data_3WF5 # _entry.id 3WF5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3WF5 RCSB RCSB096257 WWPDB D_1000096257 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3WE4 . unspecified PDB 3WF6 . unspecified PDB 3WF7 . unspecified PDB 3WF8 . unspecified PDB 3WF9 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3WF5 _pdbx_database_status.recvd_initial_deposition_date 2013-07-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Niwa, H.' 1 'Shirouzu, M.' 2 'Yokoyama, S.' 3 # _citation.id primary _citation.title 'Crystal structures of the S6K1 kinase domain in complexes with inhibitors' _citation.journal_abbrev J.Struct.Funct.Genom. _citation.journal_volume 15 _citation.page_first 153 _citation.page_last 164 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country NE _citation.journal_id_ISSN 1345-711X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25078151 _citation.pdbx_database_id_DOI 10.1007/s10969-014-9188-8 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Niwa, H.' 1 primary 'Mikuni, J.' 2 primary 'Sasaki, S.' 3 primary 'Tomabechi, Y.' 4 primary 'Honda, K.' 5 primary 'Ikeda, M.' 6 primary 'Ohsawa, N.' 7 primary 'Wakiyama, M.' 8 primary 'Handa, N.' 9 primary 'Shirouzu, M.' 10 primary 'Honma, T.' 11 primary 'Tanaka, A.' 12 primary 'Yokoyama, S.' 13 # _cell.entry_id 3WF5 _cell.length_a 69.217 _cell.length_b 69.217 _cell.length_c 143.181 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3WF5 _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ribosomal protein S6 kinase beta-1' 37178.816 1 2.7.11.1 ? 'UNP residues 78-399' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn '4-[4-(1H-benzimidazol-2-yl)piperidin-1-yl]-1H-pyrazolo[3,4-d]pyrimidine' 319.364 1 ? ? ? ? 4 water nat water 18.015 110 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;S6K-beta-1, S6K1, 70 kDa ribosomal protein S6 kinase 1, Ribosomal protein S6 kinase I, Serine/threonine-protein kinase 14A, p70 ribosomal S6 kinase alpha ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSFTSSGSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEV KHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQG HVKLTDFGLCKESIHDGTVTH(TPO)FCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKIL KCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKF TRQTPVDSPDDST ; _entity_poly.pdbx_seq_one_letter_code_can ;GSFTSSGSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEV KHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQG HVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKL NLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQT PVDSPDDST ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PHE n 1 4 THR n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 VAL n 1 10 ASN n 1 11 ARG n 1 12 GLY n 1 13 PRO n 1 14 GLU n 1 15 LYS n 1 16 ILE n 1 17 ARG n 1 18 PRO n 1 19 GLU n 1 20 CYS n 1 21 PHE n 1 22 GLU n 1 23 LEU n 1 24 LEU n 1 25 ARG n 1 26 VAL n 1 27 LEU n 1 28 GLY n 1 29 LYS n 1 30 GLY n 1 31 GLY n 1 32 TYR n 1 33 GLY n 1 34 LYS n 1 35 VAL n 1 36 PHE n 1 37 GLN n 1 38 VAL n 1 39 ARG n 1 40 LYS n 1 41 VAL n 1 42 THR n 1 43 GLY n 1 44 ALA n 1 45 ASN n 1 46 THR n 1 47 GLY n 1 48 LYS n 1 49 ILE n 1 50 PHE n 1 51 ALA n 1 52 MET n 1 53 LYS n 1 54 VAL n 1 55 LEU n 1 56 LYS n 1 57 LYS n 1 58 ALA n 1 59 MET n 1 60 ILE n 1 61 VAL n 1 62 ARG n 1 63 ASN n 1 64 ALA n 1 65 LYS n 1 66 ASP n 1 67 THR n 1 68 ALA n 1 69 HIS n 1 70 THR n 1 71 LYS n 1 72 ALA n 1 73 GLU n 1 74 ARG n 1 75 ASN n 1 76 ILE n 1 77 LEU n 1 78 GLU n 1 79 GLU n 1 80 VAL n 1 81 LYS n 1 82 HIS n 1 83 PRO n 1 84 PHE n 1 85 ILE n 1 86 VAL n 1 87 ASP n 1 88 LEU n 1 89 ILE n 1 90 TYR n 1 91 ALA n 1 92 PHE n 1 93 GLN n 1 94 THR n 1 95 GLY n 1 96 GLY n 1 97 LYS n 1 98 LEU n 1 99 TYR n 1 100 LEU n 1 101 ILE n 1 102 LEU n 1 103 GLU n 1 104 TYR n 1 105 LEU n 1 106 SER n 1 107 GLY n 1 108 GLY n 1 109 GLU n 1 110 LEU n 1 111 PHE n 1 112 MET n 1 113 GLN n 1 114 LEU n 1 115 GLU n 1 116 ARG n 1 117 GLU n 1 118 GLY n 1 119 ILE n 1 120 PHE n 1 121 MET n 1 122 GLU n 1 123 ASP n 1 124 THR n 1 125 ALA n 1 126 CYS n 1 127 PHE n 1 128 TYR n 1 129 LEU n 1 130 ALA n 1 131 GLU n 1 132 ILE n 1 133 SER n 1 134 MET n 1 135 ALA n 1 136 LEU n 1 137 GLY n 1 138 HIS n 1 139 LEU n 1 140 HIS n 1 141 GLN n 1 142 LYS n 1 143 GLY n 1 144 ILE n 1 145 ILE n 1 146 TYR n 1 147 ARG n 1 148 ASP n 1 149 LEU n 1 150 LYS n 1 151 PRO n 1 152 GLU n 1 153 ASN n 1 154 ILE n 1 155 MET n 1 156 LEU n 1 157 ASN n 1 158 HIS n 1 159 GLN n 1 160 GLY n 1 161 HIS n 1 162 VAL n 1 163 