data_3WFF # _entry.id 3WFF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.333 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3WFF RCSB RCSB096267 WWPDB D_1000096267 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3VHU . unspecified PDB 3VHV . unspecified PDB 3WFG . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3WFF _pdbx_database_status.recvd_initial_deposition_date 2013-07-19 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sogabe, S.' 1 ? 'Habuka, N.' 2 ? # _citation.id primary _citation.title ;Design, synthesis, and structure-activity relationships of dihydrofuran-2-one and dihydropyrrol-2-one derivatives as novel benzoxazin-3-one-based mineralocorticoid receptor antagonists. ; _citation.journal_abbrev Bioorg.Med.Chem. _citation.journal_volume 21 _citation.page_first 5983 _citation.page_last 5994 _citation.year 2013 _citation.journal_id_ASTM BMECEP _citation.country UK _citation.journal_id_ISSN 1464-3391 _citation.journal_id_CSD 1200 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23958516 _citation.pdbx_database_id_DOI 10.1016/j.bmc.2013.07.043 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hasui, T.' 1 ? primary 'Ohra, T.' 2 ? primary 'Ohyabu, N.' 3 ? primary 'Asano, K.' 4 ? primary 'Matsui, H.' 5 ? primary 'Mizukami, A.' 6 ? primary 'Habuka, N.' 7 ? primary 'Sogabe, S.' 8 ? primary 'Endo, S.' 9 ? primary 'Siedem, C.S.' 10 ? primary 'Tang, T.P.' 11 ? primary 'Gauthier, C.' 12 ? primary 'De Meese, L.A.' 13 ? primary 'Boyd, S.A.' 14 ? primary 'Fukumoto, S.' 15 ? # _cell.entry_id 3WFF _cell.length_a 51.866 _cell.length_b 51.866 _cell.length_c 206.153 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3WFF _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mineralocorticoid receptor' 31664.648 1 ? 'C808S, S810L, A976V' 'LIGAND-BINDING DOMAIN, UNP residues 712-984' ? 2 non-polymer syn '6-[4-(2,4-difluorophenyl)-5-oxo-2,5-dihydrofuran-3-yl]-2H-1,4-benzoxazin-3(4H)-one' 343.281 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 water nat water 18.015 94 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MR, Nuclear receptor subfamily 3 group C member 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPG FKNLPLEDQITLIQYSWMSLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEY TIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES HALKVEFPAMLVEIISDQLPKVESGNVKPLYFHRK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPG FKNLPLEDQITLIQYSWMSLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEY TIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES HALKVEFPAMLVEIISDQLPKVESGNVKPLYFHRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 PRO n 1 5 ALA n 1 6 LYS n 1 7 GLU n 1 8 PRO n 1 9 SER n 1 10 VAL n 1 11 ASN n 1 12 THR n 1 13 ALA n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 GLN n 1 18 LEU n 1 19 SER n 1 20 THR n 1 21 ILE n 1 22 SER n 1 23 ARG n 1 24 ALA n 1 25 LEU n 1 26 THR n 1 27 PRO n 1 28 SER n 1 29 PRO n 1 30 VAL n 1 31 MET n 1 32 VAL n 1 33 LEU n 1 34 GLU n 1 35 ASN n 1 36 ILE n 1 37 GLU n 1 38 PRO n 1 39 GLU n 1 40 ILE n 1 41 VAL n 1 42 TYR n 1 43 ALA n 1 44 GLY n 1 45 TYR n 1 46 ASP n 1 47 SER n 1 48 SER n 1 49 LYS n 1 50 PRO n 1 51 ASP n 1 52 THR n 1 53 ALA n 1 54 GLU n 1 55 ASN n 1 56 LEU n 1 57 LEU n 1 58 SER n 1 59 THR n 1 60 LEU n 1 61 ASN n 1 62 ARG n 1 63 LEU n 1 64 ALA n 1 65 GLY n 1 66 LYS n 1 67 GLN n 1 68 MET n 1 69 ILE n 1 70 GLN n 1 71 VAL n 1 72 VAL n 1 73 LYS n 1 74 TRP n 1 75 ALA n 1 76 LYS n 1 77 VAL n 1 78 LEU n 1 79 PRO n 1 80 GLY n 1 81 PHE n 1 82 LYS n 1 83 ASN n 1 84 LEU n 1 85 PRO n 1 86 LEU n 1 87 GLU n 1 88 ASP n 1 89 GLN n 1 90 ILE n 1 91 THR n 1 92 LEU n 1 93 ILE n 1 94 GLN n 1 95 TYR n 1 96 SER n 1 97 TRP n 1 98 MET n 1 99 SER n 1 100 LEU n 1 