data_3VF9 # _entry.id 3VF9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3VF9 RCSB RCSB069971 WWPDB D_1000069971 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3VF8 . unspecified PDB 3V8W . unspecified PDB 3V8T . unspecified PDB 3V5J . unspecified PDB 3V5L . unspecified # _pdbx_database_status.entry_id 3VF9 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-01-09 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'McLean, L.R.' 1 'Zhang, Y.' 2 # _citation.id primary _citation.title 'X-ray crystallographic structure-based design of selective thienopyrazole inhibitors for interleukin-2-inducible tyrosine kinase.' _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_volume 22 _citation.page_first 3296 _citation.page_last 3300 _citation.year 2012 _citation.journal_id_ASTM BMCLE8 _citation.country UK _citation.journal_id_ISSN 0960-894X _citation.journal_id_CSD 1127 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22464456 _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2012.03.016 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'McLean, L.R.' 1 primary 'Zhang, Y.' 2 primary 'Zaidi, N.' 3 primary 'Bi, X.' 4 primary 'Wang, R.' 5 primary 'Dharanipragada, R.' 6 primary 'Jurcak, J.G.' 7 primary 'Gillespy, T.A.' 8 primary 'Zhao, Z.' 9 primary 'Musick, K.Y.' 10 primary 'Choi, Y.M.' 11 primary 'Barrague, M.' 12 primary 'Peppard, J.' 13 primary 'Smicker, M.' 14 primary 'Duguid, M.' 15 primary 'Parkar, A.' 16 primary 'Fordham, J.' 17 primary 'Kominos, D.' 18 # _cell.length_a 39.813 _cell.length_b 84.739 _cell.length_c 90.184 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3VF9 _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 3VF9 _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase SYK' 34880.969 1 2.7.10.2 ? 'unp residues 343-635' ? 2 non-polymer syn '3-{2-[5-(difluoromethyl)-2H-thieno[3,2-c]pyrazol-3-yl]-1H-indol-6-yl}pentan-3-ol' 375.435 1 ? ? ? ? 3 water nat water 18.015 43 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Spleen tyrosine kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEAN VMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLL VTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVT AMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEAN VMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLL VTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVT AMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 THR n 1 4 GLU n 1 5 VAL n 1 6 TYR n 1 7 GLU n 1 8 SER n 1 9 PRO n 1 10 TYR n 1 11 ALA n 1 12 ASP n 1 13 PRO n 1 14 GLU n 1 15 GLU n 1 16 ILE n 1 17 ARG n 1 18 PRO n 1 19 LYS n 1 20 GLU n 1 21 VAL n 1 22 TYR n 1 23 LEU n 1 24 ASP n 1 25 ARG n 1 26 LYS n 1 27 LEU n 1 28 LEU n 1 29 THR n 1 30 LEU n 1 31 GLU n 1 32 ASP n 1 33 LYS n 1 34 GLU n 1 35 LEU n 1 36 GLY n 1 37 SER n 1 38 GLY n 1 39 ASN n 1 40 PHE n 1 41 GLY n 1 42 THR n 1 43 VAL n 1 44 LYS n 1 45 LYS n 1 46 GLY n 1 47 TYR n 1 48 TYR n 1 49 GLN n 1 50 MET n 1 51 LYS n 1 52 LYS n 1 53 VAL n 1 54 VAL n 1 55 LYS n 1 56 THR n 1 57 VAL n 1 58 ALA n 1 59 VAL n 1 60 LYS n 1 61 ILE n 1 62 LEU n 1 63 LYS n 1 64 ASN n 1 65 GLU n 1 66 ALA n 1 67 ASN n 1 68 ASP n 1 69 PRO n 1 70 ALA n 1 71 LEU n 1 72 LYS n 1 73 ASP n 1 74 GLU n 1 75 LEU n 1 76 LEU n 1 77 ALA n 1 78 GLU n 1 79 ALA n 1 80 ASN n 1 81 VAL n 1 82 MET n 1 83 GLN n 1 84 GLN n 1 85 LEU n 1 86 ASP n 1 87 ASN n 1 88 PRO n 1 89 TYR n 1 90 ILE n 1 91 VAL n 1 92 ARG n 1 93 MET n 1 94 ILE n 1 95 GLY n 1 96 ILE n 1 97 CYS n 1 98 GLU n 1 99 ALA n 1 100 GLU n 1 101 SER n 1 102 TRP n 1 103 MET n 1 104 LEU n 1 105 VAL n 1 106 MET n 1 107 GLU n 1 108 MET n 1 109 ALA n 1 110 GLU n 1 111 LEU n 1 112 GLY n 1 113 PRO n 1 114 LEU n 1 115 ASN n 1 116 LYS n 1 117 TYR n 1 118 LEU n 1 119 GLN n 1 120 GLN n 1 121 ASN n 1 122 ARG n 1 123 HIS n 1 124 VAL n 1 125 LYS n 1 126 ASP n 1 127 LYS n 1 128 ASN n 1 129 ILE n 1 130 ILE n 1 131 GLU n 1 132 LEU n 1 133 VAL n 1 134 HIS n 1 135 GLN n 1 136 VAL n 1 137 SER n 1 138 MET n 1 139 GLY n 1 140 MET n 1 141 LYS n 1 142 TYR n 1 143 LEU n 1 144 GLU n 1 145 GLU n 1 146 SER n 1 147 ASN n 1 148 PHE n 1 149 VAL n 1 150 HIS n 1 151 ARG n 1 152 ASP n 1 153 LEU n 1 154 ALA n 1 155 ALA n 1 156 ARG n 1 157 ASN n 1 158 VAL n 1 159 LEU n 1 160 LEU n 1 161 VAL n 1 162 THR n 1 163 