data_3ZLO # _entry.id 3ZLO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.294 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3ZLO PDBE EBI-55716 WWPDB D_1290055716 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 3ZK6 unspecified 'CRYSTAL STRUCTURE OF BCL-XL IN COMPLEX WITH INHIBITOR (COMPOUND 2).' PDB 3ZLN unspecified 'CRYSTAL STRUCTURE OF BCL-XL IN COMPLEX WITH INHIBITOR (COMPOUND 3).' PDB 3ZLR unspecified 'CRYSTAL STRUCTURE OF BCL-XL IN COMPLEX WITH INHIBITOR (WEHI-539).' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3ZLO _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2013-02-04 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Czabotar, P.E.' 1 ? 'Lessene, G.L.' 2 ? 'Smith, B.J.' 3 ? 'Colman, P.M.' 4 ? # _citation.id primary _citation.title 'Structure-Guided Design of a Selective Bcl-Xl Inhibitor' _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_volume 9 _citation.page_first 390 _citation.page_last 397 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1552-4450 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23603658 _citation.pdbx_database_id_DOI 10.1038/NCHEMBIO.1246 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lessene, G.L.' 1 primary 'Czabotar, P.E.' 2 primary 'Sleebs, B.E.' 3 primary 'Zobel, K.' 4 primary 'Lowes, K.L.' 5 primary 'Adams, J.M.' 6 primary 'Baell, J.B.' 7 primary 'Colman, P.M.' 8 primary 'Deshayes, K.' 9 primary 'Fairbrother, W.J.' 10 primary 'Flygare, J.A.' 11 primary 'Gibbons, P.' 12 primary 'Kersten, W.J.A.' 13 primary 'Kulasegaram, S.' 14 primary 'Moss, R.M.' 15 primary 'Parisot, J.P.' 16 primary 'Smith, B.J.' 17 primary 'Street, I.P.' 18 primary 'Yang, H.' 19 primary 'Huang, D.C.S.' 20 primary 'Watson, K.G.' 21 # _cell.entry_id 3ZLO _cell.length_a 67.832 _cell.length_b 67.832 _cell.length_c 67.383 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3ZLO _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'BCL-2-LIKE PROTEIN 1' 20804.918 1 ? ? 'RESIDUES 1-44 AND 85-209' ? 2 non-polymer syn '2-[(8E)-8-(1,3-benzothiazol-2-ylhydrazinylidene)-6,7-dihydro-5H-naphthalen-2-yl]-5-(4-phenylbutyl)-1,3-thiazole-4-carboxylic acid' 552.710 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BCL2-L-1, APOPTOSIS REGULATOR BCL-X, BCL-XL' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSMAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITP GTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG NNAAAESRKGQERLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSMAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITP GTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG NNAAAESRKGQERLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 MET n 1 4 ALA n 1 5 MET n 1 6 SER n 1 7 GLN n 1 8 SER n 1 9 ASN n 1 10 ARG n 1 