data_3ZJA # _entry.id 3ZJA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3ZJA PDBE EBI-55428 WWPDB D_1290055428 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3ZJA _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2013-01-17 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Blundell, K.L.I.M.' 1 'Hough, M.' 2 'Worrall, J.A.R.' 3 # _citation.id primary _citation.title 'Structural and Mechanistic Insights Into an Extracytoplasmic Copper Trafficking Pathway in Streptomyces Lividans.' _citation.journal_abbrev Biochem.J. _citation.journal_volume 459 _citation.page_first 525 _citation.page_last ? _citation.year 2014 _citation.journal_id_ASTM BIJOAK _citation.country UK _citation.journal_id_ISSN 0264-6021 _citation.journal_id_CSD 0043 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24548299 _citation.pdbx_database_id_DOI 10.1042/BJ20140017 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Blundell, K.L.I.M.' 1 primary 'Hough, M.A.' 2 primary 'Vijgenboom, E.' 3 primary 'Worrall, J.A.R.' 4 # _cell.entry_id 3ZJA _cell.length_a 44.480 _cell.length_b 47.840 _cell.length_c 50.040 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3ZJA _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man SL3965 14667.101 1 ? ? 'RESIDUES 42-178' ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 water nat water 18.015 108 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PROTEIN SCO3965' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SHMSGADSASPGAELSVDAAYIPQPVSDSMAAGFLTITNEGDSADELTSVTSEAGEVTVHETIDGTMKEVDRIEVPAHGQ LVFKSGGNHLMFEKLKQQPKQGQSVAVELHFAHSDPVAVKLPVKAATYQPTAGHSEDSGH ; _entity_poly.pdbx_seq_one_letter_code_can ;SHMSGADSASPGAELSVDAAYIPQPVSDSMAAGFLTITNEGDSADELTSVTSEAGEVTVHETIDGTMKEVDRIEVPAHGQ LVFKSGGNHLMFEKLKQQPKQGQSVAVELHFAHSDPVAVKLPVKAATYQPTAGHSEDSGH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 HIS n 1 3 MET n 1 4 SER n 1 5 GLY n 1 6 ALA n 1 7 ASP n 1 8 SER n 1 9 ALA n 1 10 SER n 1 11 PRO n 1 12 GLY n 1 13 ALA n 1 14 GLU n 1 15 LEU n 1 16 SER n 1 17 VAL n 1 18 ASP n 1 19 ALA n 1 20 ALA n 1 21 TYR n 1 22 ILE n 1 23 PRO n 1 24 GLN n 1 25 PRO n 1 26 VAL n 1 27 SER n 1 28 ASP n 1 29 SER n 1 30 MET n 1 31 ALA n 1 32 ALA n 1 33 GLY n 1 34 PHE n 1 35 LEU n 1 36 THR n 1 37 ILE n 1 38 THR n 1 39 ASN n 1 40 GLU n 1 41 GLY n 1 42 ASP n 1 43 SER n 1 44 ALA n 1 45 ASP n 1 46 GLU n 1 47 LEU n 1 48 THR n 1 49 SER n 1 50 VAL n 1 51 THR n 1 52 SER n 1 53 GLU n 1 54 ALA n 1 55 GLY n 1 56 GLU n 1 57 VAL n 1 58 THR n 1 59 VAL n 1 60 HIS n 1 61 GLU n 1 62 THR n 1 63 ILE n 1 64 ASP n 1 65 GLY n 1 66 THR n 1 67 MET n 1 68 LYS n 1 69 GLU n 1 70 VAL n 1 71 ASP n 1 72 ARG n 1 73 ILE n 1 74 GLU n 1 75 VAL n 1 76 PRO n 1 77 ALA n 1 78 HIS n 1 79 GLY n 1 80 GLN n 1 81 LEU n 1 82 VAL n 1 83 PHE n 1 84 LYS n 1 85 SER n 1 86 GLY n 1 87 GLY n 1 88 ASN n 1 89 HIS n 1 90 LEU n 1 91 MET n 1 92 PHE n 1 93 GLU n 1 94 LYS n 1 95 LEU n 1 96 LYS n 1 97 GLN n 1 98 GLN n 1 99 PRO n 1 100 LYS n 1 101 GLN n 1 102 GLY n 1 103 GLN n 1 104 SER n 1 105 VAL n 1 106 ALA n 1 107 VAL n 1 108 GLU n 1 109 LEU n 1 110 HIS n 1 111 PHE