GLN n 1 164 HIS n 1 165 TYR n 1 166 ALA n 1 167 LYS n 1 168 ILE n 1 169 SER n 1 170 ASP n 1 171 PHE n 1 172 GLY n 1 173 LEU n 1 174 SER n 1 175 LYS n 1 176 ALA n 1 177 LEU n 1 178 ARG n 1 179 ALA n 1 180 ASP n 1 181 GLU n 1 182 ASN n 1 183 TYR n 1 184 TYR n 1 185 LYS n 1 186 ALA n 1 187 GLN n 1 188 THR n 1 189 HIS n 1 190 GLY n 1 191 LYS n 1 192 TRP n 1 193 PRO n 1 194 VAL n 1 195 LYS n 1 196 TRP n 1 197 TYR n 1 198 ALA n 1 199 PRO n 1 200 GLU n 1 201 CYS n 1 202 ILE n 1 203 ASN n 1 204 TYR n 1 205 TYR n 1 206 LYS n 1 207 PHE n 1 208 SER n 1 209 SER n 1 210 LYS n 1 211 SER n 1 212 ASP n 1 213 VAL n 1 214 TRP n 1 215 SER n 1 216 PHE n 1 217 GLY n 1 218 VAL n 1 219 LEU n 1 220 MET n 1 221 TRP n 1 222 GLU n 1 223 ALA n 1 224 PHE n 1 225 SER n 1 226 TYR n 1 227 GLY n 1 228 GLN n 1 229 LYS n 1 230 PRO n 1 231 TYR n 1 232 ARG n 1 233 GLY n 1 234 MET n 1 235 LYS n 1 236 GLY n 1 237 SER n 1 238 GLU n 1 239 VAL n 1 240 THR n 1 241 ALA n 1 242 MET n 1 243 LEU n 1 244 GLU n 1 245 LYS n 1 246 GLY n 1 247 GLU n 1 248 ARG n 1 249 MET n 1 250 GLY n 1 251 CYS n 1 252 PRO n 1 253 ALA n 1 254 GLY n 1 255 CYS n 1 256 PRO n 1 257 ARG n 1 258 GLU n 1 259 MET n 1 260 TYR n 1 261 ASP n 1 262 LEU n 1 263 MET n 1 264 ASN n 1 265 LEU n 1 266 CYS n 1 267 TRP n 1 268 THR n 1 269 TYR n 1 270 ASP n 1 271 VAL n 1 272 GLU n 1 273 ASN n 1 274 ARG n 1 275 PRO n 1 276 GLY n 1 277 PHE n 1 278 ALA n 1 279 ALA n 1 280 VAL n 1 281 GLU n 1 282 LEU n 1 283 ARG n 1 284 LEU n 1 285 ARG n 1 286 ASN n 1 287 TYR n 1 288 TYR n 1 289 TYR n 1 290 ASP n 1 291 VAL n 1 292 VAL n 1 293 ASN n 1 294 HIS n 1 295 HIS n 1 296 HIS n 1 297 HIS n 1 298 HIS n 1 299 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SYK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pFastBac1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KSYK_HUMAN _struct_ref.pdbx_db_accession P43405 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEAN VMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLL VTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVT AMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN ; _struct_ref.pdbx_align_begin 343 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3VF9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 293 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P43405 _struct_ref_seq.db_align_beg 343 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 635 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 343 _struct_ref_seq.pdbx_auth_seq_align_end 635 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3VF9 HIS A 294 ? UNP P43405 ? ? 'EXPRESSION TAG' 636 1 1 3VF9 HIS A 295 ? UNP P43405 ? ? 'EXPRESSION TAG' 637 2 1 3VF9 HIS A 296 ? UNP P43405 ? ? 'EXPRESSION TAG' 638 3 1 3VF9 HIS A 297 ? UNP P43405 ? ? 'EXPRESSION TAG' 639 4 1 3VF9 HIS A 298 ? UNP P43405 ? ? 'EXPRESSION TAG' 640 5 1 3VF9 HIS A 299 ? UNP P43405 ? ? 'EXPRESSION TAG' 641 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 477 non-polymer . '3-{2-[5-(difluoromethyl)-2H-thieno[3,2-c]pyrazol-3-yl]-1H-indol-6-yl}pentan-3-ol' ? 'C19 H19 F2 N3 O S' 375.435 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3VF9 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 43.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.pH 4.7 _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '19% PEG3350, 0.1 M Na-citrate, 0.175 M K-phosphate, pH 4.7, VAPOR DIFFUSION, temperature 292K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2004-11-18 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH3R' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 3VF9 _reflns.d_resolution_high 2.300 _reflns.d_resolution_low 50.000 _reflns.number_obs 14135 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_netI_over_sigmaI 17.700 _reflns.pdbx_chi_squared 1.050 _reflns.pdbx_redundancy 12.300 _reflns.percent_possible_obs 99.200 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.300 2.380 ? ? ? 0.454 ? ? 1.057 10.800 ? 1339 96.300 1 1 2.380 2.480 ? ? ? 0.370 ? ? 1.100 11.600 ? 1365 98.100 2 1 2.480 2.590 ? ? ? 0.299 ? ? 1.131 11.900 ? 1385 99.200 3 1 2.590 2.730 ? ? ? 0.232 ? ? 1.097 12.200 ? 1398 99.700 4 1 2.730 2.900 ? ? ? 0.163 ? ? 1.043 12.600 ? 1403 99.900 5 1 2.900 3.120 ? ? ? 0.118 ? ? 1.049 12.800 ? 1397 99.900 6 1 3.120 3.440 ? ? ? 