11 GLU n 1 12 LEU n 1 13 VAL n 1 14 VAL n 1 15 ASP n 1 16 PHE n 1 17 LEU n 1 18 SER n 1 19 TYR n 1 20 LYS n 1 21 LEU n 1 22 SER n 1 23 GLN n 1 24 LYS n 1 25 GLY n 1 26 TYR n 1 27 SER n 1 28 TRP n 1 29 SER n 1 30 GLN n 1 31 PHE n 1 32 SER n 1 33 ASP n 1 34 VAL n 1 35 GLU n 1 36 GLU n 1 37 ASN n 1 38 ARG n 1 39 THR n 1 40 GLU n 1 41 ALA n 1 42 PRO n 1 43 GLU n 1 44 GLY n 1 45 THR n 1 46 GLU n 1 47 SER n 1 48 GLU n 1 49 ALA n 1 50 VAL n 1 51 LYS n 1 52 GLN n 1 53 ALA n 1 54 LEU n 1 55 ARG n 1 56 GLU n 1 57 ALA n 1 58 GLY n 1 59 ASP n 1 60 GLU n 1 61 PHE n 1 62 GLU n 1 63 LEU n 1 64 ARG n 1 65 TYR n 1 66 ARG n 1 67 ARG n 1 68 ALA n 1 69 PHE n 1 70 SER n 1 71 ASP n 1 72 LEU n 1 73 THR n 1 74 SER n 1 75 GLN n 1 76 LEU n 1 77 HIS n 1 78 ILE n 1 79 THR n 1 80 PRO n 1 81 GLY n 1 82 THR n 1 83 ALA n 1 84 TYR n 1 85 GLN n 1 86 SER n 1 87 PHE n 1 88 GLU n 1 89 GLN n 1 90 VAL n 1 91 VAL n 1 92 ASN n 1 93 GLU n 1 94 LEU n 1 95 PHE n 1 96 ARG n 1 97 ASP n 1 98 GLY n 1 99 VAL n 1 100 ASN n 1 101 TRP n 1 102 GLY n 1 103 ARG n 1 104 ILE n 1 105 VAL n 1 106 ALA n 1 107 PHE n 1 108 PHE n 1 109 SER n 1 110 PHE n 1 111 GLY n 1 112 GLY n 1 113 ALA n 1 114 LEU n 1 115 CYS n 1 116 VAL n 1 117 GLU n 1 118 SER n 1 119 VAL n 1 120 ASP n 1 121 LYS n 1 122 GLU n 1 123 MET n 1 124 GLN n 1 125 VAL n 1 126 LEU n 1 127 VAL n 1 128 SER n 1 129 ARG n 1 130 ILE n 1 131 ALA n 1 132 ALA n 1 133 TRP n 1 134 MET n 1 135 ALA n 1 136 THR n 1 137 TYR n 1 138 LEU n 1 139 ASN n 1 140 ASP n 1 141 HIS n 1 142 LEU n 1 143 GLU n 1 144 PRO n 1 145 TRP n 1 146 ILE n 1 147 GLN n 1 148 GLU n 1 149 ASN n 1 150 GLY n 1 151 GLY n 1 152 TRP n 1 153 ASP n 1 154 THR n 1 155 PHE n 1 156 VAL n 1 157 GLU n 1 158 LEU n 1 159 TYR n 1 160 GLY n 1 161 ASN n 1 162 ASN n 1 163 ALA n 1 164 ALA n 1 165 ALA n 1 166 GLU n 1 167 SER n 1 168 ARG n 1 169 LYS n 1 170 GLY n 1 171 GLN n 1 172 GLU n 1 173 ARG n 1 174 LEU n 1 175 GLU n 1 176 HIS n 1 177 HIS n 1 178 HIS n 1 179 HIS n 1 180 HIS n 1 181 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PGEX-6P3 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2CL1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q07817 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3ZLO A 5 ? 48 ? Q07817 1 ? 44 ? 1 44 2 1 3ZLO A 49 ? 173 ? Q07817 85 ? 209 ? 85 209 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3ZLO MET A 1 ? UNP Q07817 ? ? 'expression tag' -3 1 1 3ZLO SER A 2 ? UNP Q07817 ? ? 'expression tag' -2 2 1 3ZLO MET A 3 ? UNP Q07817 ? ? 'expression tag' -1 3 1 3ZLO ALA A 4 ? UNP Q07817 ? ? 'expression tag' 0 4 1 3ZLO LEU A 174 ? UNP Q07817 ? ? 'expression tag' 210 5 1 3ZLO GLU A 175 ? UNP Q07817 ? ? 'expression tag' 211 6 1 3ZLO HIS A 176 ? UNP Q07817 ? ? 'expression tag' 212 7 1 3ZLO HIS A 177 ? UNP Q07817 ? ? 