LYS n 1 164 LEU n 1 165 THR n 1 166 ASP n 1 167 PHE n 1 168 GLY n 1 169 LEU n 1 170 CYS n 1 171 LYS n 1 172 GLU n 1 173 SER n 1 174 ILE n 1 175 HIS n 1 176 ASP n 1 177 GLY n 1 178 THR n 1 179 VAL n 1 180 THR n 1 181 HIS n 1 182 TPO n 1 183 PHE n 1 184 CYS n 1 185 GLY n 1 186 THR n 1 187 ILE n 1 188 GLU n 1 189 TYR n 1 190 MET n 1 191 ALA n 1 192 PRO n 1 193 GLU n 1 194 ILE n 1 195 LEU n 1 196 MET n 1 197 ARG n 1 198 SER n 1 199 GLY n 1 200 HIS n 1 201 ASN n 1 202 ARG n 1 203 ALA n 1 204 VAL n 1 205 ASP n 1 206 TRP n 1 207 TRP n 1 208 SER n 1 209 LEU n 1 210 GLY n 1 211 ALA n 1 212 LEU n 1 213 MET n 1 214 TYR n 1 215 ASP n 1 216 MET n 1 217 LEU n 1 218 THR n 1 219 GLY n 1 220 ALA n 1 221 PRO n 1 222 PRO n 1 223 PHE n 1 224 THR n 1 225 GLY n 1 226 GLU n 1 227 ASN n 1 228 ARG n 1 229 LYS n 1 230 LYS n 1 231 THR n 1 232 ILE n 1 233 ASP n 1 234 LYS n 1 235 ILE n 1 236 LEU n 1 237 LYS n 1 238 CYS n 1 239 LYS n 1 240 LEU n 1 241 ASN n 1 242 LEU n 1 243 PRO n 1 244 PRO n 1 245 TYR n 1 246 LEU n 1 247 THR n 1 248 GLN n 1 249 GLU n 1 250 ALA n 1 251 ARG n 1 252 ASP n 1 253 LEU n 1 254 LEU n 1 255 LYS n 1 256 LYS n 1 257 LEU n 1 258 LEU n 1 259 LYS n 1 260 ARG n 1 261 ASN n 1 262 ALA n 1 263 ALA n 1 264 SER n 1 265 ARG n 1 266 LEU n 1 267 GLY n 1 268 ALA n 1 269 GLY n 1 270 PRO n 1 271 GLY n 1 272 ASP n 1 273 ALA n 1 274 GLY n 1 275 GLU n 1 276 VAL n 1 277 GLN n 1 278 ALA n 1 279 HIS n 1 280 PRO n 1 281 PHE n 1 282 PHE n 1 283 ARG n 1 284 HIS n 1 285 ILE n 1 286 ASN n 1 287 TRP n 1 288 GLU n 1 289 GLU n 1 290 LEU n 1 291 LEU n 1 292 ALA n 1 293 ARG n 1 294 LYS n 1 295 VAL n 1 296 GLU n 1 297 PRO n 1 298 PRO n 1 299 PHE n 1 300 LYS n 1 301 PRO n 1 302 LEU n 1 303 LEU n 1 304 GLN n 1 305 SER n 1 306 GLU n 1 307 GLU n 1 308 ASP n 1 309 VAL n 1 310 SER n 1 311 GLN n 1 312 PHE n 1 313 ASP n 1 314 SER n 1 315 LYS n 1 316 PHE n 1 317 THR n 1 318 ARG n 1 319 GLN n 1 320 THR n 1 321 PRO n 1 322 VAL n 1 323 ASP n 1 324 SER n 1 325 PRO n 1 326 ASP n 1 327 ASP n 1 328 SER n 1 329 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RPS6KB1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KS6B1_HUMAN _struct_ref.pdbx_db_accession P23443 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVD LIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDF GLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLT QEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDD ST ; _struct_ref.pdbx_align_begin 78 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3WF5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 329 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P23443 _struct_ref_seq.db_align_beg 78 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 399 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 78 _struct_ref_seq.pdbx_auth_seq_align_end 399 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3WF5 GLY A 1 ? UNP P23443 ? ? 'EXPRESSION TAG' 71 1 1 3WF5 SER A 2 ? UNP P23443 ? ? 'EXPRESSION TAG' 72 2 1 3WF5 PHE A 3 ? UNP P23443 ? ? 'EXPRESSION TAG' 73 3 1 3WF5 THR A 4 ? UNP P23443 ? ? 'EXPRESSION TAG' 74 4 1 3WF5 SER A 5 ? UNP P23443 ? ? 'EXPRESSION TAG' 75 5 1 3WF5 SER A 6 ? UNP P23443 ? ? 'EXPRESSION TAG' 76 6 1 3WF5 GLY A 7 ? UNP P23443 ? ? 'EXPRESSION TAG' 77 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FZ8 non-polymer . '4-[4-(1H-benzimidazol-2-yl)piperidin-1-yl]-1H-pyrazolo[3,4-d]pyrimidine' ? 'C17 H17 N7' 319.364 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 3WF5 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_percent_sol 46.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_details '0.1M Tris-HCl, 2.9-3.3M sodium formate, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RAYONIX MX225HE' _diffrn_detector.pdbx_collection_date 2011-04-25 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si double crystal monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL41XU' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL41XU _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.000 # _reflns.entry_id 3WF5 _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.0990 _reflns.number_obs 20923 _reflns.number_all 20923 _reflns.percent_possible_obs 98.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.08 _reflns.pdbx_netI_over_sigmaI 30.0 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 12.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.0990 _reflns_shell.d_res_low 2.14 _reflns_shell.percent_possible_all 98.2 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy 12.