101 LEU n 1 102 SER n 1 103 PHE n 1 104 ALA n 1 105 LEU n 1 106 SER n 1 107 TRP n 1 108 ARG n 1 109 SER n 1 110 TYR n 1 111 LYS n 1 112 HIS n 1 113 THR n 1 114 ASN n 1 115 SER n 1 116 GLN n 1 117 PHE n 1 118 LEU n 1 119 TYR n 1 120 PHE n 1 121 ALA n 1 122 PRO n 1 123 ASP n 1 124 LEU n 1 125 VAL n 1 126 PHE n 1 127 ASN n 1 128 GLU n 1 129 GLU n 1 130 LYS n 1 131 MET n 1 132 HIS n 1 133 GLN n 1 134 SER n 1 135 ALA n 1 136 MET n 1 137 TYR n 1 138 GLU n 1 139 LEU n 1 140 CYS n 1 141 GLN n 1 142 GLY n 1 143 MET n 1 144 HIS n 1 145 GLN n 1 146 ILE n 1 147 SER n 1 148 LEU n 1 149 GLN n 1 150 PHE n 1 151 VAL n 1 152 ARG n 1 153 LEU n 1 154 GLN n 1 155 LEU n 1 156 THR n 1 157 PHE n 1 158 GLU n 1 159 GLU n 1 160 TYR n 1 161 THR n 1 162 ILE n 1 163 MET n 1 164 LYS n 1 165 VAL n 1 166 LEU n 1 167 LEU n 1 168 LEU n 1 169 LEU n 1 170 SER n 1 171 THR n 1 172 ILE n 1 173 PRO n 1 174 LYS n 1 175 ASP n 1 176 GLY n 1 177 LEU n 1 178 LYS n 1 179 SER n 1 180 GLN n 1 181 ALA n 1 182 ALA n 1 183 PHE n 1 184 GLU n 1 185 GLU n 1 186 MET n 1 187 ARG n 1 188 THR n 1 189 ASN n 1 190 TYR n 1 191 ILE n 1 192 LYS n 1 193 GLU n 1 194 LEU n 1 195 ARG n 1 196 LYS n 1 197 MET n 1 198 VAL n 1 199 THR n 1 200 LYS n 1 201 CYS n 1 202 PRO n 1 203 ASN n 1 204 ASN n 1 205 SER n 1 206 GLY n 1 207 GLN n 1 208 SER n 1 209 TRP n 1 210 GLN n 1 211 ARG n 1 212 PHE n 1 213 TYR n 1 214 GLN n 1 215 LEU n 1 216 THR n 1 217 LYS n 1 218 LEU n 1 219 LEU n 1 220 ASP n 1 221 SER n 1 222 MET n 1 223 HIS n 1 224 ASP n 1 225 LEU n 1 226 VAL n 1 227 SER n 1 228 ASP n 1 229 LEU n 1 230 LEU n 1 231 GLU n 1 232 PHE n 1 233 CYS n 1 234 PHE n 1 235 TYR n 1 236 THR n 1 237 PHE n 1 238 ARG n 1 239 GLU n 1 240 SER n 1 241 HIS n 1 242 ALA n 1 243 LEU n 1 244 LYS n 1 245 VAL n 1 246 GLU n 1 247 PHE n 1 248 PRO n 1 249 ALA n 1 250 MET n 1 251 LEU n 1 252 VAL n 1 253 GLU n 1 254 ILE n 1 255 ILE n 1 256 SER n 1 257 ASP n 1 258 GLN n 1 259 LEU n 1 260 PRO n 1 261 LYS n 1 262 VAL n 1 263 GLU n 1 264 SER n 1 265 GLY n 1 266 ASN n 1 267 VAL n 1 268 LYS n 1 269 PRO n 1 270 LEU n 1 271 TYR n 1 272 PHE n 1 273 HIS n 1 274 ARG n 1 275 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NR3C2, MCR, MLR' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pRTH6 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MCR_HUMAN _struct_ref.pdbx_db_accession P08235 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFK NLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTI MKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHA LKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK ; _struct_ref.pdbx_align_begin 712 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3WFF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 275 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08235 _struct_ref_seq.db_align_beg 712 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 984 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 712 _struct_ref_seq.pdbx_auth_seq_align_end 984 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3WFF GLY A 1 ? UNP P08235 ? ? 'expression tag' 710 1 1 3WFF SER A 2 ? UNP P08235 ? ? 'expression tag' 711 2 1 3WFF SER A 99 ? UNP P08235 CYS 808 'engineered mutation' 808 3 1 3WFF LEU A 101 ? UNP P08235 SER 810 'engineered mutation' 810 4 1 3WFF VAL A 267 ? UNP P08235 ALA 976 'engineered mutation' 976 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 WFF non-polymer . '6-[4-(2,4-difluorophenyl)-5-oxo-2,5-dihydrofuran-3-yl]-2H-1,4-benzoxazin-3(4H)-one' ? 'C18 H11 F2 N O4' 343.281 # _exptl.entry_id 3WFF _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_percent_sol 51.