0.087 ? ? 1.024 13.000 ? 1420 100.000 7 1 3.440 3.930 ? ? ? 0.061 ? ? 0.915 13.000 ? 1435 100.000 8 1 3.930 4.950 ? ? ? 0.052 ? ? 1.067 12.800 ? 1456 100.000 9 1 4.950 50.000 ? ? ? 0.041 ? ? 1.037 12.000 ? 1537 99.000 10 1 # _refine.entry_id 3VF9 _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 38.3500 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.3900 _refine.ls_number_reflns_obs 14092 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2551 _refine.ls_R_factor_R_work 0.2545 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2673 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.9900 _refine.ls_number_reflns_R_free 703 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 46.8141 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 6.9783 _refine.aniso_B[2][2] 11.1599 _refine.aniso_B[3][3] -18.1381 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI 0.3530 _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 124.000 _refine.B_iso_min 21.440 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 1.000 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3VF9 _refine_analyze.Luzzati_coordinate_error_obs 0.394 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2028 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 2092 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 38.3500 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id t_dihedral_angle_d 682 ? ? 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' t_trig_c_planes 39 ? ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_gen_planes 307 ? ? 5.000 HARMONIC 'X-RAY DIFFRACTION' t_it 2075 ? ? 20.000 HARMONIC 'X-RAY DIFFRACTION' t_nbd ? ? ? ? ? 'X-RAY DIFFRACTION' t_improper_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_pseud_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_chiral_improper_torsion 262 ? ? 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_sum_occupancies ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_distance ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_ideal_dist_contact 2387 ? ? 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_bond_d 2099 0.007 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_angle_deg 2851 0.910 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_omega_torsion ? 1.870 ? ? ? 'X-RAY DIFFRACTION' t_other_torsion ? 18.430 ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.2900 _refine_ls_shell.d_res_low 2.4700 _refine_ls_shell.pdbx_total_number_of_bins_used 7 _refine_ls_shell.percent_reflns_obs 98.3900 _refine_ls_shell.number_reflns_R_work 2550 _refine_ls_shell.R_factor_all 0.2908 _refine_ls_shell.R_factor_R_work 0.2896 _refine_ls_shell.R_factor_R_free 0.3109 _refine_ls_shell.percent_reflns_R_free 5.0300 _refine_ls_shell.number_reflns_R_free 135 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2685 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3VF9 _struct.title 'Crystal Structure of Spleen Tyrosine Kinase Syk Catalytic Domain with Thienopyrazolylindole Inhibitor 027' _struct.pdbx_descriptor 'Tyrosine-protein kinase SYK (E.C.2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3VF9 _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text 'kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 70 ? LEU A 85 ? ALA A 412 LEU A 427 1 ? 16 HELX_P HELX_P2 2 LEU A 114 ? ASN A 121 ? LEU A 456 ASN A 463 1 ? 8 HELX_P HELX_P3 3 LYS A 125 ? SER A 146 ? LYS A 467 SER A 488 1 ? 22 HELX_P HELX_P4 4 ALA A 154 ? ARG A 156 ? ALA A 496 ARG A 498 5 ? 3 HELX_P HELX_P5 5 PRO A 193 ? TYR A 197 ? PRO A 535 TYR A 539 5 ? 5 HELX_P HELX_P6 6 ALA A 198 ? TYR A 204 ? ALA A 540 TYR A 546 1 ? 7 HELX_P HELX_P7 7 SER A 208 ? SER A 225 ? SER A 550 SER A 567 1 ? 18 HELX_P HELX_P8 8 LYS A 235 ? LYS A 245 ? LYS A 577 LYS A 587 1 ? 11 HELX_P HELX_P9 9 PRO A 256 ? TRP A 267 ? PRO A 598 TRP A 609 1 ? 