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 994 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3WF5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.0990 _refine.ls_d_res_low 40.4040 _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.3500 _refine.ls_number_reflns_obs 20901 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method ? _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1775 _refine.ls_R_factor_R_work 0.1748 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2330 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0500 _refine.ls_number_reflns_R_free 1946 _refine.ls_number_reflns_R_work 20901 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 49.7192 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2400 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 154.670 _refine.B_iso_min 21.330 _refine.pdbx_overall_phase_error 21.7500 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_TLS_residual_ADP_flag ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2211 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 110 _refine_hist.number_atoms_total 2346 _refine_hist.d_res_high 2.0990 _refine_hist.d_res_low 40.4040 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 2300 0.008 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 3101 1.054 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 330 0.045 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 392 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 876 16.465 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.redundancy_reflns_obs 2.0994 2.1519 14 99.0000 2582 . 0.2841 0.3168 . 143 . 2725 . 'X-RAY DIFFRACTION' . 2.1519 2.2101 14 99.0000 2615 . 0.2492 0.2678 . 125 . 2740 . 'X-RAY DIFFRACTION' . 2.2101 2.2751 14 99.0000 2598 . 0.2259 0.2554 . 144 . 2742 . 'X-RAY DIFFRACTION' . 2.2751 2.3486 14 99.0000 2570 . 0.2147 0.2714 . 151 . 2721 . 'X-RAY DIFFRACTION' . 2.3486 2.4325 14 99.0000 2590 . 0.1913 0.2373 . 158 . 2748 . 'X-RAY DIFFRACTION' . 2.4325 2.5299 14 99.0000 2612 . 0.1867 0.2090 . 143 . 2755 . 'X-RAY DIFFRACTION' . 2.5299 2.6450 14 99.0000 2632 . 0.1942 0.2638 . 157 . 2789 . 'X-RAY DIFFRACTION' . 2.6450 2.7844 14 99.0000 2602 . 0.1906 0.2572 . 133 . 2735 . 'X-RAY DIFFRACTION' . 2.7844 2.9588 14 99.0000 2610 . 0.1867 0.2480 . 154 . 2764 . 'X-RAY DIFFRACTION' . 2.9588 3.1872 14 100.0000 2635 . 0.1774 0.2770 . 130 . 2765 . 'X-RAY DIFFRACTION' . 3.1872 3.5078 14 100.0000 2634 . 0.1686 0.2224 . 134 . 2768 . 'X-RAY DIFFRACTION' . 3.5078 4.0149 14 100.0000 2633 . 0.1550 0.2082 . 121 . 2754 . 'X-RAY DIFFRACTION' . 4.0149 5.0569 14 100.0000 2636 . 0.1371 0.2160 . 143 . 2779 . 'X-RAY DIFFRACTION' . 5.0569 40.4114 14 100.0000 2665 . 0.1735 0.2043 . 110 . 2775 . 'X-RAY DIFFRACTION' . # _struct.entry_id 3WF5 _struct.title ;Crystal structure of S6K1 kinase domain in complex with a pyrazolopyrimidine derivative 4-[4-(1H-benzimidazol-2-yl)piperidin-1-yl]-1H-pyrazolo[3,4-d]pyrimidine ; _struct.pdbx_descriptor 'Ribosomal protein S6 kinase beta-1 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3WF5 _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text ;SERINE/THREONINE PROTEIN KINASE DOMAIN, TRANSFERASE, PHOSPHORYLATION, ATP-BINDING, ZINC-BINDING, TRANSFERASE-TRANSFERASE INHIBITOR complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 17 ? GLU A 19 ? ARG A 87 GLU A 89 5 ? 3 HELX_P HELX_P2 2 LYS A 71 ? VAL A 80 ? LYS A 141 VAL A 150 1 ? 10 HELX_P HELX_P3 3 GLU A 109 ? GLY A 118 ? GLU A 179 GLY A 188 1 ? 10 HELX_P HELX_P4 4 MET A 121 ? LYS A 142 ? MET A 191 LYS A 212 1 ? 22 HELX_P HELX_P5 5 LYS A 150 ? GLU A 152 ? LYS A 220 GLU A 222 5 ? 3 HELX_P HELX_P6 6 ALA A 191 ? ARG A 197 ? ALA A 261 ARG A 267 1 ? 7 HELX_P HELX_P7 7 ARG A 202 ? GLY A 219 ? ARG A 272 GLY A 289 1 ? 18 HELX_P HELX_P8 8 ASN A 227 ? CYS A 238 ? ASN A 297 CYS A 308 1 ? 12 HELX_P HELX_P9 9 THR A 247 ? LEU A 258 ? THR A 317 LEU A 328 1 ? 12 HELX_P HELX_P10 10 ASN A 261 ? ARG A 265 ? ASN A 331 ARG A 335 5 ? 5 HELX_P HELX_P11 11 GLY A 271 ? ALA A 278 ? GLY A 341 ALA A 348 1 ? 8 HELX_P HELX_P12 12 HIS A 279 ? ARG A 283 ? HIS A 349 ARG A 353 5 ? 5 HELX_P HELX_P13 13 ASN A 286 ? ALA A 292 ? ASN A 356 ALA A 362 1 ? 7 HELX_P HELX_P14 14 LYS A 300 ? GLN A 304 ? LYS A 370 GLN A 374 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A HIS 181 C ? ? ? 1_555 A TPO 182 N ? ? A HIS 251 A TPO 252 1_555 ? ? ? ? ? ? ? 1.326 ? covale2 covale ? ? A TPO 182 C ? ? ? 1_555 A PHE 183 N ? ? A TPO 252 A PHE 253 1_555 ? ? ? ? ? ? ? 