data_3VSB # _entry.id 3VSB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3VSB pdb_00003vsb 10.2210/pdb3vsb/pdb WWPDB D_1000179186 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3VSB _pdbx_database_status.recvd_initial_deposition_date 1997-09-25 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Stoll, V.S.' 1 'Eger, B.T.' 2 'Hynes, R.C.' 3 'Martichonok, V.' 4 'Jones, J.B.' 5 'Pai, E.F.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Differences in binding modes of enantiomers of 1-acetamido boronic acid based protease inhibitors: crystal structures of gamma-chymotrypsin and subtilisin Carlsberg complexes. ; Biochemistry 37 451 462 1998 BICHAW US 0006-2960 0033 ? 9425066 10.1021/bi971166o 1 ;Probing the Specificity of the Serine Proteases Subtilisin Carlsberg and A-Chymotrypsin with Enantiomeric 1-Acetamido Boronic Acids. An Unexpected Reversal of the Normal "L"-Stereoselectivity Preference ; J.Am.Chem.Soc. 118 950 ? 1996 JACSAT US 0002-7863 0004 ? ? ? 2 'Probing the Specificity of the S1 Binding Site of Subtilisin Carlsberg with Boronic Acids' Bioorg.Med.Chem. 2 35 ? 1994 BMECEP UK 0968-0896 1200 ? ? ? 3 'Enzyme Crystal Structure in a Neat Organic Solvent' Proc.Natl.Acad.Sci.USA 90 8653 ? 1993 PNASA6 US 0027-8424 0040 ? ? ? 4 'The Structure of Subtilopeptidase A. I. X-Ray Crystallographic Data' J.Mol.Biol. 106 453 ? 1976 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stoll, V.S.' 1 ? primary 'Eger, B.T.' 2 ? primary 'Hynes, R.C.' 3 ? primary 'Martichonok, V.' 4 ? primary 'Jones, J.B.' 5 ? primary 'Pai, E.F.' 6 ? 1 'Martichonok, V.' 7 ? 1 'Jones, J.B.' 8 ? 2 'Seufer-Wasserthal, P.' 9 ? 2 'Martichonok, V.' 10 ? 2 'Keller, T.H.' 11 ? 2 'Chin, B.' 12 ? 2 'Martin, R.' 13 ? 2 'Jones, J.B.' 14 ? 3 'Fitzpatrick, P.A.' 15 ? 3 'Steinmetz, A.C.' 16 ? 3 'Ringe, D.' 17 ? 3 'Klibanov, A.M.' 18 ? 4 'Petsko, G.A.' 19 ? 4 'Tsernoglou, D.' 20 ? # _cell.entry_id 3VSB _cell.length_a 53.000 _cell.length_b 55.400 _cell.length_c 76.600 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3VSB _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'SUBTILISIN CARLSBERG, TYPE VIII' 27562.283 1 3.4.21.62 ? 'FULL PROTEIN' ? 2 non-polymer syn 'SODIUM ION' 22.990 2 ? ? ? ? 3 water nat water 18.015 22 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SUBTILOPEPTIDASE A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGV LGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNSGS TNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGT(SBD)MASPHVAGAAALILSK HPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ ; _entity_poly.pdbx_seq_one_letter_code_can ;AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGV LGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNSGS TNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTXMASPHVAGAAALILSKHPNL SASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 THR n 1 4 VAL n 1 5 PRO n 1 6 TYR n 1 7 GLY n 1 8 ILE n 1 9 PRO n 1 10 LEU n 1 11 ILE n 1 12 LYS n 1 13 ALA n 1 14 ASP n 1 15 LYS n 1 16 VAL n 1 17 GLN n 1 18 ALA n 1 19 GLN n 1 20 GLY n 1 21 PHE n 1 22 LYS n 1 23 GLY n 1 24 ALA n 1 25 ASN n 1 26 VAL n 1 27 LYS n 1 28 VAL n 1 29 ALA n 1 30 VAL n 1 31 LEU n 1 32 ASP n 1 33 THR n 1 34 GLY n 1 35 ILE n 1 36 GLN n 1 37 ALA n 1 38 SER n 1 39 HIS n 1 40 PRO n 1 41 ASP n 1 42 LEU n 1 43 ASN n 1 44 VAL n 1 45 VAL n 1 46 GLY n 1 47 GLY n 1 48 ALA n 1 49 SER n 1 50 PHE n 1 51 VAL n 1 52 ALA n 1 53 GLY n 1 54 GLU n 1 55 ALA n 1 56 TYR n 1 57 ASN n 1 58 THR n 1 59 ASP n 1 60 GLY n 1 61 ASN n 1 62 GLY n 1 63 HIS n 1 64 GLY n 1 65 THR n 1 66 HIS n 1 67 VAL n 1 68 ALA n 1 69 GLY n 1 70 THR n 1 71 VAL n 1 72 ALA n 1 73 ALA n 1 74 LEU n 1 75 ASP n 1 76 ASN n 1 77 THR n 1 78 THR n 1 79 GLY n 1 80 VAL n 1 81 LEU n 1 82 GLY n 1 83 VAL n 1 84 ALA n 1 85 PRO n 1 86 SER n 1 87 VAL n 1 88 SER n 1 89 LEU n 1 90 TYR n 1 91 ALA n 1 92 VAL n 1 93 LYS n 1 94 VAL n 1 95 LEU n 1 96 ASN n 1 97 SER n 1 98 SER n 1 99 