12 HELX_P HELX_P10 10 GLY A 276 ? ASN A 293 ? GLY A 618 ASN A 635 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 3 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 30 ? SER A 37 ? LEU A 372 SER A 379 A 2 THR A 42 ? GLY A 46 ? THR A 384 GLY A 388 A 3 VAL A 57 ? ILE A 61 ? VAL A 399 ILE A 403 A 4 TRP A 102 ? GLU A 107 ? TRP A 444 GLU A 449 A 5 MET A 93 ? GLU A 98 ? MET A 435 GLU A 440 B 1 GLY A 112 ? PRO A 113 ? GLY A 454 PRO A 455 B 2 VAL A 158 ? THR A 162 ? VAL A 500 THR A 504 B 3 TYR A 165 ? ILE A 168 ? TYR A 507 ILE A 510 C 1 PHE A 148 ? VAL A 149 ? PHE A 490 VAL A 491 C 2 LYS A 175 ? ALA A 176 ? LYS A 517 ALA A 518 D 1 TYR A 184 ? LYS A 185 ? TYR A 526 LYS A 527 D 2 LYS A 206 ? PHE A 207 ? LYS A 548 PHE A 549 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 36 ? N GLY A 378 O VAL A 43 ? O VAL A 385 A 2 3 N GLY A 46 ? N GLY A 388 O VAL A 57 ? O VAL A 399 A 3 4 N ALA A 58 ? N ALA A 400 O MET A 106 ? O MET A 448 A 4 5 O MET A 103 ? O MET A 445 N CYS A 97 ? N CYS A 439 B 1 2 N GLY A 112 ? N GLY A 454 O LEU A 160 ? O LEU A 502 B 2 3 N LEU A 159 ? N LEU A 501 O LYS A 167 ? O LYS A 509 C 1 2 N VAL A 149 ? N VAL A 491 O LYS A 175 ? O LYS A 517 D 1 2 N TYR A 184 ? N TYR A 526 O PHE A 207 ? O PHE A 549 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE 477 A 701' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 LEU A 35 ? LEU A 377 . ? 1_555 ? 2 AC1 11 ALA A 58 ? ALA A 400 . ? 1_555 ? 3 AC1 11 MET A 106 ? MET A 448 . ? 1_555 ? 4 AC1 11 GLU A 107 ? GLU A 449 . ? 1_555 ? 5 AC1 11 MET A 108 ? MET A 450 . ? 1_555 ? 6 AC1 11 ALA A 109 ? ALA A 451 . ? 1_555 ? 7 AC1 11 GLU A 110 ? GLU A 452 . ? 1_555 ? 8 AC1 11 LEU A 111 ? LEU A 453 . ? 1_555 ? 9 AC1 11 GLY A 112 ? GLY A 454 . ? 1_555 ? 10 AC1 11 PRO A 113 ? PRO A 455 . ? 1_555 ? 11 AC1 11 LEU A 159 ? LEU A 501 . ? 1_555 ? # _atom_sites.entry_id 3VF9 _atom_sites.fract_transf_matrix[1][1] 0.025117 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011801 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011088 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 343 ? ? ? A . n A 1 2 ASP 2 344 ? ? ? A . n A 1 3 THR 3 345 ? ? ? A . n A 1 4 GLU 4 346 ? ? ? A . n A 1 5 VAL 5 347 ? ? ? A . n A 1 6 TYR 6 348 ? ? ? A . n A 1 7 GLU 7 349 ? ? ? A . n A 1 8 SER 8 350 ? ? ? A . n A 1 9 PRO 9 351 ? ? ? A . n A 1 10 TYR 10 352 ? ? ? A . n A 1 11 ALA 11 353 ? ? ? A . n A 1 12 ASP 12 354 ? ? ? A . n A 1 13 PRO 13 355 ? ? ? A . n A 1 14 GLU 14 356 ? ? ? A . n A 1 15 GLU 15 357 ? ? ? A . n A 1 16 ILE 16 358 ? ? ? A . n A 1 17 ARG 17 359 ? ? ? A . n A 1 18 PRO 18 360 ? ? ? A . n A 1 19 LYS 19 361 ? ? ? A . n A 1 20 GLU 20 362 ? ? ? A . n A 1 21 VAL 21 363 ? ? ? A . n A 1 22 TYR 22 364 364 TYR TYR A . n A 1 23 LEU 23 365 365 LEU LEU A . n A 1 24 ASP 24 366 366 ASP ASP A . n A 1 25 ARG 25 367 367 ARG ARG A . n A 1 26 LYS 26 368 368 LYS LYS A . n A 1 27 LEU 27 369 369 LEU LEU A . n A 1 28 LEU 28 370 370 LEU LEU A . n A 1 29 THR 29 371 371 THR THR A . n A 1 30 LEU 30 372 372 LEU LEU A . n A 1 31 GLU 31 373 373 GLU GLU A . n A 1 32 ASP 32 374 374 ASP ASP A . n A 1 33 LYS 33 375 375 LYS LYS A . n A 1 34 GLU 34 376 376 GLU GLU A . n A 1 35 LEU 35 377 377 LEU LEU A . n A 1 36 GLY 36 378 378 GLY GLY A . n A 1 37 SER 37 379 379 SER SER A . n A 1 38 GLY 38 380 380 GLY GLY A . n A 1 39 ASN 39 381 381 ASN ASN A . n A 1 40 PHE 40 382 382 PHE PHE A . n A 1 41 GLY 41 383 383 GLY GLY A . n A 1 42 THR 42 384 384 THR THR A . n A 1 43 VAL 43 385 385 VAL VAL A . n A 1 44 LYS 44 386 386 LYS LYS A . n A 1 45 LYS 45 387 387 LYS LYS A . n A 1 46 GLY 46 388 388 GLY GLY A . n A 1 47 TYR 47 389 389 TYR TYR A . n A 1 48 TYR 48 390 390 TYR TYR A . n A 1 49 GLN 49 391 391 GLN GLN A . n A 1 50 MET 50 392 392 MET MET A . n A 1 51 LYS 51 393 393 LYS LYS A . n A 1 52 LYS 52 394 ? ? ? A . n A 1 53 VAL 53 395 395 VAL VAL A . n A 1 54 VAL 54 396 396 VAL VAL A . n A 1 55 LYS 55 397 397 LYS LYS A . n A 1 56 THR 56 398 398 THR THR A . n A 1 57 VAL 57 399 399 VAL VAL A . n A 1 58 ALA 58 400 400 ALA ALA A . n A 1 59 VAL 59 401 401 VAL VAL A . n A 1 60 LYS 60 402 402 LYS LYS A . n A 1 61 ILE 61 403 403 ILE ILE A . n A 1 62 LEU 62 404 404 LEU LEU A . n A 1 63 LYS 63 405 ? ? ? A . n A 1 64 ASN 64 406 ? ? ? A . n A 1 65 GLU 65 407 ? ? ? A . n A 1 66 ALA 66 408 ? ? ? A . n A 1 67 ASN 67 409 ? ? ? A . n A 1 68 ASP 68 410 ? ? ? A . n A 1 69 PRO 69 411 411 PRO PRO A . n A 1 70 ALA 70 412 412 ALA ALA A . n A 1 71 LEU 71 413 413 LEU LEU A . n A 1 72 LYS 72 414 414 LYS LYS A . n A 1 73 ASP 73 415 415 ASP ASP A . n A 1 74 GLU 74 416 416 GLU GLU A . n A 1 75 LEU 75 417 417 LEU LEU A . n A 1 76 LEU 76 418 418 LEU LEU A . n A 1 77 ALA 77 419 419 ALA ALA A . n A 1 78 GLU 