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pdbx_details '0.04M potassium dihydrogen phosphate, 16% PEG 8000, 20% glycerol, pH 7.2, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.pdbx_collection_date 2007-09-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 5.0.3' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 5.0.3 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1 # _reflns.entry_id 3WFF _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.05 _reflns.number_obs 21157 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.079 _reflns.pdbx_netI_over_sigmaI 23.1 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.1 _reflns_shell.percent_possible_all 99.4 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.484 _reflns_shell.meanI_over_sigI_obs 3.4 _reflns_shell.pdbx_redundancy 6.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3WFF _refine.ls_number_reflns_obs 20007 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.86 _refine.ls_d_res_high 2.05 _refine.ls_percent_reflns_obs 99.88 _refine.ls_R_factor_obs 0.18771 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18624 _refine.ls_R_factor_R_free 0.21560 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1082 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.944 _refine.B_iso_mean 38.805 _refine.aniso_B[1][1] -12.66 _refine.aniso_B[2][2] -12.66 _refine.aniso_B[3][3] 25.32 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] -0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 3VHV _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.037 _refine.pdbx_overall_ESU_R_Free 0.032 _refine.overall_SU_ML 0.086 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 6.174 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2109 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 94 _refine_hist.number_atoms_total 2233 _refine_hist.d_res_high 2.05 _refine_hist.d_res_low 33.86 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.009 0.019 ? 2214 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.001 0.020 ? 2118 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.404 1.986 ? 3004 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.720 3.000 ? 4890 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 4.643 5.000 ? 263 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 32.885 24.545 ? 99 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 13.109 15.000 ? 407 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 14.429 15.000 ? 9 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.067 0.200 ? 330 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.005 0.021 ? 2482 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.001 0.020 ? 515 ? 'X-RAY DIFFRACTION' r_mcbond_it 1.532 2.884 ? 1037 ? 'X-RAY DIFFRACTION' r_mcbond_other 1.530 2.884 ? 1036 ? 'X-RAY DIFFRACTION' r_mcangle_it 2.262 4.315 ? 1296 ? 'X-RAY DIFFRACTION' r_mcangle_other 2.261 4.316 ? 1297 ? 'X-RAY DIFFRACTION' r_scbond_it 2.252 3.154 ? 1177 ? 'X-RAY DIFFRACTION' r_scbond_other 2.252 3.152 ? 1174 ? 'X-RAY DIFFRACTION' r_scangle_other 3.470 4.615 ? 1700 ? 'X-RAY DIFFRACTION' r_long_range_B_refined 5.044 23.594 ? 2698 ? 'X-RAY DIFFRACTION' r_long_range_B_other 5.028 23.438 ? 2673 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.051 _refine_ls_shell.d_res_low 2.104 _refine_ls_shell.number_reflns_R_work 1408 _refine_ls_shell.R_factor_R_work 0.232 _refine_ls_shell.percent_reflns_obs 99.34 _refine_ls_shell.R_factor_R_free 0.248 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 95 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 3WFF _struct.title 'Mineralocorticoid receptor ligand-binding domain with compound 2b' _struct.pdbx_descriptor 'Mineralocorticoid receptor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3WFF _struct_keywords.pdbx_keywords TRANSCRIPTION/INHIBITOR _struct_keywords.text ;NUCLEAR RECEPTOR, TRANSCRIPTION FACTOR, TRANSCRIPTION, HYPERTENSION, NON-STEROIDAL ANTAGONIST, ACTIVATING MUTATION, TRANSCRIPTION-INHIBITOR complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 19 ? THR A 26 ? SER A 728 THR A 735 1 ? 