1.324 ? metalc1 metalc ? ? A HIS 181 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 251 A ZN 401 1_555 ? ? ? ? ? ? ? 2.047 ? metalc2 metalc ? ? A CYS 184 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 254 A ZN 401 1_555 ? ? ? ? ? ? ? 2.280 ? metalc3 metalc ? ? A HIS 175 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 245 A ZN 401 1_555 ? ? ? ? ? ? ? 2.371 ? metalc4 metalc ? ? A CYS 170 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 240 A ZN 401 1_555 ? ? ? ? ? ? ? 2.493 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 21 ? GLY A 30 ? PHE A 91 GLY A 100 A 2 GLY A 33 ? LYS A 40 ? GLY A 103 LYS A 110 A 3 ILE A 49 ? LYS A 56 ? ILE A 119 LYS A 126 A 4 LYS A 97 ? GLU A 103 ? LYS A 167 GLU A 173 A 5 LEU A 88 ? THR A 94 ? LEU A 158 THR A 164 B 1 ILE A 154 ? LEU A 156 ? ILE A 224 LEU A 226 B 2 VAL A 162 ? LEU A 164 ? VAL A 232 LEU A 234 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 27 ? N LEU A 97 O VAL A 35 ? O VAL A 105 A 2 3 N LYS A 34 ? N LYS A 104 O VAL A 54 ? O VAL A 124 A 3 4 N ALA A 51 ? N ALA A 121 O LEU A 102 ? O LEU A 172 A 4 5 O TYR A 99 ? O TYR A 169 N PHE A 92 ? N PHE A 162 B 1 2 N MET A 155 ? N MET A 225 O LYS A 163 ? O LYS A 233 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 401' AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE FZ8 A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 170 ? CYS A 240 . ? 1_555 ? 2 AC1 4 HIS A 175 ? HIS A 245 . ? 1_555 ? 3 AC1 4 HIS A 181 ? HIS A 251 . ? 1_555 ? 4 AC1 4 CYS A 184 ? CYS A 254 . ? 1_555 ? 5 AC2 14 GLY A 28 ? GLY A 98 . ? 1_555 ? 6 AC2 14 LYS A 29 ? LYS A 99 . ? 1_555 ? 7 AC2 14 GLY A 30 ? GLY A 100 . ? 1_555 ? 8 AC2 14 GLY A 33 ? GLY A 103 . ? 1_555 ? 9 AC2 14 VAL A 35 ? VAL A 105 . ? 1_555 ? 10 AC2 14 ALA A 51 ? ALA A 121 . ? 1_555 ? 11 AC2 14 VAL A 86 ? VAL A 156 . ? 1_555 ? 12 AC2 14 GLU A 103 ? GLU A 173 . ? 1_555 ? 13 AC2 14 LEU A 105 ? LEU A 175 . ? 1_555 ? 14 AC2 14 MET A 155 ? MET A 225 . ? 1_555 ? 15 AC2 14 LYS A 171 ? LYS A 241 . ? 1_555 ? 16 AC2 14 HOH D . ? HOH A 516 . ? 1_555 ? 17 AC2 14 HOH D . ? HOH A 533 . ? 1_555 ? 18 AC2 14 HOH D . ? HOH A 606 . ? 1_555 ? # _database_PDB_matrix.entry_id 3WF5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3WF5 _atom_sites.fract_transf_matrix[1][1] 0.014447 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014447 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006984 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 71 ? ? ? A . n A 1 2 SER 2 72 ? ? ? A . n A 1 3 PHE 3 73 ? ? ? A . n A 1 4 THR 4 74 ? ? ? A . n A 1 5 SER 5 75 ? ? ? A . n A 1 6 SER 6 76 ? ? ? A . n A 1 7 GLY 7 77 ? ? ? A . n A 1 8 SER 8 78 ? ? ? A . n A 1 9 VAL 9 79 ? ? ? A . n A 1 10 ASN 10 80 ? ? ? A . n A 1 11 ARG 11 81 ? ? ? A . n A 1 12 GLY 12 82 ? ? ? A . n A 1 13 PRO 13 83 ? ? ? A . n A 1 14 GLU 14 84 ? ? ? A . n A 1 15 LYS 15 85 85 LYS LYS A . n A 1 16 ILE 16 86 86 ILE ILE A . n A 1 17 ARG 17 87 87 ARG ARG A . n A 1 18 PRO 18 88 88 PRO PRO A . n A 1 19 GLU 19 89 89 GLU GLU A . n A 1 20 CYS 20 90 90 CYS CYS A . n A 1 21 PHE 21 91 91 PHE PHE A . n A 1 22 GLU 22 92 92 GLU GLU A . n A 1 23 LEU 23 93 93 LEU LEU A . n A 1 24 LEU 24 94 94 LEU LEU A . n A 1 25 ARG 25 95 95 ARG ARG A . n A 1 26 VAL 26 96 96 VAL VAL A . n A 1 27 LEU 27 97 97 LEU LEU A . n A 1 28 GLY 28 98 98 GLY GLY A . n A 1 29 LYS 29 99 99 LYS LYS A . n A 1 30 GLY 30 100 100 GLY GLY A . n A 1 31 GLY 31 101 101 GLY GLY A . n A 1 32 TYR 32 102 102 TYR TYR A . n A 1 33 GLY 33 103 103 GLY GLY A . n A 1 34 LYS 34 104 104 LYS LYS A . n A 1 35 VAL 35 105 105 VAL VAL A . n A 1 36 PHE 36 106 106 PHE PHE A . n A 1 37 GLN 37 107 107 GLN GLN A . n A 1 38 VAL 38 108 108 VAL VAL A . n A 1 39 ARG 39 109 109 ARG ARG A . n A 1 40 LYS 40 110 110 LYS LYS A . n A 1 41 VAL 41 111 111 VAL VAL A . n A 1 42 THR 42 112 112 THR THR A . n A 1 43 GLY 43 113 113 GLY GLY A . n A 1 44 ALA 44 114 114 ALA ALA A . n A 1 45 ASN 45 115 115 ASN ASN A . n A 1 46 THR 46 116 116 THR THR A . n A 1 47 GLY 47 117 117 GLY GLY A . n A 1 48 LYS 48 118 118 LYS LYS A . n A 1 49 ILE 49 119 119 ILE ILE A . n A 1 50 PHE 50 120 120 PHE PHE A . n A 1 51 ALA 51 121 121 ALA ALA A . n A 1 52 MET 52 122 122 MET MET A . n A 1 53 LYS 53 123 123 LYS LYS A . n A 1 54 VAL 54 124 124 VAL VAL A . n A 1 55 LEU 55 125 125 LEU LEU A . n A 1 56 LYS 56 126 126 LYS LYS A . n A 1 57 LYS 57 127 127 LYS LYS A . n A 1 58 ALA 58 128 ? ? ? A . n A 1 59 MET 59 129 ? ? ? A . n A 1 60 ILE 60 130 ? ? ? A . n A 1 61 VAL 61 131 ? ? ? A . n A 1 62 ARG 62 132 ? ? ? A . n A 1 63 ASN 63 133 ? ? ? A . n A 1 64 ALA 64 134 ? ? ? A . n A 1 65 LYS 65 135 ? ? ? A . n A 1 66 ASP 66 136 ? ? ? A . n A 1 67 THR 67 137 ? ? ? A . n A 1 68 ALA 68 138 ? ? ? A . n A 1 69 HIS 69 139 ? ? ? A . n A 1 70 THR 70 140 140 THR THR A . n A 1 71 LYS 71 141 141 LYS LYS A . n A 1 72 ALA 72 142 142 ALA ALA A . n A 1 73 GLU 73 143 143 GLU GLU A . n A 1 74 ARG 74 144 144 ARG ARG A . n A 1 75 ASN 75 145 145 ASN ASN A . n A 1 76 ILE 76 146 146 ILE ILE A . n A 1 77 LEU 77 147 147 LEU LEU A . n A 1 78 GLU 78 148 148 GLU GLU A . n A 1 79 GLU 79 149 149 GLU GLU A . n A 1 80 VAL 80 150 150 VAL VAL A . n A 1 81 LYS 81 151 151 LYS LYS A . n A 1 82 HIS 82 152 152 HIS HIS A . n A 1 83 PRO 83 153 153 PRO PRO A . n A 1 84 PHE 84 154 154 PHE PHE A . n A 1 85 ILE 85 155 155 ILE ILE A . n A 1 86 VAL 86 156 156 VAL VAL A . n A 1 87 ASP 87 157 157 ASP ASP A . n A 1 88 LEU 88 158 158 LEU LEU A . n A 1 89 ILE 89 159 159 ILE ILE A . n A 1 90 TYR 90 160 160 TYR TYR A . n A 1 91 ALA 91 161 161 ALA ALA A . n A 1 92 PHE 92 162 162 PHE PHE A . n A 1 93 GLN 93 163 163 GLN GLN A . n A 1 94 THR 94 164 164 THR THR A . n A 1 95 GLY 95 165 165 GLY GLY A . n A 1 96 GLY 96 166 166 GLY GLY A . n A 1 97 LYS 97 167 167 LYS LYS A . n A 1 98 LEU 98 168 168 LEU LEU A . n A 1 99 TYR 99 169 169 TYR TYR A . n A 1 100 LEU 100 170 170 LEU LEU A . n A 1 101 ILE 101 171 171 ILE ILE A . n A 1 102 LEU 102 172 172 LEU LEU A . n A 1 103 GLU 103 173 173 GLU GLU A . n A 1 104 TYR 104 174 174 TYR TYR A . n A 1 105 LEU 105 175 175 LEU LEU A . n A 1 106 SER 106 176 176 SER SER A . n A 1 107 GLY 107 177 177 GLY GLY A . n A 1 108 GLY 108 178 178 GLY GLY A . n A 1 109 GLU 109 179 179 GLU GLU A . n A 1 110 LEU 110 180 180 LEU LEU A . n A 1 111 PHE 111 181 181 PHE PHE A . n A 1 112 MET 112 182 182 MET MET A . n A 1 113 GLN 113 183 183 GLN GLN A . n A 1 114 LEU 114 184 184 LEU LEU A . n A 1 115 GLU 115 185 185 GLU GLU A . n A 1 116 ARG 116 186 186 ARG ARG A . n A 1 117 GLU 117 187 187 GLU GLU A . n A 1 118 GLY 118 188 188 GLY GLY A . n A 1 119 ILE 119 189 189 ILE ILE A . n A 1 120 PHE 120 190 190 PHE PHE A . n A 1 121 MET 121 191 191 MET MET A . n A 1 122 GLU 122 192 192 GLU GLU A . n A 1 123 ASP 123 193 193 ASP ASP A . n A 1 124 THR 124 194 194 THR THR A . n A 1 125 ALA 125 195 195 ALA ALA A . n A 1 126 CYS 126 196 196 CYS CYS A . n A 1 127 PHE 127 197 197 PHE PHE A . n A 1 128 TYR 128 198 198 TYR TYR A . n A 1 129 LEU 129 199 199 LEU LEU A . n A 1 130 ALA 130 200 200 ALA ALA A . n A 1 131 GLU 131 201 201 GLU GLU A . n A 1 132 ILE 132 202 202 ILE ILE A . n A 1 133 SER 133 203 203 SER SER A . n A 1 134 MET 134 204 204 MET MET A . n A 1 135 ALA 135 205 205 ALA ALA A . n A 1 136 LEU 136 206 206 LEU LEU A . n A 1 137 GLY 137 207 207 GLY GLY A . n A 1 138 HIS 138 208 208 HIS HIS A . n A 1 139 LEU 139 209 209 LEU LEU A . n A 1 140 HIS 140 210 210 HIS HIS A . n A 1 141 GLN 141 211 211 GLN GLN A . n A 1 142 LYS 142 212 212 LYS LYS A . n A 1 143 GLY 143 213 213 GLY GLY A . n A 1 144 ILE 144 214 214 ILE ILE A . n A 1 145 ILE 145 215 215 ILE ILE A . n A 1 146 TYR 146 216 216 TYR TYR A . n A 1 147 ARG 147 217 217 ARG ARG A . n A 1 148 ASP 148 218 218 ASP ASP A . n A 1 149 LEU 149 219 219 LEU LEU A . n A 1 150 LYS 150 220 220 LYS LYS A . n A 1 151 PRO 151 221 221 PRO PRO A . n A 1 152 GLU 152 222 222 GLU GLU A . n A 1 153 ASN 153 223 223 ASN ASN A . n A 1 154 ILE 154 224 224 ILE ILE A . n A 1 155 MET 155 225 225 MET MET A . n A 1 156 LEU 156 226 226 LEU LEU A . n A 1 157 ASN 157 227 227 ASN ASN A . n A 1 158 HIS 158 228 228 HIS HIS A . n A 1 159 GLN 159 229 229 GLN GLN A . n A 1 160 GLY 160 230 230 GLY GLY A . n A 1 161 HIS 161 231 231 HIS HIS A . n A 1 162 VAL 162 232 232 VAL VAL A . n A 1 163 LYS 163 233 233 LYS LYS A . n A 1 164 LEU 164 234 234 LEU LEU A . n A 1 165 THR 165 235 235 THR THR A . n A 1 166 ASP 166 236 236 ASP ASP A . n A 1 167 PHE 167 237 237 PHE PHE A . n A 1 168 GLY 168 238 238 GLY GLY A . n A 1 169 LEU 169 239 239 LEU LEU A . n A 1 170 CYS 170 240 240 CYS CYS A . n A 1 171 LYS 171 241 241 LYS LYS A . n A 1 172 GLU 172 242 242 GLU GLU A . n A 1 173 SER 173 243 243 SER SER A . n A 1 174 ILE 174 244 244 ILE ILE A . n A 1 175 HIS 175 245 245 HIS HIS A . n A 1 176 ASP 176 246 246 ASP ASP A . n A 1 177 GLY 177 247 247 GLY GLY A . n A 1 178 THR 178 248 248 THR THR A . n A 1 179 VAL 179 249 249 VAL VAL A . n A 1 180 THR 180 250 250 THR THR A . n A 1 181 HIS 181 251 251 HIS HIS A . n A 1 182 TPO 182 