78 420 420 GLU GLU A . n A 1 79 ALA 79 421 421 ALA ALA A . n A 1 80 ASN 80 422 422 ASN ASN A . n A 1 81 VAL 81 423 423 VAL VAL A . n A 1 82 MET 82 424 424 MET MET A . n A 1 83 GLN 83 425 425 GLN GLN A . n A 1 84 GLN 84 426 426 GLN GLN A . n A 1 85 LEU 85 427 427 LEU LEU A . n A 1 86 ASP 86 428 428 ASP ASP A . n A 1 87 ASN 87 429 429 ASN ASN A . n A 1 88 PRO 88 430 430 PRO PRO A . n A 1 89 TYR 89 431 431 TYR TYR A . n A 1 90 ILE 90 432 432 ILE ILE A . n A 1 91 VAL 91 433 433 VAL VAL A . n A 1 92 ARG 92 434 434 ARG ARG A . n A 1 93 MET 93 435 435 MET MET A . n A 1 94 ILE 94 436 436 ILE ILE A . n A 1 95 GLY 95 437 437 GLY GLY A . n A 1 96 ILE 96 438 438 ILE ILE A . n A 1 97 CYS 97 439 439 CYS CYS A . n A 1 98 GLU 98 440 440 GLU GLU A . n A 1 99 ALA 99 441 441 ALA ALA A . n A 1 100 GLU 100 442 442 GLU GLU A . n A 1 101 SER 101 443 443 SER SER A . n A 1 102 TRP 102 444 444 TRP TRP A . n A 1 103 MET 103 445 445 MET MET A . n A 1 104 LEU 104 446 446 LEU LEU A . n A 1 105 VAL 105 447 447 VAL VAL A . n A 1 106 MET 106 448 448 MET MET A . n A 1 107 GLU 107 449 449 GLU GLU A . n A 1 108 MET 108 450 450 MET MET A . n A 1 109 ALA 109 451 451 ALA ALA A . n A 1 110 GLU 110 452 452 GLU GLU A . n A 1 111 LEU 111 453 453 LEU LEU A . n A 1 112 GLY 112 454 454 GLY GLY A . n A 1 113 PRO 113 455 455 PRO PRO A . n A 1 114 LEU 114 456 456 LEU LEU A . n A 1 115 ASN 115 457 457 ASN ASN A . n A 1 116 LYS 116 458 458 LYS LYS A . n A 1 117 TYR 117 459 459 TYR TYR A . n A 1 118 LEU 118 460 460 LEU LEU A . n A 1 119 GLN 119 461 461 GLN GLN A . n A 1 120 GLN 120 462 462 GLN GLN A . n A 1 121 ASN 121 463 463 ASN ASN A . n A 1 122 ARG 122 464 464 ARG ARG A . n A 1 123 HIS 123 465 465 HIS HIS A . n A 1 124 VAL 124 466 466 VAL VAL A . n A 1 125 LYS 125 467 467 LYS LYS A . n A 1 126 ASP 126 468 468 ASP ASP A . n A 1 127 LYS 127 469 469 LYS LYS A . n A 1 128 ASN 128 470 470 ASN ASN A . n A 1 129 ILE 129 471 471 ILE ILE A . n A 1 130 ILE 130 472 472 ILE ILE A . n A 1 131 GLU 131 473 473 GLU GLU A . n A 1 132 LEU 132 474 474 LEU LEU A . n A 1 133 VAL 133 475 475 VAL VAL A . n A 1 134 HIS 134 476 476 HIS HIS A . n A 1 135 GLN 135 477 477 GLN GLN A . n A 1 136 VAL 136 478 478 VAL VAL A . n A 1 137 SER 137 479 479 SER SER A . n A 1 138 MET 138 480 480 MET MET A . n A 1 139 GLY 139 481 481 GLY GLY A . n A 1 140 MET 140 482 482 MET MET A . n A 1 141 LYS 141 483 483 LYS LYS A . n A 1 142 TYR 142 484 484 TYR TYR A . n A 1 143 LEU 143 485 485 LEU LEU A . n A 1 144 GLU 144 486 486 GLU GLU A . n A 1 145 GLU 145 487 487 GLU GLU A . n A 1 146 SER 146 488 488 SER SER A . n A 1 147 ASN 147 489 489 ASN ASN A . n A 1 148 PHE 148 490 490 PHE PHE A . n A 1 149 VAL 149 491 491 VAL VAL A . n A 1 150 HIS 150 492 492 HIS HIS A . n A 1 151 ARG 151 493 493 ARG ARG A . n A 1 152 ASP 152 494 494 ASP ASP A . n A 1 153 LEU 153 495 495 LEU LEU A . n A 1 154 ALA 154 496 496 ALA ALA A . n A 1 155 ALA 155 497 497 ALA ALA A . n A 1 156 ARG 156 498 498 ARG ARG A . n A 1 157 ASN 157 499 499 ASN ASN A . n A 1 158 VAL 158 500 500 VAL VAL A . n A 1 159 LEU 159 501 501 LEU LEU A . n A 1 160 LEU 160 502 502 LEU LEU A . n A 1 161 VAL 161 503 503 VAL VAL A . n A 1 162 THR 162 504 504 THR THR A . n A 1 163 GLN 163 505 505 GLN GLN A . n A 1 164 HIS 164 506 506 HIS HIS A . n A 1 165 TYR 165 507 507 TYR TYR A . n A 1 166 ALA 166 508 508 ALA ALA A . n A 1 167 LYS 167 509 509 LYS LYS A . n A 1 168 ILE 168 510 510 ILE ILE A . n A 1 169 SER 169 511 511 SER SER A . n A 1 170 ASP 170 512 512 ASP ASP A . n A 1 171 PHE 171 513 513 PHE PHE A . n A 1 172 GLY 172 514 514 GLY GLY A . n A 1 173 LEU 173 515 515 LEU LEU A . n A 1 174 SER 174 516 516 SER SER A . n A 1 175 LYS 175 517 517 LYS LYS A . n A 1 176 ALA 176 518 518 ALA ALA A . n A 1 177 LEU 177 519 519 LEU LEU A . n A 1 178 ARG 178 520 520 ARG ARG A . n A 1 179 ALA 179 521 521 ALA ALA A . n A 1 180 ASP 180 522 522 ASP ASP A . n A 1 181 GLU 181 523 523 GLU GLU A . n A 1 182 ASN 182 524 524 ASN ASN A . n A 1 183 TYR 183 525 525 TYR TYR A . n A 1 184 TYR 184 526 526 TYR TYR A . n A 1 185 LYS 185 527 527 LYS LYS A . n A 1 186 ALA 186 528 528 ALA ALA A . n A 1 187 GLN 187 529 529 GLN GLN A . n A 1 188 THR 188 530 530 THR THR A . n A 1 189 HIS 189 531 531 HIS HIS A . n A 1 190 GLY 190 532 532 GLY GLY A . n A 