8 HELX_P HELX_P2 2 SER A 28 ? ILE A 36 ? SER A 737 ILE A 745 1 ? 9 HELX_P HELX_P3 3 THR A 52 ? VAL A 77 ? THR A 761 VAL A 786 1 ? 26 HELX_P HELX_P4 4 GLY A 80 ? LEU A 84 ? GLY A 789 LEU A 793 5 ? 5 HELX_P HELX_P5 5 PRO A 85 ? ASN A 114 ? PRO A 794 ASN A 823 1 ? 30 HELX_P HELX_P6 6 ASN A 127 ? SER A 134 ? ASN A 836 SER A 843 1 ? 8 HELX_P HELX_P7 7 MET A 136 ? GLN A 154 ? MET A 845 GLN A 863 1 ? 19 HELX_P HELX_P8 8 THR A 156 ? LEU A 169 ? THR A 865 LEU A 878 1 ? 14 HELX_P HELX_P9 9 SER A 179 ? CYS A 201 ? SER A 888 CYS A 910 1 ? 23 HELX_P HELX_P10 10 PRO A 202 ? GLY A 206 ? PRO A 911 GLY A 915 5 ? 5 HELX_P HELX_P11 11 GLN A 207 ? GLU A 239 ? GLN A 916 GLU A 948 1 ? 33 HELX_P HELX_P12 12 GLU A 239 ? LYS A 244 ? GLU A 948 LYS A 953 1 ? 6 HELX_P HELX_P13 13 PRO A 248 ? SER A 264 ? PRO A 957 SER A 973 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 118 ? ALA A 121 ? LEU A 827 ALA A 830 A 2 LEU A 124 ? PHE A 126 ? LEU A 833 PHE A 835 B 1 THR A 171 ? ILE A 172 ? THR A 880 ILE A 881 B 2 LYS A 268 ? PRO A 269 ? LYS A 977 PRO A 978 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 118 ? N LEU A 827 O PHE A 126 ? O PHE A 835 B 1 2 N ILE A 172 ? N ILE A 881 O LYS A 268 ? O LYS A 977 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A WFF 1001 ? 17 'BINDING SITE FOR RESIDUE WFF A 1001' AC2 Software A PO4 1002 ? 6 'BINDING SITE FOR RESIDUE PO4 A 1002' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 LEU A 60 ? LEU A 769 . ? 1_555 ? 2 AC1 17 ASN A 61 ? ASN A 770 . ? 1_555 ? 3 AC1 17 ALA A 64 ? ALA A 773 . ? 1_555 ? 4 AC1 17 MET A 98 ? MET A 807 . ? 1_555 ? 5 AC1 17 SER A 102 ? SER A 811 . ? 1_555 ? 6 AC1 17 LEU A 105 ? LEU A 814 . ? 1_555 ? 7 AC1 17 PHE A 120 ? PHE A 829 . ? 1_555 ? 8 AC1 17 MET A 136 ? MET A 845 . ? 1_555 ? 9 AC1 17 LEU A 139 ? LEU A 848 . ? 1_555 ? 10 AC1 17 MET A 143 ? MET A 852 . ? 1_555 ? 11 AC1 17 LEU A 229 ? LEU A 938 . ? 1_555 ? 12 AC1 17 PHE A 232 ? PHE A 941 . ? 1_555 ? 13 AC1 17 CYS A 233 ? CYS A 942 . ? 1_555 ? 14 AC1 17 THR A 236 ? THR A 945 . ? 1_555 ? 15 AC1 17 VAL A 245 ? VAL A 954 . ? 1_555 ? 16 AC1 17 PHE A 247 ? PHE A 956 . ? 1_555 ? 17 AC1 17 HOH D . ? HOH A 1118 . ? 1_555 ? 18 AC2 6 TYR A 137 ? TYR A 846 . ? 5_665 ? 19 AC2 6 PHE A 272 ? PHE A 981 . ? 1_555 ? 20 AC2 6 HIS A 273 ? HIS A 982 . ? 1_555 ? 21 AC2 6 ARG A 274 ? ARG A 983 . ? 1_555 ? 22 AC2 6 HOH D . ? HOH A 1149 . ? 1_555 ? 23 AC2 6 HOH D . ? HOH A 1151 . ? 1_555 ? # _database_PDB_matrix.entry_id 3WFF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3WFF _atom_sites.fract_transf_matrix[1][1] 0.019280 _atom_sites.fract_transf_matrix[1][2] 0.011132 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022263 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004851 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 710 ? ? ? A . n A 1 2 SER 2 711 ? ? ? A . n A 1 3 ALA 3 712 ? ? ? A . n A 1 4 PRO 4 713 ? ? ? A . n A 1 5 ALA 5 714 ? ? ? A . n A 1 6 LYS 6 715 ? ? ? A . n A 1 7 GLU 7 716 ? ? ? A . n A 1 8 PRO 8 717 ? ? ? A . n A 1 9 SER 9 718 ? ? ? A . n A 1 10 VAL 10 719 ? ? ? A . n A 1 11 ASN 11 720 ? ? ? A . n A 1 12 THR 12 721 ? ? ? A . n A 1 13 ALA 13 722 ? ? ? A . n A 1 14 LEU 14 723 ? ? ? A . n A 1 15 VAL 15 724 ? ? ? A . n A 1 16 PRO 16 725 ? ? ? A . n A 1 17 GLN 17 726 ? ? ? A . n A 1 18 LEU 18 727 727 LEU LEU A . n A 1 19 SER 19 728 728 SER SER A . n A 1 20 THR 20 729 729 THR THR A . n A 1 21 ILE 21 730 730 ILE ILE A . n A 1 22 SER 22 731 731 SER SER A . n A 1 23 ARG 23 732 732 ARG ARG A . n A 1 24 ALA 24 