n 1 112 ALA n 1 113 HIS n 1 114 SER n 1 115 ASP n 1 116 PRO n 1 117 VAL n 1 118 ALA n 1 119 VAL n 1 120 LYS n 1 121 LEU n 1 122 PRO n 1 123 VAL n 1 124 LYS n 1 125 ALA n 1 126 ALA n 1 127 THR n 1 128 TYR n 1 129 GLN n 1 130 PRO n 1 131 THR n 1 132 ALA n 1 133 GLY n 1 134 HIS n 1 135 SER n 1 136 GLU n 1 137 ASP n 1 138 SER n 1 139 GLY n 1 140 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'STREPTOMYCES LIVIDANS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1916 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET28A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q93J41_STRCO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q93J41 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ZJA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q93J41 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 178 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 42 _struct_ref_seq.pdbx_auth_seq_align_end 178 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3ZJA SER A 1 ? UNP Q93J41 ? ? 'expression tag' 39 1 1 3ZJA HIS A 2 ? UNP Q93J41 ? ? 'expression tag' 40 2 1 3ZJA MET A 3 ? UNP Q93J41 ? ? 'expression tag' 41 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3ZJA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.64 _exptl_crystal.density_percent_sol 25.2 _exptl_crystal.description 'CU K-EDGE SAD' # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '30% PEG-MME2000, 0.1M KSCN' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2011-07-25 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DOUBLE CRYSTAL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9163 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_wavelength 0.9163 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 3ZJA _reflns.observed_criterion_sigma_I -10.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 32.60 _reflns.d_resolution_high 1.48 _reflns.number_obs 17951 _reflns.number_all ? _reflns.percent_possible_obs 98.1 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 9.50 _reflns.B_iso_Wilson_estimate 26.6 _reflns.pdbx_redundancy 3.3 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.48 _reflns_shell.d_res_low 1.56 _reflns_shell.percent_possible_all 98.8 _reflns_shell.Rmerge_I_obs 0.48 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.20 _reflns_shell.pdbx_redundancy 3.4 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3ZJA _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 16995 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.32 _refine.ls_d_res_high 1.48 _refine.ls_percent_reflns_obs 97.50 _refine.ls_R_factor_obs 0.18741 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18544 _refine.ls_R_factor_R_free 0.22675 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 913 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.967 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.B_iso_mean 20.460 _refine.aniso_B[1][1] -0.94 _refine.aniso_B[2][2] -0.74 _refine.aniso_B[3][3] 1.68 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.078 _refine.pdbx_overall_ESU_R_Free 0.084 _refine.overall_SU_ML 0.057 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.489 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 849 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 108 _refine_hist.number_atoms_total 958 _refine_hist.d_res_high 1.48 _refine_hist.d_res_low 27.32 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.019 ? 