1 191 LYS 191 533 533 LYS LYS A . n A 1 192 TRP 192 534 534 TRP TRP A . n A 1 193 PRO 193 535 535 PRO PRO A . n A 1 194 VAL 194 536 536 VAL VAL A . n A 1 195 LYS 195 537 537 LYS LYS A . n A 1 196 TRP 196 538 538 TRP TRP A . n A 1 197 TYR 197 539 539 TYR TYR A . n A 1 198 ALA 198 540 540 ALA ALA A . n A 1 199 PRO 199 541 541 PRO PRO A . n A 1 200 GLU 200 542 542 GLU GLU A . n A 1 201 CYS 201 543 543 CYS CYS A . n A 1 202 ILE 202 544 544 ILE ILE A . n A 1 203 ASN 203 545 545 ASN ASN A . n A 1 204 TYR 204 546 546 TYR TYR A . n A 1 205 TYR 205 547 547 TYR TYR A . n A 1 206 LYS 206 548 548 LYS LYS A . n A 1 207 PHE 207 549 549 PHE PHE A . n A 1 208 SER 208 550 550 SER SER A . n A 1 209 SER 209 551 551 SER SER A . n A 1 210 LYS 210 552 552 LYS LYS A . n A 1 211 SER 211 553 553 SER SER A . n A 1 212 ASP 212 554 554 ASP ASP A . n A 1 213 VAL 213 555 555 VAL VAL A . n A 1 214 TRP 214 556 556 TRP TRP A . n A 1 215 SER 215 557 557 SER SER A . n A 1 216 PHE 216 558 558 PHE PHE A . n A 1 217 GLY 217 559 559 GLY GLY A . n A 1 218 VAL 218 560 560 VAL VAL A . n A 1 219 LEU 219 561 561 LEU LEU A . n A 1 220 MET 220 562 562 MET MET A . n A 1 221 TRP 221 563 563 TRP TRP A . n A 1 222 GLU 222 564 564 GLU GLU A . n A 1 223 ALA 223 565 565 ALA ALA A . n A 1 224 PHE 224 566 566 PHE PHE A . n A 1 225 SER 225 567 567 SER SER A . n A 1 226 TYR 226 568 568 TYR TYR A . n A 1 227 GLY 227 569 569 GLY GLY A . n A 1 228 GLN 228 570 570 GLN GLN A . n A 1 229 LYS 229 571 571 LYS LYS A . n A 1 230 PRO 230 572 572 PRO PRO A . n A 1 231 TYR 231 573 573 TYR TYR A . n A 1 232 ARG 232 574 574 ARG ARG A . n A 1 233 GLY 233 575 575 GLY GLY A . n A 1 234 MET 234 576 576 MET MET A . n A 1 235 LYS 235 577 577 LYS LYS A . n A 1 236 GLY 236 578 578 GLY GLY A . n A 1 237 SER 237 579 579 SER SER A . n A 1 238 GLU 238 580 580 GLU GLU A . n A 1 239 VAL 239 581 581 VAL VAL A . n A 1 240 THR 240 582 582 THR THR A . n A 1 241 ALA 241 583 583 ALA ALA A . n A 1 242 MET 242 584 584 MET MET A . n A 1 243 LEU 243 585 585 LEU LEU A . n A 1 244 GLU 244 586 586 GLU GLU A . n A 1 245 LYS 245 587 587 LYS LYS A . n A 1 246 GLY 246 588 588 GLY GLY A . n A 1 247 GLU 247 589 589 GLU GLU A . n A 1 248 ARG 248 590 590 ARG ARG A . n A 1 249 MET 249 591 591 MET MET A . n A 1 250 GLY 250 592 592 GLY GLY A . n A 1 251 CYS 251 593 593 CYS CYS A . n A 1 252 PRO 252 594 594 PRO PRO A . n A 1 253 ALA 253 595 595 ALA ALA A . n A 1 254 GLY 254 596 596 GLY GLY A . n A 1 255 CYS 255 597 597 CYS CYS A . n A 1 256 PRO 256 598 598 PRO PRO A . n A 1 257 ARG 257 599 599 ARG ARG A . n A 1 258 GLU 258 600 600 GLU GLU A . n A 1 259 MET 259 601 601 MET MET A . n A 1 260 TYR 260 602 602 TYR TYR A . n A 1 261 ASP 261 603 603 ASP ASP A . n A 1 262 LEU 262 604 604 LEU LEU A . n A 1 263 MET 263 605 605 MET MET A . n A 1 264 ASN 264 606 606 ASN ASN A . n A 1 265 LEU 265 607 607 LEU LEU A . n A 1 266 CYS 266 608 608 CYS CYS A . n A 1 267 TRP 267 609 609 TRP TRP A . n A 1 268 THR 268 610 610 THR THR A . n A 1 269 TYR 269 611 611 TYR TYR A . n A 1 270 ASP 270 612 612 ASP ASP A . n A 1 271 VAL 271 613 613 VAL VAL A . n A 1 272 GLU 272 614 614 GLU GLU A . n A 1 273 ASN 273 615 615 ASN ASN A . n A 1 274 ARG 274 616 616 ARG ARG A . n A 1 275 PRO 275 617 617 PRO PRO A . n A 1 276 GLY 276 618 618 GLY GLY A . n A 1 277 PHE 277 619 619 PHE PHE A . n A 1 278 ALA 278 620 620 ALA ALA A . n A 1 279 ALA 279 621 621 ALA ALA A . n A 1 280 VAL 280 622 622 VAL VAL A . n A 1 281 GLU 281 623 623 GLU GLU A . n A 1 282 LEU 282 624 624 LEU LEU A . n A 1 283 ARG 283 625 625 ARG ARG A . n A 1 284 LEU 284 626 626 LEU LEU A . n A 1 285 ARG 285 627 627 ARG ARG A . n A 1 286 ASN 286 628 628 ASN ASN A . n A 1 287 TYR 287 629 629 TYR TYR A . n A 1 288 TYR 288 630 630 TYR TYR A . n A 1 289 TYR 289 631 631 TYR TYR A . n A 1 290 ASP 290 632 632 ASP ASP A . n A 1 291 VAL 291 633 633 VAL VAL A . n A 1 292 VAL 292 634 634 VAL VAL A . n A 1 293 ASN 293 635 635 ASN ASN A . n A 1 294 HIS 294 636 ? ? ? A . n A 1 295 HIS 295 637 ? ? ? A . n A 1 296 HIS 296 638 ? ? ? A . n A 1 297 HIS 297 639 ? ? ? A . n A 1 298 HIS 298 640 ? ? ? A . n A 1 299 HIS 299 641 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 477 1 701 1 477 027 A . C 3 HOH 1 801 1 HOH HOH A . C 3 HOH 2 802 2 HOH HOH A . C 3 HOH 3 803 