733 733 ALA ALA A . n A 1 25 LEU 25 734 734 LEU LEU A . n A 1 26 THR 26 735 735 THR THR A . n A 1 27 PRO 27 736 736 PRO PRO A . n A 1 28 SER 28 737 737 SER SER A . n A 1 29 PRO 29 738 738 PRO PRO A . n A 1 30 VAL 30 739 739 VAL VAL A . n A 1 31 MET 31 740 740 MET MET A . n A 1 32 VAL 32 741 741 VAL VAL A . n A 1 33 LEU 33 742 742 LEU LEU A . n A 1 34 GLU 34 743 743 GLU GLU A . n A 1 35 ASN 35 744 744 ASN ASN A . n A 1 36 ILE 36 745 745 ILE ILE A . n A 1 37 GLU 37 746 746 GLU GLU A . n A 1 38 PRO 38 747 747 PRO PRO A . n A 1 39 GLU 39 748 748 GLU GLU A . n A 1 40 ILE 40 749 749 ILE ILE A . n A 1 41 VAL 41 750 750 VAL VAL A . n A 1 42 TYR 42 751 751 TYR TYR A . n A 1 43 ALA 43 752 752 ALA ALA A . n A 1 44 GLY 44 753 753 GLY GLY A . n A 1 45 TYR 45 754 754 TYR TYR A . n A 1 46 ASP 46 755 755 ASP ASP A . n A 1 47 SER 47 756 756 SER SER A . n A 1 48 SER 48 757 757 SER SER A . n A 1 49 LYS 49 758 758 LYS LYS A . n A 1 50 PRO 50 759 759 PRO PRO A . n A 1 51 ASP 51 760 760 ASP ASP A . n A 1 52 THR 52 761 761 THR THR A . n A 1 53 ALA 53 762 762 ALA ALA A . n A 1 54 GLU 54 763 763 GLU GLU A . n A 1 55 ASN 55 764 764 ASN ASN A . n A 1 56 LEU 56 765 765 LEU LEU A . n A 1 57 LEU 57 766 766 LEU LEU A . n A 1 58 SER 58 767 767 SER SER A . n A 1 59 THR 59 768 768 THR THR A . n A 1 60 LEU 60 769 769 LEU LEU A . n A 1 61 ASN 61 770 770 ASN ASN A . n A 1 62 ARG 62 771 771 ARG ARG A . n A 1 63 LEU 63 772 772 LEU LEU A . n A 1 64 ALA 64 773 773 ALA ALA A . n A 1 65 GLY 65 774 774 GLY GLY A . n A 1 66 LYS 66 775 775 LYS LYS A . n A 1 67 GLN 67 776 776 GLN GLN A . n A 1 68 MET 68 777 777 MET MET A . n A 1 69 ILE 69 778 778 ILE ILE A . n A 1 70 GLN 70 779 779 GLN GLN A . n A 1 71 VAL 71 780 780 VAL VAL A . n A 1 72 VAL 72 781 781 VAL VAL A . n A 1 73 LYS 73 782 782 LYS LYS A . n A 1 74 TRP 74 783 783 TRP TRP A . n A 1 75 ALA 75 784 784 ALA ALA A . n A 1 76 LYS 76 785 785 LYS LYS A . n A 1 77 VAL 77 786 786 VAL VAL A . n A 1 78 LEU 78 787 787 LEU LEU A . n A 1 79 PRO 79 788 788 PRO PRO A . n A 1 80 GLY 80 789 789 GLY GLY A . n A 1 81 PHE 81 790 790 PHE PHE A . n A 1 82 LYS 82 791 791 LYS LYS A . n A 1 83 ASN 83 792 792 ASN ASN A . n A 1 84 LEU 84 793 793 LEU LEU A . n A 1 85 PRO 85 794 794 PRO PRO A . n A 1 86 LEU 86 795 795 LEU LEU A . n A 1 87 GLU 87 796 796 GLU GLU A . n A 1 88 ASP 88 797 797 ASP ASP A . n A 1 89 GLN 89 798 798 GLN GLN A . n A 1 90 ILE 90 799 799 ILE ILE A . n A 1 91 THR 91 800 800 THR THR A . n A 1 92 LEU 92 801 801 LEU LEU A . n A 1 93 ILE 93 802 802 ILE ILE A . n A 1 94 GLN 94 803 803 GLN GLN A . n A 1 95 TYR 95 804 804 TYR TYR A . n A 1 96 SER 96 805 805 SER SER A . n A 1 97 TRP 97 806 806 TRP TRP A . n A 1 98 MET 98 807 807 MET MET A . n A 1 99 SER 99 808 808 SER SER A . n A 1 100 LEU 100 809 809 LEU LEU A . n A 1 101 LEU 101 810 810 LEU LEU A . n A 1 102 SER 102 811 811 SER SER A . n A 1 103 PHE 103 812 812 PHE PHE A . n A 1 104 ALA 104 813 813 ALA ALA A . n A 1 105 LEU 105 814 814 LEU LEU A . n A 1 106 SER 106 815 815 SER SER A . n A 1 107 TRP 107 816 816 TRP TRP A . n A 1 108 ARG 108 817 817 ARG ARG A . n A 1 109 SER 109 818 818 SER SER A . n A 1 110 TYR 110 819 819 TYR TYR A . n A 1 111 LYS 111 820 820 LYS LYS A . n A 1 112 HIS 112 821 821 HIS HIS A . n A 1 113 THR 113 822 822 THR THR A . n A 1 114 ASN 114 823 823 ASN ASN A . n A 1 115 SER 115 824 824 SER SER A . n A 1 116 GLN 116 825 825 GLN GLN A . n A 1 117 PHE 117 826 826 PHE PHE A . n A 1 118 LEU 118 827 827 LEU LEU A . n A 1 119 TYR 119 828 828 TYR TYR A . n A 1 120 PHE 120 829 829 PHE PHE A . n A 1 121 ALA 121 830 830 ALA ALA A . n A 1 122 PRO 122 831 831 PRO PRO A . n A 1 123 ASP 123 832 832 ASP ASP A . n A 1 124 LEU 124 833 833 LEU LEU A . n A 1 125 VAL 125 834 834 VAL VAL A . n A 