'expression tag' 213 8 1 3ZLO HIS A 178 ? UNP Q07817 ? ? 'expression tag' 214 9 1 3ZLO HIS A 179 ? UNP Q07817 ? ? 'expression tag' 215 10 1 3ZLO HIS A 180 ? UNP Q07817 ? ? 'expression tag' 216 11 1 3ZLO HIS A 181 ? UNP Q07817 ? ? 'expression tag' 217 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 X8U non-polymer . '2-[(8E)-8-(1,3-benzothiazol-2-ylhydrazinylidene)-6,7-dihydro-5H-naphthalen-2-yl]-5-(4-phenylbutyl)-1,3-thiazole-4-carboxylic acid' ? 'C31 H28 N4 O2 S2' 552.710 # _exptl.entry_id 3ZLO _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_percent_sol 47.76 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '2 M (NH4)2SO4, 0.5 M GUANADINE HCL, 0.1 M MES PH 6.0' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS-IV' _diffrn_detector.pdbx_collection_date 2007-09-03 _diffrn_detector.details 'MEECO CAPILLARY' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU MICROMAX' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 3ZLO _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 2.60 _reflns.number_obs 5766 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 0.00 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.4 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 99.1 _reflns_shell.Rmerge_I_obs 0.55 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.50 _reflns_shell.pdbx_redundancy 3.5 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3ZLO _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 5766 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.916 _refine.ls_d_res_high 2.601 _refine.ls_percent_reflns_obs 99.88 _refine.ls_R_factor_obs 0.1972 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1932 _refine.ls_R_factor_R_free 0.2822 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 265 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 3ZK6 CHAIN A' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.40 _refine.pdbx_overall_phase_error 31.36 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1142 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1187 _refine_hist.d_res_high 2.601 _refine_hist.d_res_low 33.916 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 1213 'X-RAY DIFFRACTION' ? f_angle_d 1.188 ? ? 1644 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 13.438 ? ? 425 'X-RAY DIFFRACTION' ? f_chiral_restr 0.069 ? ? 167 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 211 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.6011 3.2767 2678 0.2517 100.00 0.3517 . . 137 . . . . 'X-RAY DIFFRACTION' . 3.2767 33.9189 2823 0.1785 100.00 0.2630 . . 