3 HOH HOH A . C 3 HOH 4 804 4 HOH HOH A . C 3 HOH 5 805 5 HOH HOH A . C 3 HOH 6 806 6 HOH HOH A . C 3 HOH 7 807 7 HOH HOH A . C 3 HOH 8 808 8 HOH HOH A . C 3 HOH 9 809 9 HOH HOH A . C 3 HOH 10 810 10 HOH HOH A . C 3 HOH 11 811 12 HOH HOH A . C 3 HOH 12 812 13 HOH HOH A . C 3 HOH 13 813 14 HOH HOH A . C 3 HOH 14 814 15 HOH HOH A . C 3 HOH 15 815 16 HOH HOH A . C 3 HOH 16 816 17 HOH HOH A . C 3 HOH 17 817 18 HOH HOH A . C 3 HOH 18 818 19 HOH HOH A . C 3 HOH 19 819 20 HOH HOH A . C 3 HOH 20 820 21 HOH HOH A . C 3 HOH 21 821 22 HOH HOH A . C 3 HOH 22 822 23 HOH HOH A . C 3 HOH 23 823 24 HOH HOH A . C 3 HOH 24 824 25 HOH HOH A . C 3 HOH 25 825 26 HOH HOH A . C 3 HOH 26 826 27 HOH HOH A . C 3 HOH 27 827 28 HOH HOH A . C 3 HOH 28 828 29 HOH HOH A . C 3 HOH 29 829 30 HOH HOH A . C 3 HOH 30 830 31 HOH HOH A . C 3 HOH 31 831 32 HOH HOH A . C 3 HOH 32 832 33 HOH HOH A . C 3 HOH 33 833 34 HOH HOH A . C 3 HOH 34 834 35 HOH HOH A . C 3 HOH 35 835 37 HOH HOH A . C 3 HOH 36 836 38 HOH HOH A . C 3 HOH 37 837 39 HOH HOH A . C 3 HOH 38 838 40 HOH HOH A . C 3 HOH 39 839 41 HOH HOH A . C 3 HOH 40 840 42 HOH HOH A . C 3 HOH 41 841 43 HOH HOH A . C 3 HOH 42 842 44 HOH HOH A . C 3 HOH 43 843 45 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-05-02 2 'Structure model' 1 1 2017-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALEPACK . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 PHASER . ? program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 3 BUSTER-TNT 'BUSTER 2.9.1' ? program 'Gerard Bricogne' buster-develop@GlobalPhasing.com refinement http://www.globalphasing.com/buster/ ? ? 4 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 CrystalClear . ? ? ? ? 'data collection' ? ? ? 6 DENZO . ? ? ? ? 'data reduction' ? ? ? 7 BUSTER 2.9.1 ? ? ? ? refinement ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 441 ? ? -144.42 -109.21 2 1 ASP A 494 ? ? -154.38 37.06 3 1 ASP A 512 ? ? 57.37 81.54 4 1 LYS A 533 ? ? -64.57 94.78 5 1 TRP A 609 ? ? -88.35 31.36 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 368 ? CG ? A LYS 26 CG 2 1 Y 1 A LYS 368 ? CD ? A LYS 26 CD 3 1 Y 1 A LYS 368 ? CE ? A LYS 26 CE 4 1 Y 1 A LYS 368 ? NZ ? A LYS 26 NZ 5 1 Y 1 A GLU 373 ? CG ? A GLU 31 CG 6 1 Y 1 A GLU 373 ? CD ? A GLU 31 CD 7 1 Y 1 A GLU 373 ? OE1 ? A GLU 31 OE1 8 1 Y 1 A GLU 373 ? OE2 ? A GLU 31 OE2 9 1 Y 1 A ASP 374 ? CG ? A ASP 32 CG 10 1 Y 1 A ASP 374 ? OD1 ? A ASP 32 OD1 11 1 Y 1 A ASP 374 ? OD2 ? A ASP 32 OD2 12 1 Y 1 A LYS 375 ? CG ? A LYS 33 CG 13 1 Y 1 A LYS 375 ? CD ? A LYS 33 CD 14 1 Y 1 A LYS 375 ? CE ? A LYS 33 CE 15 1 Y 1 A LYS 375 ? NZ ? A LYS 33 NZ 16 1 Y 1 A GLU 376 ? CG ? A GLU 34 CG 17 1 Y 1 A GLU 376 ? CD ? A GLU 34 CD 18 1 Y 1 A GLU 376 ? OE1 ? A GLU 34 OE1 19 1 Y 1 A GLU 376 ? OE2 ? A GLU 34 OE2 20 1 Y 1 A SER 379 ? OG ? A SER 37 OG 21 1 Y 1 A ASN 381 ? CG ? A ASN 39 CG 22 1 Y 1 A ASN 381 ? OD1 ? A ASN 39 OD1 23 1 Y 1 A ASN 381 ? ND2 ? A ASN 39 ND2 24 1 Y 1 A THR 384 ? OG1 ? A THR 42 OG1 25 1 Y 1 A THR 384 ? CG2 ? A THR 42 CG2 26 1 Y 1 A LYS 386 ? CG ? A LYS 44 CG 27 1 Y 1 A LYS 386 ? CD ? A LYS 44 CD 28 1 Y 1 A LYS 386 ? CE ? A LYS 44 CE 29 1 Y 1 A LYS 386 ? NZ ? A LYS 44 NZ 30 1 Y 1 A TYR 389 ? O ? A TYR 47 O 31 1 Y 1 A GLN 391 ? CG ? A GLN 49 CG 32 1 Y 1 A GLN 391 ? CD ? A GLN 49 CD 33 1 Y 1 A GLN 391 ? OE1 ? A GLN 49 OE1 34 1 Y 1 A GLN 391 ? NE2 ? A GLN 49 NE2 35 1 Y 1 A LYS 393 ? CG ? A LYS 51 CG 36 1 Y 1 A LYS 393 ? CD ? A LYS 51 CD 37 1 Y 1 A LYS 393 ? CE ? A LYS 51 CE 38 1 Y 1 A LYS 393 ? NZ ? A LYS 51 NZ 39 1 Y 1 A VAL 395 ? CG1 ? A VAL 53 CG1 40 1 Y 1 A VAL 395 ? CG2 ? A VAL 53 CG2 41 1 Y 1 A LYS 402 ? CE ? A LYS 60 CE 42 1 Y 1 A LYS 402 ? NZ ? A LYS 60 NZ 43 1 Y 1 A LEU 404 ? CD1 ? A LEU 62 CD1 44 1 Y 1 A LEU 404 ? CD2 ? A LEU 62 CD2 45 1 Y 1 A LYS 414 ? CG ? A LYS 72 CG 46 1 Y 1 A LYS 414 ? CD ? A LYS 72 CD 47 1 Y 1 A LYS 414 ? CE ? A LYS 72 CE 48 1 Y 1 A LYS 414 ? NZ ? A LYS 72 NZ 49 1 Y 1 A ASP 415 ? CG ? A ASP 73 CG 50 1 Y 1 A ASP 415 ? OD1 ? A ASP 73 OD1 51 1 Y 1 A ASP 415 ? OD2 ? A ASP 73 OD2 52 1 Y 1 A GLU 416 ? OE1 ? A GLU 74 OE1 53 1 Y 1 A GLU 416 ? OE2 ? A GLU 74 OE2 54 1 Y 1 A GLN 425 ? CG ? A GLN 83 CG 55 1 Y 1 A GLN 425 ? CD ? A GLN 83 CD 56 1 Y 1 A GLN 425 ? OE1 ? A GLN 83 OE1 57 1 Y 1 A GLN 425 ? NE2 ? A GLN 83 NE2 58 1 Y 1 A