1 126 PHE 126 835 835 PHE PHE A . n A 1 127 ASN 127 836 836 ASN ASN A . n A 1 128 GLU 128 837 837 GLU GLU A . n A 1 129 GLU 129 838 838 GLU GLU A . n A 1 130 LYS 130 839 839 LYS LYS A . n A 1 131 MET 131 840 840 MET MET A . n A 1 132 HIS 132 841 841 HIS HIS A . n A 1 133 GLN 133 842 842 GLN GLN A . n A 1 134 SER 134 843 843 SER SER A . n A 1 135 ALA 135 844 844 ALA ALA A . n A 1 136 MET 136 845 845 MET MET A . n A 1 137 TYR 137 846 846 TYR TYR A . n A 1 138 GLU 138 847 847 GLU GLU A . n A 1 139 LEU 139 848 848 LEU LEU A . n A 1 140 CYS 140 849 849 CYS CYS A . n A 1 141 GLN 141 850 850 GLN GLN A . n A 1 142 GLY 142 851 851 GLY GLY A . n A 1 143 MET 143 852 852 MET MET A . n A 1 144 HIS 144 853 853 HIS HIS A . n A 1 145 GLN 145 854 854 GLN GLN A . n A 1 146 ILE 146 855 855 ILE ILE A . n A 1 147 SER 147 856 856 SER SER A . n A 1 148 LEU 148 857 857 LEU LEU A . n A 1 149 GLN 149 858 858 GLN GLN A . n A 1 150 PHE 150 859 859 PHE PHE A . n A 1 151 VAL 151 860 860 VAL VAL A . n A 1 152 ARG 152 861 861 ARG ARG A . n A 1 153 LEU 153 862 862 LEU LEU A . n A 1 154 GLN 154 863 863 GLN GLN A . n A 1 155 LEU 155 864 864 LEU LEU A . n A 1 156 THR 156 865 865 THR THR A . n A 1 157 PHE 157 866 866 PHE PHE A . n A 1 158 GLU 158 867 867 GLU GLU A . n A 1 159 GLU 159 868 868 GLU GLU A . n A 1 160 TYR 160 869 869 TYR TYR A . n A 1 161 THR 161 870 870 THR THR A . n A 1 162 ILE 162 871 871 ILE ILE A . n A 1 163 MET 163 872 872 MET MET A . n A 1 164 LYS 164 873 873 LYS LYS A . n A 1 165 VAL 165 874 874 VAL VAL A . n A 1 166 LEU 166 875 875 LEU LEU A . n A 1 167 LEU 167 876 876 LEU LEU A . n A 1 168 LEU 168 877 877 LEU LEU A . n A 1 169 LEU 169 878 878 LEU LEU A . n A 1 170 SER 170 879 879 SER SER A . n A 1 171 THR 171 880 880 THR THR A . n A 1 172 ILE 172 881 881 ILE ILE A . n A 1 173 PRO 173 882 882 PRO PRO A . n A 1 174 LYS 174 883 883 LYS LYS A . n A 1 175 ASP 175 884 884 ASP ASP A . n A 1 176 GLY 176 885 885 GLY GLY A . n A 1 177 LEU 177 886 886 LEU LEU A . n A 1 178 LYS 178 887 887 LYS LYS A . n A 1 179 SER 179 888 888 SER SER A . n A 1 180 GLN 180 889 889 GLN GLN A . n A 1 181 ALA 181 890 890 ALA ALA A . n A 1 182 ALA 182 891 891 ALA ALA A . n A 1 183 PHE 183 892 892 PHE PHE A . n A 1 184 GLU 184 893 893 GLU GLU A . n A 1 185 GLU 185 894 894 GLU GLU A . n A 1 186 MET 186 895 895 MET MET A . n A 1 187 ARG 187 896 896 ARG ARG A . n A 1 188 THR 188 897 897 THR THR A . n A 1 189 ASN 189 898 898 ASN ASN A . n A 1 190 TYR 190 899 899 TYR TYR A . n A 1 191 ILE 191 900 900 ILE ILE A . n A 1 192 LYS 192 901 901 LYS LYS A . n A 1 193 GLU 193 902 902 GLU GLU A . n A 1 194 LEU 194 903 903 LEU LEU A . n A 1 195 ARG 195 904 904 ARG ARG A . n A 1 196 LYS 196 905 905 LYS LYS A . n A 1 197 MET 197 906 906 MET MET A . n A 1 198 VAL 198 907 907 VAL VAL A . n A 1 199 THR 199 908 908 THR THR A . n A 1 200 LYS 200 909 909 LYS LYS A . n A 1 201 CYS 201 910 910 CYS CYS A . n A 1 202 PRO 202 911 911 PRO PRO A . n A 1 203 ASN 203 912 912 ASN ASN A . n A 1 204 ASN 204 913 913 ASN ASN A . n A 1 205 SER 205 914 914 SER SER A . n A 1 206 GLY 206 915 915 GLY GLY A . n A 1 207 GLN 207 916 916 GLN GLN A . n A 1 208 SER 208 917 917 SER SER A . n A 1 209 TRP 209 918 918 TRP TRP A . n A 1 210 GLN 210 919 919 GLN GLN A . n A 1 211 ARG 211 920 920 ARG ARG A . n A 1 212 PHE 212 921 921 PHE PHE A . n A 1 213 TYR 213 922 922 TYR TYR A . n A 1 214 GLN 214 923 923 GLN GLN A . n A 1 215 LEU 215 924 924 LEU LEU A . n A 1 216 THR 216 925 925 THR THR A . n A 1 217 LYS 217 926 926 LYS LYS A . n A 1 218 LEU 218 927 927 LEU LEU A . n A 1 219 LEU 219 928 928 LEU LEU A . n A 1 220 ASP 220 929 929 ASP ASP A . n A 1 221 SER 221 930 930 SER SER A . n A 1 222 MET 222 931 931 MET MET A . n A 1 223 HIS 223 932 932 HIS