923 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 890 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.800 1.967 ? 1268 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.802 3.000 ? 2077 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.446 5.000 ? 133 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.181 26.757 ? 37 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.377 15.000 ? 163 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 11.453 15.000 ? 1 'X-RAY DIFFRACTION' ? r_chiral_restr 0.100 0.200 ? 150 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.021 ? 1075 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 184 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.480 _refine_ls_shell.d_res_low 1.518 _refine_ls_shell.number_reflns_R_work 1236 _refine_ls_shell.R_factor_R_work 0.295 _refine_ls_shell.percent_reflns_obs 98.19 _refine_ls_shell.R_factor_R_free 0.334 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 68 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 3ZJA _struct.title 'The crystal structure of a Cu(I) metallochaperone from Streptomyces lividans' _struct.pdbx_descriptor SL3965 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ZJA _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CU . CU ? ? ? 1_555 A HIS 60 ND1 ? ? A CU 999 A HIS 98 1_555 ? ? ? ? ? ? ? 2.152 ? metalc2 metalc ? ? B CU . CU ? ? ? 1_555 A MET 67 SD ? ? A CU 999 A MET 105 1_555 ? ? ? ? ? ? ? 2.253 ? metalc3 metalc ? ? B CU . CU ? ? ? 1_555 A HIS 89 NE2 ? ? A CU 999 A HIS 127 1_555 ? ? ? ? ? ? ? 2.082 ? metalc4 metalc ? ? B CU . CU ? ? ? 1_555 A MET 91 SD ? ? A CU 999 A MET 129 1_555 ? ? ? ? ? ? ? 2.306 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 9 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? parallel AA 3 4 ? parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? parallel AB 3 4 ? parallel AB 4 5 ? anti-parallel AB 5 6 ? parallel AB 6 7 ? anti-parallel AB 7 8 ? anti-parallel AB 8 9 ? anti-parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 THR A 66 ? GLU A 69 ? THR A 104 GLU A 107 AA 2 GLU A 56 ? ILE A 63 ? GLU A 94 ILE A 101 AA 3 HIS A 89 ? GLU A 93 ? HIS A 127 GLU A 131 AA 4 ALA A 31 ? ASN A 39 ? ALA A 69 ASN A 77 AA 5 GLY A 79 ? PHE A 83 ? GLY A 117 PHE A 121 AB 1 THR A 66 ? GLU A 69 ? THR A 104 GLU A 107 AB 2 GLU A 56 ? ILE A 63 ? GLU A 94 ILE A 101 AB 3 HIS A 89 ? GLU A 93 ? HIS A 127 GLU A 131 AB 4 ALA A 31 ? ASN A 39 ? ALA A 69 ASN A 77 AB 5 LEU A 15 ? PRO A 23 ? LEU A 53 PRO A 61 AB 6 VAL A 117 ? LYS A 124 ? VAL A 155 LYS A 162 AB 7 SER A 104 ? PHE A 111 ? SER A 142 PHE A 149 AB 8 ASP A 45 ? THR A 51 ? ASP A 83 THR A 89 AB 9 ILE A 73 ? VAL A 75 ? ILE A 111 VAL A 113 AC 1 GLY A 79 ? PHE A 83 ? GLY A 117 PHE A 121 AC 2 ALA A 31 ? ASN A 39 ? ALA A 69 ASN A 77 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N LYS A 68 ? N LYS A 106 O GLU A 61 ? O GLU A 99 AA 2 3 N HIS A 60 ? N HIS A 98 O HIS A 89 ? O HIS A 127 AA 3 4 N PHE A 92 ? N PHE A 130 O ALA A 31 ? O ALA A 69 AA 4 5 N ASN A 39 ? N ASN A 77 O GLY A 79 ? O GLY A 117 AB 1 2 N LYS A 68 ? N LYS A 106 O GLU A 61 ? O GLU A 99 AB 2 3 N HIS A 60 ? N HIS A 98 O HIS A 89 ? O HIS A 127 AB 3 4 N PHE A 92 ? N PHE A 130 O ALA A 31 ? O ALA A 69 AB 4 5 N THR A 38 ? N THR A 76 O SER A 16 ? O SER A 54 AB 5 6 N ILE A 22 ? N ILE A 60 O PRO A 122 ? O PRO A 160 AB 6 7 N LEU A 121 ? N LEU A 159 O VAL A 105 ? O VAL A 143 AB 7 8 O HIS A 110 ? O HIS A 148 N THR A 48 ? N THR A 86 AB 8 9 N LEU A 47 ? N LEU A 85 O ILE A 73 ? O ILE A 111 AC 1 2 N PHE A 83 ? N PHE A 121 O LEU A 35 ? O LEU A 73 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE CU A 999' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 60 ? HIS A 98 . ? 1_555 ? 2 AC1 4 MET A 67 ? MET A 105 . ? 1_555 ? 3 AC1 4 HIS A 89 ? HIS A 127 . ? 1_555 ? 4 AC1 4 MET A 91 ? MET A 129 . ? 1_555 ? # _database_PDB_matrix.entry_id 3ZJA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3ZJA _atom_sites.fract_transf_matrix[1][1] 0.022482 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020903 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019984 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 39 ? ? ? A . n A 1 2 HIS 2 40 ? ? ? A . n A 1 3 MET 3 41 ? ? ? A . n A 1 4 SER 4 42 ? ? ? A . n A 1 5 GLY 5 43 ? ? ? A . n A 1 6 ALA 6 44 ? ? ? A . n A 1 7 ASP 7 45 ? ? ? A . n A 1 8 SER 8 46 ? ? ? A . n A 1 9 ALA 9 47 ? ? ? A . n A 1 10 SER 10 48 ? ? ? A . n A 1 11 PRO 11 49 ? ? ? A . n A 1 12 GLY 12 50 ? ? ? A . n A 1 13 ALA 13 51 51 ALA ALA A . n A 1 14 GLU 14 52 52 GLU GLU A . n A 1 15 LEU 15 53 53 LEU LEU A . n A 1 16 SER 16 54 54 SER SER A . n A 1 17 VAL 17 55 55 VAL VAL A . n A 1 18 ASP 18 56 56 ASP ASP A . n A 1 19 ALA 19 57 57 ALA ALA A . n A 1 20 ALA 20 58 58 ALA ALA A . n A 1 21 TYR 21 59 59 TYR TYR A . n A 1 22 ILE 22 60 60 ILE ILE A . n A 1 23 PRO 23 61 61 PRO PRO A . n A 1 24 GLN 24 62 62 GLN GLN A . n A 1 25 PRO 25 63 63 PRO PRO A . n A 1 26 VAL 26 64 64 VAL VAL A . n A 1 27 SER 27 65 65 SER SER A . n A 1 28 ASP 28 66 66 ASP ASP A . n A 1 29 SER 29 67 67 SER SER A . n A 1 30 MET 30 68 68 MET MET A . n A 1 31 ALA 31 69 69 ALA ALA A . n A 1 32 ALA 32 70 70 ALA ALA A . n A 1 33 GLY 33 71 71 GLY GLY A . n A 1 34 PHE 34 72 72 PHE PHE A . n A 1 35 LEU 35 73 73 LEU LEU A . n A 1 36 THR 36 74 74 THR THR A . n A 1 37 ILE 37 75 75 ILE ILE A . n A 1 38 THR 38 76 76 THR THR A . n A 1 39 ASN 39 77 77 ASN ASN A . n A 1 40 GLU 40 78 78 GLU GLU A . n A 1 41 GLY 41 79 79 GLY GLY A . n A 1 42 ASP 42 80 80 ASP ASP A . n A 1 43 SER 43 81 81 SER SER A . n A 1 44 ALA 44 82 82 ALA ALA A . n A 1 45 ASP 45 83 83 ASP ASP A . n A 1 46 GLU 46 84 84 GLU GLU A . n A 1 47 LEU 47 85 85 LEU LEU A . n A 1 48 THR 48 86 86 THR THR A . n A 1 49 SER 49 87 87 SER SER A . n A 1 50 VAL 50 88 88 VAL VAL A . n A 1 51 THR 51 89 89 THR