ARG 434 ? NE ? A ARG 92 NE 59 1 Y 1 A ARG 434 ? CZ ? A ARG 92 CZ 60 1 Y 1 A ARG 434 ? NH1 ? A ARG 92 NH1 61 1 Y 1 A ARG 434 ? NH2 ? A ARG 92 NH2 62 1 Y 1 A GLU 440 ? CG ? A GLU 98 CG 63 1 Y 1 A GLU 440 ? CD ? A GLU 98 CD 64 1 Y 1 A GLU 440 ? OE1 ? A GLU 98 OE1 65 1 Y 1 A GLU 440 ? OE2 ? A GLU 98 OE2 66 1 Y 1 A GLU 442 ? CG ? A GLU 100 CG 67 1 Y 1 A GLU 442 ? CD ? A GLU 100 CD 68 1 Y 1 A GLU 442 ? OE1 ? A GLU 100 OE1 69 1 Y 1 A GLU 442 ? OE2 ? A GLU 100 OE2 70 1 Y 1 A HIS 465 ? CG ? A HIS 123 CG 71 1 Y 1 A HIS 465 ? ND1 ? A HIS 123 ND1 72 1 Y 1 A HIS 465 ? CD2 ? A HIS 123 CD2 73 1 Y 1 A HIS 465 ? CE1 ? A HIS 123 CE1 74 1 Y 1 A HIS 465 ? NE2 ? A HIS 123 NE2 75 1 Y 1 A LYS 467 ? CD ? A LYS 125 CD 76 1 Y 1 A LYS 467 ? CE ? A LYS 125 CE 77 1 Y 1 A LYS 467 ? NZ ? A LYS 125 NZ 78 1 Y 1 A LYS 469 ? NZ ? A LYS 127 NZ 79 1 Y 1 A GLU 523 ? CG ? A GLU 181 CG 80 1 Y 1 A GLU 523 ? CD ? A GLU 181 CD 81 1 Y 1 A GLU 523 ? OE1 ? A GLU 181 OE1 82 1 Y 1 A GLU 523 ? OE2 ? A GLU 181 OE2 83 1 Y 1 A ASN 524 ? CG ? A ASN 182 CG 84 1 Y 1 A ASN 524 ? OD1 ? A ASN 182 OD1 85 1 Y 1 A ASN 524 ? ND2 ? A ASN 182 ND2 86 1 Y 1 A LYS 527 ? NZ ? A LYS 185 NZ 87 1 Y 1 A GLN 529 ? CG ? A GLN 187 CG 88 1 Y 1 A GLN 529 ? CD ? A GLN 187 CD 89 1 Y 1 A GLN 529 ? OE1 ? A GLN 187 OE1 90 1 Y 1 A GLN 529 ? NE2 ? A GLN 187 NE2 91 1 Y 1 A HIS 531 ? CG ? A HIS 189 CG 92 1 Y 1 A HIS 531 ? ND1 ? A HIS 189 ND1 93 1 Y 1 A HIS 531 ? CD2 ? A HIS 189 CD2 94 1 Y 1 A HIS 531 ? CE1 ? A HIS 189 CE1 95 1 Y 1 A HIS 531 ? NE2 ? A HIS 189 NE2 96 1 Y 1 A LYS 533 ? CG ? A LYS 191 CG 97 1 Y 1 A LYS 533 ? CD ? A LYS 191 CD 98 1 Y 1 A LYS 533 ? CE ? A LYS 191 CE 99 1 Y 1 A LYS 533 ? NZ ? A LYS 191 NZ 100 1 Y 1 A LYS 548 ? NZ ? A LYS 206 NZ 101 1 Y 1 A GLN 570 ? CG ? A GLN 228 CG 102 1 Y 1 A GLN 570 ? CD ? A GLN 228 CD 103 1 Y 1 A GLN 570 ? OE1 ? A GLN 228 OE1 104 1 Y 1 A GLN 570 ? NE2 ? A GLN 228 NE2 105 1 Y 1 A LYS 571 ? CD ? A LYS 229 CD 106 1 Y 1 A LYS 571 ? CE ? A LYS 229 CE 107 1 Y 1 A LYS 571 ? NZ ? A LYS 229 NZ 108 1 Y 1 A LYS 577 ? CG ? A LYS 235 CG 109 1 Y 1 A LYS 577 ? CD ? A LYS 235 CD 110 1 Y 1 A LYS 577 ? CE ? A LYS 235 CE 111 1 Y 1 A LYS 577 ? NZ ? A LYS 235 NZ 112 1 Y 1 A ARG 599 ? CG ? A ARG 257 CG 113 1 Y 1 A ARG 599 ? CD ? A ARG 257 CD 114 1 Y 1 A ARG 599 ? NE ? A ARG 257 NE 115 1 Y 1 A ARG 599 ? CZ ? A ARG 257 CZ 116 1 Y 1 A ARG 599 ? NH1 ? A ARG 257 NH1 117 1 Y 1 A ARG 599 ? NH2 ? A ARG 257 NH2 118 1 Y 1 A GLU 614 ? OE1 ? A GLU 272 OE1 119 1 Y 1 A GLU 614 ? OE2 ? A GLU 272 OE2 120 1 Y 1 A ARG 625 ? CG ? A ARG 283 CG 121 1 Y 1 A ARG 625 ? CD ? A ARG 283 CD 122 1 Y 1 A ARG 625 ? NE ? A ARG 283 NE 123 1 Y 1 A ARG 625 ? CZ ? A ARG 283 CZ 124 1 Y 1 A ARG 625 ? NH1 ? A ARG 283 NH1 125 1 Y 1 A ARG 625 ? NH2 ? A ARG 283 NH2 126 1 Y 1 A ASN 635 ? CG ? A ASN 293 CG 127 1 Y 1 A ASN 635 ? OD1 ? A ASN 293 OD1 128 1 Y 1 A ASN 635 ? ND2 ? A ASN 293 ND2 129 1 N 1 A 477 701 ? CAU ? B 477 1 CAU 130 1 N 1 A 477 701 ? CAX ? B 477 1 CAX 131 1 N 1 A 477 701 ? CAV ? B 477 1 CAV 132 1 N 1 A 477 701 ? FAZ ? B 477 1 FAZ 133 1 N 1 A 477 701 ? FAY ? B 477 1 FAY # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 343 ? A MET 1 2 1 Y 1 A ASP 344 ? A ASP 2 3 1 Y 1 A THR 345 ? A THR 3 4 1 Y 1 A GLU 346 ? A GLU 4 5 1 Y 1 A VAL 347 ? A VAL 5 6 1 Y 1 A TYR 348 ? A TYR 6 7 1 Y 1 A GLU 349 ? A GLU 7 8 1 Y 1 A SER 350 ? A SER 8 9 1 Y 1 A PRO 351 ? A PRO 9 10 1 Y 1 A TYR 352 ? A TYR 10 11 1 Y 1 A ALA 353 ? A ALA 11 12 1 Y 1 A ASP 354 ? A ASP 12 13 1 Y 1 A PRO 355 ? A PRO 13 14 1 Y 1 A GLU 356 ? A GLU 14 15 1 Y 1 A GLU 357 ? A GLU 15 16 1 Y 1 A ILE 358 ? A ILE 16 17 1 Y 1 A ARG 359 ? A ARG 17 18 1 Y 1 A PRO 360 ? A PRO 18 19 1 Y 1 A LYS 361 ? A LYS 19 20 1 Y 1 A GLU 362 ? A GLU 20 21 1 Y 1 A VAL 363 ? A VAL 21 22 1 Y 1 A LYS 394 ? A LYS 52 23 1 Y 1 A LYS 405 ? A LYS 63 24 1 Y 1 A ASN 406 ? A ASN 64 25 1 Y 1 A GLU 407 ? A GLU 65 26 1 Y 1 A ALA 408 ? A ALA 66 27 1 Y 1 A ASN 409 ? A ASN 67 28 1 Y 1 A ASP 410 ? A ASP 68 29 1 Y 1 A HIS 636 ? A HIS 294 30 1 Y 1 A HIS 637 ? A HIS 295 31 1 Y 1 A HIS 638 ? A HIS 296 32 1 Y 1 A HIS 639 ? A HIS 297 33 1 Y 1 A HIS 640 ? A HIS 298 34 1 Y 1 A HIS 641 ? A HIS 299 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-{2-[5-(difluoromethyl)-2H-thieno[3,2-c]pyrazol-3-yl]-1H-indol-6-yl}pentan-3-ol' 477 3 water HOH #