HIS A . n A 1 224 ASP 224 933 933 ASP ASP A . n A 1 225 LEU 225 934 934 LEU LEU A . n A 1 226 VAL 226 935 935 VAL VAL A . n A 1 227 SER 227 936 936 SER SER A . n A 1 228 ASP 228 937 937 ASP ASP A . n A 1 229 LEU 229 938 938 LEU LEU A . n A 1 230 LEU 230 939 939 LEU LEU A . n A 1 231 GLU 231 940 940 GLU GLU A . n A 1 232 PHE 232 941 941 PHE PHE A . n A 1 233 CYS 233 942 942 CYS CYS A . n A 1 234 PHE 234 943 943 PHE PHE A . n A 1 235 TYR 235 944 944 TYR TYR A . n A 1 236 THR 236 945 945 THR THR A . n A 1 237 PHE 237 946 946 PHE PHE A . n A 1 238 ARG 238 947 947 ARG ARG A . n A 1 239 GLU 239 948 948 GLU GLU A . n A 1 240 SER 240 949 949 SER SER A . n A 1 241 HIS 241 950 950 HIS HIS A . n A 1 242 ALA 242 951 951 ALA ALA A . n A 1 243 LEU 243 952 952 LEU LEU A . n A 1 244 LYS 244 953 953 LYS LYS A . n A 1 245 VAL 245 954 954 VAL VAL A . n A 1 246 GLU 246 955 955 GLU GLU A . n A 1 247 PHE 247 956 956 PHE PHE A . n A 1 248 PRO 248 957 957 PRO PRO A . n A 1 249 ALA 249 958 958 ALA ALA A . n A 1 250 MET 250 959 959 MET MET A . n A 1 251 LEU 251 960 960 LEU LEU A . n A 1 252 VAL 252 961 961 VAL VAL A . n A 1 253 GLU 253 962 962 GLU GLU A . n A 1 254 ILE 254 963 963 ILE ILE A . n A 1 255 ILE 255 964 964 ILE ILE A . n A 1 256 SER 256 965 965 SER SER A . n A 1 257 ASP 257 966 966 ASP ASP A . n A 1 258 GLN 258 967 967 GLN GLN A . n A 1 259 LEU 259 968 968 LEU LEU A . n A 1 260 PRO 260 969 969 PRO PRO A . n A 1 261 LYS 261 970 970 LYS LYS A . n A 1 262 VAL 262 971 971 VAL VAL A . n A 1 263 GLU 263 972 972 GLU GLU A . n A 1 264 SER 264 973 973 SER SER A . n A 1 265 GLY 265 974 974 GLY GLY A . n A 1 266 ASN 266 975 975 ASN ASN A . n A 1 267 VAL 267 976 976 VAL VAL A . n A 1 268 LYS 268 977 977 LYS LYS A . n A 1 269 PRO 269 978 978 PRO PRO A . n A 1 270 LEU 270 979 979 LEU LEU A . n A 1 271 TYR 271 980 980 TYR TYR A . n A 1 272 PHE 272 981 981 PHE PHE A . n A 1 273 HIS 273 982 982 HIS HIS A . n A 1 274 ARG 274 983 983 ARG ARG A . n A 1 275 LYS 275 984 984 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 WFF 1 1001 1 WFF LIG A . C 3 PO4 1 1002 1 PO4 PO4 A . D 4 HOH 1 1101 1 HOH HOH A . D 4 HOH 2 1102 2 HOH HOH A . D 4 HOH 3 1103 3 HOH HOH A . D 4 HOH 4 1104 4 HOH HOH A . D 4 HOH 5 1105 5 HOH HOH A . D 4 HOH 6 1106 6 HOH HOH A . D 4 HOH 7 1107 7 HOH HOH A . D 4 HOH 8 1108 8 HOH HOH A . D 4 HOH 9 1109 9 HOH HOH A . D 4 HOH 10 1110 10 HOH HOH A . D 4 HOH 11 1111 11 HOH HOH A . D 4 HOH 12 1112 12 HOH HOH A . D 4 HOH 13 1113 13 HOH HOH A . D 4 HOH 14 1114 14 HOH HOH A . D 4 HOH 15 1115 15 HOH HOH A . D 4 HOH 16 1116 16 HOH HOH A . D 4 HOH 17 1117 17 HOH HOH A . D 4 HOH 18 1118 18 HOH HOH A . D 4 HOH 19 1119 19 HOH HOH A . D 4 HOH 20 1120 20 HOH HOH A . D 4 HOH 21 1121 21 HOH HOH A . D 4 HOH 22 1122 22 HOH HOH A . D 4 HOH 23 1123 23 HOH HOH A . D 4 HOH 24 1124 24 HOH HOH A . D 4 HOH 25 1125 25 HOH HOH A . D 4 HOH 26 1126 26 HOH HOH A . D 4 HOH 27 1127 27 HOH HOH A . D 4 HOH 28 1128 28 HOH HOH A . D 4 HOH 29 1129 29 HOH HOH A . D 4 HOH 30 1130 30 HOH HOH A . D 4 HOH 31 1131 31 HOH HOH A . D 4 HOH 32 1132 32 HOH HOH A . D 4 HOH 33 1133 33 HOH HOH A . D 4 HOH 34 1134 34 HOH HOH A . D 4 HOH 35 1135 35 HOH HOH A . D 4 HOH 36 1136 36 HOH HOH A . D 4 HOH 37 1137 37 HOH HOH A . D 4 HOH 38 1138 38 HOH HOH A . D 4 HOH 39 1139 39 HOH HOH A . D 4 HOH 40 1140 40 HOH HOH A . D 4 HOH 41 1141 41 HOH HOH A . D 4 HOH 42 1142 42 HOH HOH A . D 4 HOH 43 1143 43 HOH HOH A . D 4 HOH 44 1144 44 HOH HOH A . D 4 HOH 45 1145 45 HOH HOH A . D 4 HOH 46 1146 46 HOH HOH A . D 4 HOH 47 1147 47 HOH HOH A . D 4 HOH 48 1148 48 HOH HOH A . D 4 HOH 49 1149 49 HOH HOH A . D 4 HOH 50 1150 50 HOH HOH A . D 4 HOH 51 1151 51 HOH HOH A . D 4 HOH 52 1152 52 HOH HOH A . D 4 HOH 53 1153 53 HOH HOH A . D 4 HOH 