252 252 TPO TPO A . n A 1 183 PHE 183 253 253 PHE PHE A . n A 1 184 CYS 184 254 254 CYS CYS A . n A 1 185 GLY 185 255 255 GLY GLY A . n A 1 186 THR 186 256 256 THR THR A . n A 1 187 ILE 187 257 257 ILE ILE A . n A 1 188 GLU 188 258 258 GLU GLU A . n A 1 189 TYR 189 259 259 TYR TYR A . n A 1 190 MET 190 260 260 MET MET A . n A 1 191 ALA 191 261 261 ALA ALA A . n A 1 192 PRO 192 262 262 PRO PRO A . n A 1 193 GLU 193 263 263 GLU GLU A . n A 1 194 ILE 194 264 264 ILE ILE A . n A 1 195 LEU 195 265 265 LEU LEU A . n A 1 196 MET 196 266 266 MET MET A . n A 1 197 ARG 197 267 267 ARG ARG A . n A 1 198 SER 198 268 268 SER SER A . n A 1 199 GLY 199 269 269 GLY GLY A . n A 1 200 HIS 200 270 270 HIS HIS A . n A 1 201 ASN 201 271 271 ASN ASN A . n A 1 202 ARG 202 272 272 ARG ARG A . n A 1 203 ALA 203 273 273 ALA ALA A . n A 1 204 VAL 204 274 274 VAL VAL A . n A 1 205 ASP 205 275 275 ASP ASP A . n A 1 206 TRP 206 276 276 TRP TRP A . n A 1 207 TRP 207 277 277 TRP TRP A . n A 1 208 SER 208 278 278 SER SER A . n A 1 209 LEU 209 279 279 LEU LEU A . n A 1 210 GLY 210 280 280 GLY GLY A . n A 1 211 ALA 211 281 281 ALA ALA A . n A 1 212 LEU 212 282 282 LEU LEU A . n A 1 213 MET 213 283 283 MET MET A . n A 1 214 TYR 214 284 284 TYR TYR A . n A 1 215 ASP 215 285 285 ASP ASP A . n A 1 216 MET 216 286 286 MET MET A . n A 1 217 LEU 217 287 287 LEU LEU A . n A 1 218 THR 218 288 288 THR THR A . n A 1 219 GLY 219 289 289 GLY GLY A . n A 1 220 ALA 220 290 290 ALA ALA A . n A 1 221 PRO 221 291 291 PRO PRO A . n A 1 222 PRO 222 292 292 PRO PRO A . n A 1 223 PHE 223 293 293 PHE PHE A . n A 1 224 THR 224 294 294 THR THR A . n A 1 225 GLY 225 295 295 GLY GLY A . n A 1 226 GLU 226 296 296 GLU GLU A . n A 1 227 ASN 227 297 297 ASN ASN A . n A 1 228 ARG 228 298 298 ARG ARG A . n A 1 229 LYS 229 299 299 LYS LYS A . n A 1 230 LYS 230 300 300 LYS LYS A . n A 1 231 THR 231 301 301 THR THR A . n A 1 232 ILE 232 302 302 ILE ILE A . n A 1 233 ASP 233 303 303 ASP ASP A . n A 1 234 LYS 234 304 304 LYS LYS A . n A 1 235 ILE 235 305 305 ILE ILE A . n A 1 236 LEU 236 306 306 LEU LEU A . n A 1 237 LYS 237 307 307 LYS LYS A . n A 1 238 CYS 238 308 308 CYS CYS A . n A 1 239 LYS 239 309 309 LYS LYS A . n A 1 240 LEU 240 310 310 LEU LEU A . n A 1 241 ASN 241 311 311 ASN ASN A . n A 1 242 LEU 242 312 312 LEU LEU A . n A 1 243 PRO 243 313 313 PRO PRO A . n A 1 244 PRO 244 314 314 PRO PRO A . n A 1 245 TYR 245 315 315 TYR TYR A . n A 1 246 LEU 246 316 316 LEU LEU A . n A 1 247 THR 247 317 317 THR THR A . n A 1 248 GLN 248 318 318 GLN GLN A . n A 1 249 GLU 249 319 319 GLU GLU A . n A 1 250 ALA 250 320 320 ALA ALA A . n A 1 251 ARG 251 321 321 ARG ARG A . n A 1 252 ASP 252 322 322 ASP ASP A . n A 1 253 LEU 253 323 323 LEU LEU A . n A 1 254 LEU 254 324 324 LEU LEU A . n A 1 255 LYS 255 325 325 LYS LYS A . n A 1 256 LYS 256 326 326 LYS LYS A . n A 1 257 LEU 257 327 327 LEU LEU A . n A 1 258 LEU 258 328 328 LEU LEU A . n A 1 259 LYS 259 329 329 LYS LYS A . n A 1 260 ARG 260 330 330 ARG ARG A . n A 1 261 ASN 261 331 331 ASN ASN A . n A 1 262 ALA 262 332 332 ALA ALA A . n A 1 263 ALA 263 333 333 ALA ALA A . n A 1 264 SER 264 334 334 SER SER A . n A 1 265 ARG 265 335 335 ARG ARG A . n A 1 266 LEU 266 336 336 LEU LEU A . n A 1 267 GLY 267 337 337 GLY GLY A . n A 1 268 ALA 268 338 338 ALA ALA A . n A 1 269 GLY 269 339 339 GLY GLY A . n A 1 270 PRO 270 340 340 PRO PRO A . n A 1 271 GLY 271 341 341 GLY GLY A . n A 1 272 ASP 272 342 342 ASP ASP A . n A 1 273 ALA 273 343 343 ALA ALA A . n A 1 274 GLY 274 344 344 GLY GLY A . n A 1 275 GLU 275 345 345 GLU GLU A . n A 1 276 VAL 276 346 346 VAL VAL A . n A 1 277 GLN 277 347 347 GLN GLN A . n A 1 278 ALA 278 348 348 ALA ALA A . n A 1 279 HIS 279 349 349 HIS HIS A . n A 1 280 PRO 280 350 350 PRO PRO A . n A 1 281 PHE 281 351 351 PHE PHE A . n A 1 282 PHE 282 352 352 PHE PHE A . n A 1 283 ARG 283 353 353 ARG ARG A . n A 1 284 HIS 284 354 354 HIS HIS A . n A 1 285 ILE 285 355 355 ILE ILE A . n A 1 286 ASN 286 356 356 ASN ASN A . n A 1 287 TRP 287 357 357 TRP TRP A . n A 1 288 GLU 288 358 358 GLU GLU A . n A 1 289 GLU 289 359 359 GLU GLU A . n A 1 290 LEU 290 360 360 LEU LEU A . n A 1 291 LEU 291 361 361 LEU LEU A . n A 1 292 ALA 292 362 362 ALA ALA A . n A 1 293 ARG 293 363 363 ARG ARG A . n A 1 294 LYS 294 364 364 LYS LYS A . n A 1 295 VAL 295 365 365 VAL VAL A . n A 1 296 GLU 296 366 366 GLU GLU A . n A 1 297 PRO 297 367 367 PRO PRO A . n A 1 298 PRO 298 368 368 PRO PRO A . n A 1 299 PHE 299 369 369 PHE PHE