THR A . n A 1 52 SER 52 90 90 SER SER A . n A 1 53 GLU 53 91 91 GLU GLU A . n A 1 54 ALA 54 92 92 ALA ALA A . n A 1 55 GLY 55 93 93 GLY GLY A . n A 1 56 GLU 56 94 94 GLU GLU A . n A 1 57 VAL 57 95 95 VAL VAL A . n A 1 58 THR 58 96 96 THR THR A . n A 1 59 VAL 59 97 97 VAL VAL A . n A 1 60 HIS 60 98 98 HIS HIS A . n A 1 61 GLU 61 99 99 GLU GLU A . n A 1 62 THR 62 100 100 THR THR A . n A 1 63 ILE 63 101 101 ILE ILE A . n A 1 64 ASP 64 102 102 ASP ASP A . n A 1 65 GLY 65 103 103 GLY GLY A . n A 1 66 THR 66 104 104 THR THR A . n A 1 67 MET 67 105 105 MET MET A . n A 1 68 LYS 68 106 106 LYS LYS A . n A 1 69 GLU 69 107 107 GLU GLU A . n A 1 70 VAL 70 108 108 VAL VAL A . n A 1 71 ASP 71 109 109 ASP ASP A . n A 1 72 ARG 72 110 110 ARG ARG A . n A 1 73 ILE 73 111 111 ILE ILE A . n A 1 74 GLU 74 112 112 GLU GLU A . n A 1 75 VAL 75 113 113 VAL VAL A . n A 1 76 PRO 76 114 114 PRO PRO A . n A 1 77 ALA 77 115 115 ALA ALA A . n A 1 78 HIS 78 116 116 HIS HIS A . n A 1 79 GLY 79 117 117 GLY GLY A . n A 1 80 GLN 80 118 118 GLN GLN A . n A 1 81 LEU 81 119 119 LEU LEU A . n A 1 82 VAL 82 120 120 VAL VAL A . n A 1 83 PHE 83 121 121 PHE PHE A . n A 1 84 LYS 84 122 122 LYS LYS A . n A 1 85 SER 85 123 123 SER SER A . n A 1 86 GLY 86 124 124 GLY GLY A . n A 1 87 GLY 87 125 125 GLY GLY A . n A 1 88 ASN 88 126 126 ASN ASN A . n A 1 89 HIS 89 127 127 HIS HIS A . n A 1 90 LEU 90 128 128 LEU LEU A . n A 1 91 MET 91 129 129 MET MET A . n A 1 92 PHE 92 130 130 PHE PHE A . n A 1 93 GLU 93 131 131 GLU GLU A . n A 1 94 LYS 94 132 132 LYS LYS A . n A 1 95 LEU 95 133 133 LEU LEU A . n A 1 96 LYS 96 134 134 LYS LYS A . n A 1 97 GLN 97 135 135 GLN GLN A . n A 1 98 GLN 98 136 136 GLN GLN A . n A 1 99 PRO 99 137 137 PRO PRO A . n A 1 100 LYS 100 138 138 LYS LYS A . n A 1 101 GLN 101 139 139 GLN GLN A . n A 1 102 GLY 102 140 140 GLY GLY A . n A 1 103 GLN 103 141 141 GLN GLN A . n A 1 104 SER 104 142 142 SER SER A . n A 1 105 VAL 105 143 143 VAL VAL A . n A 1 106 ALA 106 144 144 ALA ALA A . n A 1 107 VAL 107 145 145 VAL VAL A . n A 1 108 GLU 108 146 146 GLU GLU A . n A 1 109 LEU 109 147 147 LEU LEU A . n A 1 110 HIS 110 148 148 HIS HIS A . n A 1 111 PHE 111 149 149 PHE PHE A . n A 1 112 ALA 112 150 150 ALA ALA A . n A 1 113 HIS 113 151 151 HIS HIS A . n A 1 114 SER 114 152 152 SER SER A . n A 1 115 ASP 115 153 153 ASP ASP A . n A 1 116 PRO 116 154 154 PRO PRO A . n A 1 117 VAL 117 155 155 VAL VAL A . n A 1 118 ALA 118 156 156 ALA ALA A . n A 1 119 VAL 119 157 157 VAL VAL A . n A 1 120 LYS 120 158 158 LYS LYS A . n A 1 121 LEU 121 159 159 LEU LEU A . n A 1 122 PRO 122 160 160 PRO PRO A . n A 1 123 VAL 123 161 161 VAL VAL A . n A 1 124 LYS 124 162 162 LYS LYS A . n A 1 125 ALA 125 163 163 ALA ALA A . n A 1 126 ALA 126 164 164 ALA ALA A . n A 1 127 THR 127 165 ? ? ? A . n A 1 128 TYR 128 166 ? ? ? A . n A 1 129 GLN 129 167 ? ? ? A . n A 1 130 PRO 130 168 ? ? ? A . n A 1 131 THR 131 169 ? ? ? A . n A 1 132 ALA 132 170 ? ? ? A . n A 1 133 GLY 133 171 ? ? ? A . n A 1 134 HIS 134 172 ? ? ? A . n A 1 135 SER 135 173 ? ? ? A . n A 1 136 GLU 136 174 ? ? ? A . n A 1 137 ASP 137 175 ? ? ? A . n A 1 138 SER 138 176 ? ? ? A . n A 1 139 GLY 139 177 ? ? ? A . n A 1 140 HIS 140 178 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 999 999 CU CU A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . C 3 HOH 47 2047 2047 HOH HOH A . C 3 HOH 48 2048 2048 HOH HOH A . C 3 HOH 49 2049 2049 HOH HOH A . C 3 HOH 50 2050 2050 HOH HOH A . C 3 HOH 51 2051 2051 HOH HOH A . C 3 HOH 52 2052 2052 HOH HOH A . C 3 HOH 53 2053 2053 HOH HOH A . C 3 HOH 54 2054 2054 HOH HOH A . C 3 HOH 55 2055 2055 HOH HOH A . C 3 HOH 56 2056 2056 HOH HOH A . C 3 HOH 57 2057 2057 HOH HOH A . C 3 HOH 58 2058 2058 HOH HOH A . C 3 HOH 59 2059 2059 HOH HOH A . C 3 HOH 60 2060 2060 HOH HOH A . C 3 HOH 61 2061 2061 HOH HOH A . C 3 HOH 62 2062 2062 HOH HOH A . C 3 HOH 63 2063 2063 HOH HOH A . C 3 HOH 64 2064 2064 HOH HOH A . C 3 HOH 65 2065 2065 HOH HOH A . C 3 HOH 66 2066 2066 HOH HOH A . C 3 HOH 67 2067 2067 HOH HOH A . C 3 HOH 68 2068 2068 HOH HOH A . C 3 HOH 69 2069 2069 HOH HOH A . C 3 HOH 70 2070 2070 HOH HOH A . C 3 HOH 71 2071 2071 HOH HOH A . C 3 HOH 72 2072 2072 HOH HOH A . C 3 HOH 73 2073 2073 HOH HOH A . C 3 HOH 74 2074 2074 HOH HOH A . C 3 HOH 75 2075 2075 HOH HOH A . C 3 HOH 76 2076 2076 HOH HOH A . C 3 HOH 77 2077 2077 HOH HOH A . C 3 HOH 78 2078 2078 HOH HOH A . C 3 HOH 79 2079 2079 HOH HOH A . C 3 HOH 80 2080 2080 HOH HOH A . C 3 HOH 81 2081 2081 HOH HOH A . C 3 HOH 82 2082 2082 HOH HOH A . C 3 HOH 83 2083 2083 HOH HOH A . C 3 HOH 84 2084 2084 HOH HOH A . C 3 HOH 85 2085 2085 HOH HOH A . C 3 HOH 86 2086 2086 HOH HOH A . C 3 HOH 87 2087 2087 HOH HOH A . C 3 HOH 88 2088 2088 HOH HOH A . C 3 HOH 89 2089 2089 HOH HOH A . C 3 HOH 90 2090 2090 HOH HOH A . C 3 HOH 91 2091 2091 HOH HOH A . C 3 HOH 92 2092 2092 HOH HOH A . C 3 HOH 93 2093 2093 HOH HOH A . C 3 HOH 94 2094 2094 HOH HOH A . C 3 HOH 95 2095 2095 HOH HOH A . C 3 HOH 96 2096 2096 HOH HOH A . C 3 HOH 97 2097 2097 HOH HOH A . C 3 HOH 98 2098 2098 HOH HOH A . C 3 HOH 99 2099 2099 HOH HOH A . C 3 HOH 100 2100 2100 HOH HOH A . C 3 HOH 101 2101 2101 HOH HOH A . C 3 HOH 102 2102 2102 HOH HOH A . C 3 HOH 103 2103 2103 HOH HOH A . C 3 HOH 104 2104 2104 HOH HOH A . C 3 HOH 105 2105 2105 HOH HOH A . C 3 HOH 106 2106 2106 HOH HOH A . C 3 HOH 107 2107 2107 HOH HOH A . C 3 HOH 108 2108 2108 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 60 ? A HIS 98 ? 1_555 CU ? B CU . ? A CU 999 ? 1_555 SD ? A MET 67 ? A MET 105 ? 1_555 113.6 ? 2 ND1 ? A HIS 60 ? A HIS 98 ? 1_555 CU ? B CU . ? A CU 999 ? 1_555 NE2 ? A HIS 89 ? A HIS 127 ? 1_555 108.3 ? 3 SD ? A MET 67 ? A MET 105 ? 1_555 CU ? B CU . ? A CU 999 ? 1_555 NE2 ? A HIS 89 ? A HIS 127 ? 1_555 109.9 ? 4 ND1 ? A HIS 60 ? A HIS 98 ? 1_555 CU ? B CU . ? A CU 999 ? 1_555 SD ? A MET 91 ? A MET 129 ? 1_555 109.9 ? 5 SD ? A MET 67 ? A MET 105 ? 1_555 CU ? B CU . ? A CU 999 ? 1_555 SD ? A MET 91 ? A MET 129 ? 1_555 115.3 ? 6 NE2 ? A HIS 89 ? A HIS 127 ? 1_555 CU ? B CU . ? A CU 999 ? 1_555 SD ? A MET 91 ? A MET 129 ? 1_555 98.