GLY n 1 100 SER n 1 101 GLY n 1 102 SER n 1 103 TYR n 1 104 SER n 1 105 GLY n 1 106 ILE n 1 107 VAL n 1 108 SER n 1 109 GLY n 1 110 ILE n 1 111 GLU n 1 112 TRP n 1 113 ALA n 1 114 THR n 1 115 THR n 1 116 ASN n 1 117 GLY n 1 118 MET n 1 119 ASP n 1 120 VAL n 1 121 ILE n 1 122 ASN n 1 123 MET n 1 124 SER n 1 125 LEU n 1 126 GLY n 1 127 GLY n 1 128 ALA n 1 129 SER n 1 130 GLY n 1 131 SER n 1 132 THR n 1 133 ALA n 1 134 MET n 1 135 LYS n 1 136 GLN n 1 137 ALA n 1 138 VAL n 1 139 ASP n 1 140 ASN n 1 141 ALA n 1 142 TYR n 1 143 ALA n 1 144 ARG n 1 145 GLY n 1 146 VAL n 1 147 VAL n 1 148 VAL n 1 149 VAL n 1 150 ALA n 1 151 ALA n 1 152 ALA n 1 153 GLY n 1 154 ASN n 1 155 SER n 1 156 GLY n 1 157 ASN n 1 158 SER n 1 159 GLY n 1 160 SER n 1 161 THR n 1 162 ASN n 1 163 THR n 1 164 ILE n 1 165 GLY n 1 166 TYR n 1 167 PRO n 1 168 ALA n 1 169 LYS n 1 170 TYR n 1 171 ASP n 1 172 SER n 1 173 VAL n 1 174 ILE n 1 175 ALA n 1 176 VAL n 1 177 GLY n 1 178 ALA n 1 179 VAL n 1 180 ASP n 1 181 SER n 1 182 ASN n 1 183 SER n 1 184 ASN n 1 185 ARG n 1 186 ALA n 1 187 SER n 1 188 PHE n 1 189 SER n 1 190 SER n 1 191 VAL n 1 192 GLY n 1 193 ALA n 1 194 GLU n 1 195 LEU n 1 196 GLU n 1 197 VAL n 1 198 MET n 1 199 ALA n 1 200 PRO n 1 201 GLY n 1 202 ALA n 1 203 GLY n 1 204 VAL n 1 205 TYR n 1 206 SER n 1 207 THR n 1 208 TYR n 1 209 PRO n 1 210 THR n 1 211 ASN n 1 212 THR n 1 213 TYR n 1 214 ALA n 1 215 THR n 1 216 LEU n 1 217 ASN n 1 218 GLY n 1 219 THR n 1 220 SBD n 1 221 MET n 1 222 ALA n 1 223 SER n 1 224 PRO n 1 225 HIS n 1 226 VAL n 1 227 ALA n 1 228 GLY n 1 229 ALA n 1 230 ALA n 1 231 ALA n 1 232 LEU n 1 233 ILE n 1 234 LEU n 1 235 SER n 1 236 LYS n 1 237 HIS n 1 238 PRO n 1 239 ASN n 1 240 LEU n 1 241 SER n 1 242 ALA n 1 243 SER n 1 244 GLN n 1 245 VAL n 1 246 ARG n 1 247 ASN n 1 248 ARG n 1 249 LEU n 1 250 SER n 1 251 SER n 1 252 THR n 1 253 ALA n 1 254 THR n 1 255 TYR n 1 256 LEU n 1 257 GLY n 1 258 SER n 1 259 SER n 1 260 PHE n 1 261 TYR n 1 262 TYR n 1 263 GLY n 1 264 LYS n 1 265 GLY n 1 266 LEU n 1 267 ILE n 1 268 ASN n 1 269 VAL n 1 270 GLU n 1 271 ALA n 1 272 ALA n 1 273 ALA n 1 274 GLN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Bacillus licheniformis' _entity_src_nat.pdbx_ncbi_taxonomy_id 1402 _entity_src_nat.genus Bacillus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details 'PURCHASED FROM SIGMA' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SUBT_BACLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00780 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MMRKKSFWLGMLTAFMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVKTASVKKDIIKESGGKVDKQFRIINAAKAKLD KEALKEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEA YNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMK QAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYAT LNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3VSB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 274 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00780 _struct_ref_seq.db_align_beg 106 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 379 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 275 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3VSB SER A 102 ? UNP P00780 THR 207 conflict 103 1 1 3VSB ALA A 128 ? UNP P00780 PRO 233 conflict 129 2 1 3VSB ASN A 157 ? UNP P00780 SER 262 conflict 158 3 1 3VSB SER A 160 ? UNP P00780 ASN 265 conflict 161 4 1 3VSB ASN A 211 ? UNP P00780 SER 316 conflict 212 5 1 3VSB SBD A 220 ? UNP P00780 SER 325 'modified residue' 221 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SBD 'D-peptide linking' . 'D-NAPHTHYL-1-ACETAMIDO BORONIC ACID ALANINE' ? 'C17 H22 B N2 O6 -1' 361.177 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3VSB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.2 _exptl_crystal.density_percent_sol 41.5 _exptl_crystal.description 'STARTING MODEL WAS RE-INDEXED TO CONFORM TO AXIS LABELING CONVENTION A