A . n A 1 300 LYS 300 370 370 LYS LYS A . n A 1 301 PRO 301 371 371 PRO PRO A . n A 1 302 LEU 302 372 372 LEU LEU A . n A 1 303 LEU 303 373 373 LEU LEU A . n A 1 304 GLN 304 374 374 GLN GLN A . n A 1 305 SER 305 375 ? ? ? A . n A 1 306 GLU 306 376 ? ? ? A . n A 1 307 GLU 307 377 ? ? ? A . n A 1 308 ASP 308 378 ? ? ? A . n A 1 309 VAL 309 379 ? ? ? A . n A 1 310 SER 310 380 ? ? ? A . n A 1 311 GLN 311 381 ? ? ? A . n A 1 312 PHE 312 382 ? ? ? A . n A 1 313 ASP 313 383 ? ? ? A . n A 1 314 SER 314 384 ? ? ? A . n A 1 315 LYS 315 385 ? ? ? A . n A 1 316 PHE 316 386 ? ? ? A . n A 1 317 THR 317 387 ? ? ? A . n A 1 318 ARG 318 388 ? ? ? A . n A 1 319 GLN 319 389 ? ? ? A . n A 1 320 THR 320 390 ? ? ? A . n A 1 321 PRO 321 391 ? ? ? A . n A 1 322 VAL 322 392 ? ? ? A . n A 1 323 ASP 323 393 ? ? ? A . n A 1 324 SER 324 394 ? ? ? A . n A 1 325 PRO 325 395 ? ? ? A . n A 1 326 ASP 326 396 ? ? ? A . n A 1 327 ASP 327 397 ? ? ? A . n A 1 328 SER 328 398 ? ? ? A . n A 1 329 THR 329 399 ? ? ? A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id TPO _pdbx_struct_mod_residue.label_seq_id 182 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id TPO _pdbx_struct_mod_residue.auth_seq_id 252 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details PHOSPHOTHREONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 181 ? A HIS 251 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 184 ? A CYS 254 ? 1_555 105.5 ? 2 ND1 ? A HIS 181 ? A HIS 251 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 175 ? A HIS 245 ? 1_555 132.2 ? 3 SG ? A CYS 184 ? A CYS 254 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 175 ? A HIS 245 ? 1_555 110.0 ? 4 ND1 ? A HIS 181 ? A HIS 251 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 170 ? A CYS 240 ? 1_555 92.1 ? 5 SG ? A CYS 184 ? A CYS 254 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 170 ? A CYS 240 ? 1_555 113.2 ? 6 ND1 ? A HIS 175 ? A HIS 245 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 170 ? A CYS 240 ? 1_555 102.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-08-06 2 'Structure model' 1 1 2014-08-13 3 'Structure model' 1 2 2014-10-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -3.0487 5.4276 -16.4602 0.2201 0.4478 0.2724 0.0059 0.0279 -0.0986 3.6715 7.9497 8.0185 0.1775 1.3977 0.7626 0.0695 0.1500 -0.1857 -0.5321 0.1810 -0.4815 0.3785 0.2802 0.7662 'X-RAY DIFFRACTION' 2 ? refined -18.3748 7.4868 -7.3579 0.2811 0.3097 0.2604 -0.0137 0.0387 -0.0079 5.1181 3.4004 3.4171 -2.2059 -2.6803 1.4496 -0.2982 0.0640 0.2288 -0.2661 -0.4946 0.1486 0.1761 0.3262 0.3049 'X-RAY DIFFRACTION' 3 ? refined -28.0798 16.7783 -0.6877 0.2317 0.3207 0.2606 -0.0282 0.0646 0.0198 3.4989 3.1850 5.1331 -2.1320 -1.8574 1.9965 -0.0978 0.0478 0.0317 -0.1353 -0.2175 0.1349 0.1419 -0.0172 0.0281 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 85:126 )' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 127:234 )' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 235:374 )' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHASER phasing . ? 2 PHENIX refinement '(phenix.refine: 1.8.1_1168)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 217 ? ? 73.10 -44.42 2 1 VAL A 249 ? ? -141.26 -76.92 3 1 ASN A 271 ? ? -144.55 -158.60 4 1 ASP A 342 ? ? 43.90 -121.83 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 85 ? CG ? A LYS 15 CG 2 1 Y 1 A LYS 85 ? CD ? A LYS 15 CD 3 1 Y 1 A LYS 85 ? CE ? A LYS 15 CE 4 1 Y 1 A LYS 85 ? NZ ? A LYS 15 NZ 5 1 Y 1 A LYS 127 ? CG ? A LYS 57 CG 6 1 Y 1 A LYS 127 ? CD ? A LYS 57 CD 7 1 Y 1 A LYS 127 ? CE ? A LYS 57 CE 8 1 Y 1 A LYS 127 ? NZ ? A LYS 57 NZ 9 1 Y 1 A THR 248 ? CB ? A THR 178 CB 10 1 Y 1 A THR 248 ? OG1 ? A THR 178 OG1 11 1 Y 1 A THR 248 ? CG2 ? A THR 178 CG2 12 1 Y 1 A VAL 249 ? CB ? A VAL 179 CB 13 1 Y 1 A VAL 249 ? CG1 ? A VAL 179 CG1 14 1 Y 1 A VAL 249 ? CG2 ? A VAL 179 CG2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 71 ? A GLY 1 2 1 Y 1 A SER 72 ? A SER 2 3 1 Y 1 A PHE 73 ? A PHE 3 4 1 Y 1 A THR 74 ? A THR 4 5 1 Y 1 A SER 75 ? A SER 5 6 1 Y 1 A SER 76 ? A SER 6 7 1 Y 1 A GLY 77 ? A GLY 7 8 1 Y 1 A SER 78 ? A SER 8 9 1 Y 1 A VAL 79 ? A VAL 9 10 1 Y 1 A ASN 80 ? A ASN 10 11 1 Y 1 A ARG 81 ? A ARG 11 12 1 Y 1 A GLY 82 ? A GLY 12 13 1 Y 1 A PRO 83 ? A PRO 13 14 1 Y 1 A GLU 84 ? A GLU 14 15 1 Y 1 A ALA 128 ? A ALA 58 16 1 Y 1 A MET 129 ? A MET 59 17 1 Y 1 A ILE 130 ? A ILE 60 18 1 Y 1 A VAL 131 ? A VAL 61 19 1 Y 1 A ARG 132 ? A ARG 62 20 1 Y 1 A ASN 133 ? A ASN 63 21 1 Y 1 A ALA 134 ? A ALA 