128 . . . . # _struct.entry_id 3ZLO _struct.title 'Crystal structure of BCL-XL in complex with inhibitor (Compound 6)' _struct.pdbx_descriptor 'BCL-2-LIKE PROTEIN 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ZLO _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'APOPTOSIS, INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? LYS A 24 ? SER A 2 LYS A 20 1 ? 19 HELX_P HELX_P2 2 GLU A 46 ? TYR A 65 ? GLU A 42 TYR A 101 1 ? 20 HELX_P HELX_P3 3 ARG A 66 ? PHE A 69 ? ARG A 102 PHE A 105 5 ? 4 HELX_P HELX_P4 4 ASP A 71 ? LEU A 76 ? ASP A 107 LEU A 112 1 ? 6 HELX_P HELX_P5 5 ALA A 83 ? PHE A 95 ? ALA A 119 PHE A 131 1 ? 13 HELX_P HELX_P6 6 ASN A 100 ? LYS A 121 ? ASN A 136 LYS A 157 1 ? 22 HELX_P HELX_P7 7 VAL A 125 ? LEU A 142 ? VAL A 161 LEU A 178 1 ? 18 HELX_P HELX_P8 8 LEU A 142 ? ASN A 149 ? LEU A 178 ASN A 185 1 ? 8 HELX_P HELX_P9 9 GLY A 150 ? GLY A 160 ? GLY A 186 GLY A 196 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'BINDING SITE FOR RESIDUE X8U A 1198' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 ALA A 57 ? ALA A 93 . ? 1_555 ? 2 AC1 16 PHE A 61 ? PHE A 97 . ? 1_555 ? 3 AC1 16 TYR A 65 ? TYR A 101 . ? 1_555 ? 4 AC1 16 PHE A 69 ? PHE A 105 . ? 1_555 ? 5 AC1 16 SER A 70 ? SER A 106 . ? 1_555 ? 6 AC1 16 ASP A 71 ? ASP A 107 . ? 1_555 ? 7 AC1 16 LEU A 72 ? LEU A 108 . ? 1_555 ? 8 AC1 16 GLU A 93 ? GLU A 129 . ? 1_555 ? 9 AC1 16 LEU A 94 ? LEU A 130 . ? 1_555 ? 10 AC1 16 ASN A 100 ? ASN A 136 . ? 1_555 ? 11 AC1 16 GLY A 102 ? GLY A 138 . ? 1_555 ? 12 AC1 16 ARG A 103 ? ARG A 139 . ? 1_555 ? 13 AC1 16 SER A 109 ? SER A 145 . ? 1_555 ? 14 AC1 16 PHE A 110 ? PHE A 146 . ? 1_555 ? 15 AC1 16 GLN A 124 ? GLN A 160 . ? 5_445 ? 16 AC1 16 TYR A 159 ? TYR A 195 . ? 1_555 ? # _database_PDB_matrix.entry_id 3ZLO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3ZLO _atom_sites.fract_transf_matrix[1][1] 0.014742 _atom_sites.fract_transf_matrix[1][2] 0.008511 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017023 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014841 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -3 ? ? ? A . n A 1 2 SER 2 -2 ? ? ? A . n A 1 3 MET 3 -1 ? ? ? A . n A 1 4 ALA 4 0 ? ? ? A . n A 1 5 MET 5 1 ? ? ? A . n A 1 6 SER 6 2 2 SER SER A . n A 1 7 GLN 7 3 3 GLN GLN A . n A 1 8 SER 8 4 4 SER SER A . n A 1 9 ASN 9 5 5 ASN ASN A . n A 1 10 ARG 10 6 6 ARG ARG A . n A 1 11 GLU 11 7 7 GLU GLU A . n A 1 12 LEU 12 8 8 LEU LEU A . n A 1 13 VAL 13 9 9 VAL VAL A . n A 1 14 VAL 14 10 10 VAL VAL A . n A 1 15 ASP 15 11 11 ASP ASP A . n A 1 16 PHE 16 12 12 PHE PHE A . n A 1 17 LEU 17 13 13 LEU LEU A . n A 1 18 SER 18 14 14 SER SER A . n A 1 19 TYR 19 15 15 TYR TYR A . n A 1 20 LYS 20 16 16 LYS LYS A . n A 1 21 LEU 21 17 17 LEU LEU A . n A 1 22 SER 22 18 18 SER SER A . n A 1 23 GLN 23 19 19 GLN GLN A . n A 1 24 LYS 24 20 20 LYS LYS A . n A 1 25 GLY 25 21 21 GLY GLY A . n A 1 26 TYR 26 22 22 TYR TYR A . n A 1 27 SER 27 23 23 SER SER A . n A 