350 50 HOH HOH A . C 3 HOH 49 351 51 HOH HOH A . C 3 HOH 50 352 52 HOH HOH A . C 3 HOH 51 353 53 HOH HOH A . C 3 HOH 52 354 54 HOH HOH A . C 3 HOH 53 355 55 HOH HOH A . C 3 HOH 54 356 56 HOH HOH A . C 3 HOH 55 357 57 HOH HOH A . C 3 HOH 56 358 58 HOH HOH A . C 3 HOH 57 359 59 HOH HOH A . C 3 HOH 58 360 60 HOH HOH A . C 3 HOH 59 361 63 HOH HOH A . C 3 HOH 60 362 64 HOH HOH A . C 3 HOH 61 363 65 HOH HOH A . C 3 HOH 62 364 66 HOH HOH A . C 3 HOH 63 365 68 HOH HOH A . C 3 HOH 64 366 69 HOH HOH A . C 3 HOH 65 367 70 HOH HOH A . C 3 HOH 66 368 71 HOH HOH A . C 3 HOH 67 369 72 HOH HOH A . C 3 HOH 68 370 73 HOH HOH A . C 3 HOH 69 371 74 HOH HOH A . C 3 HOH 70 372 75 HOH HOH A . C 3 HOH 71 373 76 HOH HOH A . C 3 HOH 72 374 77 HOH HOH A . C 3 HOH 73 375 78 HOH HOH A . #