64 22 1 Y 1 A LYS 135 ? A LYS 65 23 1 Y 1 A ASP 136 ? A ASP 66 24 1 Y 1 A THR 137 ? A THR 67 25 1 Y 1 A ALA 138 ? A ALA 68 26 1 Y 1 A HIS 139 ? A HIS 69 27 1 Y 1 A SER 375 ? A SER 305 28 1 Y 1 A GLU 376 ? A GLU 306 29 1 Y 1 A GLU 377 ? A GLU 307 30 1 Y 1 A ASP 378 ? A ASP 308 31 1 Y 1 A VAL 379 ? A VAL 309 32 1 Y 1 A SER 380 ? A SER 310 33 1 Y 1 A GLN 381 ? A GLN 311 34 1 Y 1 A PHE 382 ? A PHE 312 35 1 Y 1 A ASP 383 ? A ASP 313 36 1 Y 1 A SER 384 ? A SER 314 37 1 Y 1 A LYS 385 ? A LYS 315 38 1 Y 1 A PHE 386 ? A PHE 316 39 1 Y 1 A THR 387 ? A THR 317 40 1 Y 1 A ARG 388 ? A ARG 318 41 1 Y 1 A GLN 389 ? A GLN 319 42 1 Y 1 A THR 390 ? A THR 320 43 1 Y 1 A PRO 391 ? A PRO 321 44 1 Y 1 A VAL 392 ? A VAL 322 45 1 Y 1 A ASP 393 ? A ASP 323 46 1 Y 1 A SER 394 ? A SER 324 47 1 Y 1 A PRO 395 ? A PRO 325 48 1 Y 1 A ASP 396 ? A ASP 326 49 1 Y 1 A ASP 397 ? A ASP 327 50 1 Y 1 A SER 398 ? A SER 328 51 1 Y 1 A THR 399 ? A THR 329 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '4-[4-(1H-benzimidazol-2-yl)piperidin-1-yl]-1H-pyrazolo[3,4-d]pyrimidine' FZ8 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 401 ZN ZN A . C 3 FZ8 1 402 501 FZ8 FZ8 A . D 4 HOH 1 501 1 HOH HOH A . D 4 HOH 2 502 2 HOH HOH A . D 4 HOH 3 503 3 HOH HOH A . D 4 HOH 4 504 4 HOH HOH A . D 4 HOH 5 505 5 HOH HOH A . D 4 HOH 6 506 6 HOH HOH A . D 4 HOH 7 507 7 HOH HOH A . D 4 HOH 8 508 8 HOH HOH A . D 4 HOH 9 509 9 HOH HOH A . D 4 HOH 10 510 10 HOH HOH A . D 4 HOH 11 511 11 HOH HOH A . D 4 HOH 12 512 12 HOH HOH A . D 4 HOH 13 513 13 HOH HOH A . D 4 HOH 14 514 14 HOH HOH A . D 4 HOH 15 515 15 HOH HOH A . D 4 HOH 16 516 16 HOH HOH A . D 4 HOH 17 517 17 HOH HOH A . D 4 HOH 18 518 18 HOH HOH A . D 4 HOH 19 519 19 HOH HOH A . D 4 HOH 20 520 20 HOH HOH A . D 4 HOH 21 521 21 HOH HOH A . D 4 HOH 22 522 22 HOH HOH A . D 4 HOH 23 523 23 HOH HOH A . D 4 HOH 24 524 24 HOH HOH A . D 4 HOH 25 525 25 HOH HOH A . D 4 HOH 26 526 26 HOH HOH A . D 4 HOH 27 527 27 HOH HOH A . D 4 HOH 28 528 28 HOH HOH A . D 4 HOH 29 529 29 HOH HOH A . D 4 HOH 30 530 30 HOH HOH A . D 4 HOH 31 531 31 HOH HOH A . D 4 HOH 32 532 32 HOH HOH A . D 4 HOH 33 533 33 HOH HOH A . D 4 HOH 34 534 34 HOH HOH A . D 4 HOH 35 535 35 HOH HOH A . D 4 HOH 36 536 36 HOH HOH A . D 4 HOH 37 537 37 HOH HOH A . D 4 HOH 38 538 38 HOH HOH A . D 4 HOH 39 539 39 HOH HOH A . D 4 HOH 40 540 40 HOH HOH A . D 4 HOH 41 541 41 HOH HOH A . D 4 HOH 42 542 42 HOH HOH A . D 4 HOH 43 543 43 HOH HOH A . D 4 HOH 44 544 44 HOH HOH A . D 4 HOH 45 545 45 HOH HOH A . D 4 HOH 46 546 46 HOH HOH A . D 4 HOH 47 547 47 HOH HOH A . D 4 HOH 48 548 48 HOH HOH A . D 4 HOH 49 549 49 HOH HOH A . D 4 HOH 50 550 50 HOH HOH A . D 4 HOH 51 551 51 HOH HOH A . D 4 HOH 52 552 52 HOH HOH A . D 4 HOH 53 553 53 HOH HOH A . D 4 HOH 54 554 54 HOH HOH A . D 4 HOH 55 555 55 HOH HOH A . D 4 HOH 56 556 56 HOH HOH A . D 4 HOH 57 557 57 HOH HOH A . D 4 HOH 58 558 58 HOH HOH A . D 4 HOH 59 559 59 HOH HOH A . D 4 HOH 60 560 60 HOH HOH A . D 4 HOH 61 561 61 HOH HOH A . D 4 HOH 62 562 62 HOH HOH A . D 4 HOH 63 563 63 HOH HOH A . D 4 HOH 64 564 64 HOH HOH A . D 4 HOH 65 565 65 HOH HOH A . D 4 HOH 66 566 66 HOH HOH A . D 4 HOH 67 567 67 HOH HOH A . D 4 HOH 68 568 68 HOH HOH A . D 4 HOH 69 569 69 HOH HOH A . D 4 HOH 70 570 70 HOH HOH A . D 4 HOH 71 571 71 HOH HOH A . D 4 HOH 72 572 72 HOH HOH A . D 4 HOH 73 573 73 HOH HOH A . D 4 HOH 74 574 74 HOH HOH A . D 4 HOH 75 575 75 HOH HOH A . D 4 HOH 76 576 76 HOH HOH A . D 4 HOH 77 577 77 HOH HOH A . D 4 HOH 78 578 78 HOH HOH A . D 4 HOH 79 579 79 HOH HOH A . D 4 HOH 80 580 80 HOH HOH A . D 4 HOH 81 581 81 HOH HOH A . D 4 HOH 82 582 82 HOH HOH A . D 4 HOH 83 583 83 HOH HOH A . D 4 HOH 84 584 84 HOH HOH A . D 4 HOH 85 585 85 HOH HOH A . D 4 HOH 86 586 86 HOH HOH A . D 4 HOH 87 587 87 HOH HOH A . D 4 HOH 88 588 88 HOH HOH A . D 4 HOH 89 589 89 HOH HOH A . D 4 HOH 90 590 90 HOH HOH A . D 4 HOH 91 591 91 HOH HOH A . D 4 HOH 92 592 92 HOH HOH A . D 4 HOH 93 593 93 HOH HOH A . D 4 HOH 94 594 94 HOH HOH A . D 4 HOH 95 595 95 HOH HOH A . D 4 HOH 96 596 96 HOH HOH A . D 4 HOH 97 597 97 HOH HOH A . D 4 HOH 98 598 98 HOH HOH A . D 4 HOH 99 599 99 HOH HOH A . D 4 HOH 100 600 100 HOH HOH A . D 4 HOH 101 601 101 HOH HOH A . D 4 HOH 102 602 102 HOH HOH A . D 4 HOH 103 603 103 HOH HOH A . D 4 HOH 104 604 104 HOH HOH A . D 4 HOH 105 605 105 HOH HOH A . D 4 HOH 106 606 106 HOH HOH A . D 4 HOH 107 607 107 HOH HOH A . D 4 HOH 108 608 108 HOH HOH A . D 4 HOH 109 609 109 HOH HOH A . D 4 HOH 110 610 110 HOH HOH A . #