54 1154 54 HOH HOH A . D 4 HOH 55 1155 55 HOH HOH A . D 4 HOH 56 1156 56 HOH HOH A . D 4 HOH 57 1157 57 HOH HOH A . D 4 HOH 58 1158 58 HOH HOH A . D 4 HOH 59 1159 59 HOH HOH A . D 4 HOH 60 1160 60 HOH HOH A . D 4 HOH 61 1161 61 HOH HOH A . D 4 HOH 62 1162 62 HOH HOH A . D 4 HOH 63 1163 63 HOH HOH A . D 4 HOH 64 1164 64 HOH HOH A . D 4 HOH 65 1165 65 HOH HOH A . D 4 HOH 66 1166 66 HOH HOH A . D 4 HOH 67 1167 67 HOH HOH A . D 4 HOH 68 1168 68 HOH HOH A . D 4 HOH 69 1169 69 HOH HOH A . D 4 HOH 70 1170 70 HOH HOH A . D 4 HOH 71 1171 71 HOH HOH A . D 4 HOH 72 1172 72 HOH HOH A . D 4 HOH 73 1173 73 HOH HOH A . D 4 HOH 74 1174 74 HOH HOH A . D 4 HOH 75 1175 75 HOH HOH A . D 4 HOH 76 1176 76 HOH HOH A . D 4 HOH 77 1177 77 HOH HOH A . D 4 HOH 78 1178 78 HOH HOH A . D 4 HOH 79 1179 79 HOH HOH A . D 4 HOH 80 1180 80 HOH HOH A . D 4 HOH 81 1181 81 HOH HOH A . D 4 HOH 82 1182 82 HOH HOH A . D 4 HOH 83 1183 83 HOH HOH A . D 4 HOH 84 1184 84 HOH HOH A . D 4 HOH 85 1185 85 HOH HOH A . D 4 HOH 86 1186 86 HOH HOH A . D 4 HOH 87 1187 87 HOH HOH A . D 4 HOH 88 1188 88 HOH HOH A . D 4 HOH 89 1189 89 HOH HOH A . D 4 HOH 90 1190 90 HOH HOH A . D 4 HOH 91 1191 91 HOH HOH A . D 4 HOH 92 1192 92 HOH HOH A . D 4 HOH 93 1193 93 HOH HOH A . D 4 HOH 94 1194 94 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-08-21 2 'Structure model' 1 1 2019-12-25 3 'Structure model' 1 2 2020-09-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' struct_ref_seq_dif 3 3 'Structure model' struct 4 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_struct.title' 8 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 9 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 10 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 7.3587 _pdbx_refine_tls.origin_y 14.2103 _pdbx_refine_tls.origin_z 53.9447 _pdbx_refine_tls.T[1][1] 0.1428 _pdbx_refine_tls.T[2][2] 0.0788 _pdbx_refine_tls.T[3][3] 0.0069 _pdbx_refine_tls.T[1][2] -0.0658 _pdbx_refine_tls.T[1][3] 0.0075 _pdbx_refine_tls.T[2][3] 0.0106 _pdbx_refine_tls.L[1][1] 0.3260 _pdbx_refine_tls.L[2][2] 0.7796 _pdbx_refine_tls.L[3][3] 0.4465 _pdbx_refine_tls.L[1][2] 0.1302 _pdbx_refine_tls.L[1][3] -0.0646 _pdbx_refine_tls.L[2][3] -0.3042 _pdbx_refine_tls.S[1][1] -0.0951 _pdbx_refine_tls.S[1][2] 0.0545 _pdbx_refine_tls.S[1][3] 0.0048 _pdbx_refine_tls.S[2][1] -0.1182 _pdbx_refine_tls.S[2][2] 0.0929 _pdbx_refine_tls.S[2][3] -0.0179 _pdbx_refine_tls.S[3][1] 0.0233 _pdbx_refine_tls.S[3][2] 0.0243 _pdbx_refine_tls.S[3][3] 0.0022 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 735 ? ? A 984 ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 1001 ? ? A 1001 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOLREP phasing . ? 1 REFMAC refinement 5.7.0032 ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 746 ? ? O A HOH 1180 ? ? 2.07 2 1 OG A SER 737 ? ? O A HOH 1178 ? ? 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 833 ? ? -150.69 88.00 2 1 MET A 845 ? ? -142.18 54.05 3 1 SER A 888 ? ? -111.92 78.15 4 1 ASN A 912 ? ? 53.79 -142.05 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 710 ? A GLY 1 2 1 Y 1 A SER 711 ? A SER 2 3 1 Y 1 A ALA 712 ? A ALA 3 4 1 Y 1 A PRO 713 ? A PRO 4 5 1 Y 1 A ALA 714 ? A ALA 5 6 1 Y 1 A LYS 715 ? A LYS 6 7 1 Y 1 A GLU 716 ? A GLU 7 8 1 Y 1 A PRO 717 ? A PRO 8 9 1 Y 1 A SER 718 ? A SER 9 10 1 Y 1 A VAL 719 ? A VAL 10 11 1 Y 1 A ASN 720 ? A ASN 11 12 1 Y 1 A THR 721 ? A THR 12 13 1 Y 1 A ALA 722 ? A ALA 13 14 1 Y 1 A LEU 723 ? A LEU 14 15 1 Y 1 A VAL 724 ? A VAL 15 16 1 Y 1 A PRO 725 ? A PRO 16 17 1 Y 1 A GLN 726 ? A GLN 17 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '6-[4-(2,4-difluorophenyl)-5-oxo-2,5-dihydrofuran-3-yl]-2H-1,4-benzoxazin-3(4H)-one' WFF 3 'PHOSPHATE ION' PO4 4 water HOH #