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-01-29 2 'Structure model' 1 1 2014-03-05 3 'Structure model' 1 2 2014-04-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Refinement description' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.7.0029 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 PHENIX phasing . ? 4 # _pdbx_entry_details.entry_id 3ZJA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;FULL-LENGTH SEQUENCE IS 178 AMINO-ACIDS. N-TERMINAL TRANSMEMBRANE HELIX REMOVED, AND CONSTRUCT CRYSTALLISED BEGINS AT SER-42 ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 84 ? ? NH1 A ARG 110 ? ? 2.09 2 1 N A ARG 110 ? ? O A HOH 2074 ? ? 2.13 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 102 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLN _pdbx_validate_symm_contact.auth_seq_id_2 135 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_554 _pdbx_validate_symm_contact.dist 1.77 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLN _pdbx_validate_rmsd_bond.auth_seq_id_1 135 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLN _pdbx_validate_rmsd_bond.auth_seq_id_2 135 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.481 _pdbx_validate_rmsd_bond.bond_target_value 1.235 _pdbx_validate_rmsd_bond.bond_deviation 0.246 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.022 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 OE1 A GLN 135 ? ? CD A GLN 135 ? ? NE2 A GLN 135 ? ? 105.30 121.90 -16.60 2.30 N 2 1 CG A GLN 135 ? ? CD A GLN 135 ? ? OE1 A GLN 135 ? ? 93.61 121.60 -27.99 2.00 N 3 1 CG A GLN 135 ? ? CD A GLN 135 ? ? NE2 A GLN 135 ? ? 95.36 116.70 -21.34 2.40 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 110 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -153.36 _pdbx_validate_torsion.psi 57.38 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLN _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 135 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.298 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ASP 109 ? CG ? A ASP 71 CG 2 1 Y 0 A ASP 109 ? OD1 ? A ASP 71 OD1 3 1 Y 0 A ASP 109 ? OD2 ? A ASP 71 OD2 4 1 Y 0 A LYS 122 ? CE ? A LYS 84 CE 5 1 Y 0 A LYS 122 ? NZ ? A LYS 84 NZ 6 1 Y 0 A GLN 135 ? OE1 ? A GLN 97 OE1 7 1 Y 0 A GLN 135 ? NE2 ? A GLN 97 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 39 ? A SER 1 2 1 Y 1 A HIS 40 ? A HIS 2 3 1 Y 1 A MET 41 ? A MET 3 4 1 Y 1 A SER 42 ? A SER 4 5 1 Y 1 A GLY 43 ? A GLY 5 6 1 Y 1 A ALA 44 ? A ALA 6 7 1 Y 1 A ASP 45 ? A ASP 7 8 1 Y 1 A SER 46 ? A SER 8 9 1 Y 1 A ALA 47 ? A ALA 9 10 1 Y 1 A SER 48 ? A SER 10 11 1 Y 1 A PRO 49 ? A PRO 11 12 1 Y 1 A GLY 50 ? A GLY 12 13 1 Y 1 A THR 165 ? A THR 127 14 1 Y 1 A TYR 166 ? A TYR 128 15 1 Y 1 A GLN 167 ? A GLN 129 16 1 Y 1 A PRO 168 ? A PRO 130 17 1 Y 1 A THR 169 ? A THR 131 18 1 Y 1 A ALA 170 ? A ALA 132 19 1 Y 1 A GLY 171 ? A GLY 133 20 1 Y 1 A HIS 172 ? A HIS 134 21 1 Y 1 A SER 173 ? A SER 135 22 1 Y 1 A GLU 174 ? A GLU 136 23 1 Y 1 A ASP 175 ? A ASP 137 24 1 Y 1 A SER 176 ? A SER 138 25 1 Y 1 A GLY 177 ? A GLY 139 26 1 Y 1 A HIS 178 ? A HIS 140 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 water HOH #