1 28 TRP 28 24 24 TRP TRP A . n A 1 29 SER 29 25 25 SER SER A . n A 1 30 GLN 30 26 26 GLN GLN A . n A 1 31 PHE 31 27 ? ? ? A . n A 1 32 SER 32 28 ? ? ? A . n A 1 33 ASP 33 29 ? ? ? A . n A 1 34 VAL 34 30 ? ? ? A . n A 1 35 GLU 35 31 ? ? ? A . n A 1 36 GLU 36 32 ? ? ? A . n A 1 37 ASN 37 33 ? ? ? A . n A 1 38 ARG 38 34 ? ? ? A . n A 1 39 THR 39 35 ? ? ? A . n A 1 40 GLU 40 36 ? ? ? A . n A 1 41 ALA 41 37 ? ? ? A . n A 1 42 PRO 42 38 ? ? ? A . n A 1 43 GLU 43 39 ? ? ? A . n A 1 44 GLY 44 40 ? ? ? A . n A 1 45 THR 45 41 41 THR THR A . n A 1 46 GLU 46 42 42 GLU GLU A . n A 1 47 SER 47 43 43 SER SER A . n A 1 48 GLU 48 44 44 GLU GLU A . n A 1 49 ALA 49 85 85 ALA ALA A . n A 1 50 VAL 50 86 86 VAL VAL A . n A 1 51 LYS 51 87 87 LYS LYS A . n A 1 52 GLN 52 88 88 GLN GLN A . n A 1 53 ALA 53 89 89 ALA ALA A . n A 1 54 LEU 54 90 90 LEU LEU A . n A 1 55 ARG 55 91 91 ARG ARG A . n A 1 56 GLU 56 92 92 GLU GLU A . n A 1 57 ALA 57 93 93 ALA ALA A . n A 1 58 GLY 58 94 94 GLY GLY A . n A 1 59 ASP 59 95 95 ASP ASP A . n A 1 60 GLU 60 96 96 GLU GLU A . n A 1 61 PHE 61 97 97 PHE PHE A . n A 1 62 GLU 62 98 98 GLU GLU A . n A 1 63 LEU 63 99 99 LEU LEU A . n A 1 64 ARG 64 100 100 ARG ARG A . n A 1 65 TYR 65 101 101 TYR TYR A . n A 1 66 ARG 66 102 102 ARG ARG A . n A 1 67 ARG 67 103 103 ARG ARG A . n A 1 68 ALA 68 104 104 ALA ALA A . n A 1 69 PHE 69 105 105 PHE PHE A . n A 1 70 SER 70 106 106 SER SER A . n A 1 71 ASP 71 107 107 ASP ASP A . n A 1 72 LEU 72 108 108 LEU LEU A . n A 1 73 THR 73 109 109 THR THR A . n A 1 74 SER 74 110 110 SER SER A . n A 1 75 GLN 75 111 111 GLN GLN A . n A 1 76 LEU 76 112 112 LEU LEU A . n A 1 77 HIS 77 113 113 HIS HIS A . n A 1 78 ILE 78 114 114 ILE ILE A . n A 1 79 THR 79 115 115 THR THR A . n A 1 80 PRO 80 116 116 PRO PRO A . n A 1 81 GLY 81 117 117 GLY GLY A . n A 1 82 THR 82 118 118 THR THR A . n A 1 83 ALA 83 119 119 ALA ALA A . n A 1 84 TYR 84 120 120 TYR TYR A . n A 1 85 GLN 85 121 121 GLN GLN A . n A 1 86 SER 86 122 122 SER SER A . n A 1 87 PHE 87 123 123 PHE PHE A . n A 1 88 GLU 88 124 124 GLU GLU A . n A 1 89 GLN 89 125 125 GLN GLN A . n A 1 90 VAL 90 126 126 VAL VAL A . n A 1 91 VAL 91 127 127 VAL VAL A . n A 1 92 ASN 92 128 128 ASN ASN A . n A 1 93 GLU 93 129 129 GLU GLU A . n A 1 94 LEU 94 130 130 LEU LEU A . n A 1 95 PHE 95 131 131 PHE PHE A . n A 1 96 ARG 96 132 132 ARG ARG A . n A 1 97 ASP 97 133 133 ASP ASP A . n A 1 98 GLY 98 134 134 GLY GLY A . n A 1 99 VAL 99 135 135 VAL VAL A . n A 1 100 ASN 100 136 136 ASN ASN A . n A 1 101 TRP 101 137 137 TRP TRP A . n A 1 102 GLY 102 138 138 GLY GLY A . n A 1 103 ARG 103 139 139 ARG ARG A . n A 1 104 ILE 104 140 140 ILE ILE A . n A 1 105 VAL 105 141 141 VAL VAL A . n A 1 106 ALA 106 142 142 ALA ALA A . n A 1 107 PHE 107 143 143 PHE PHE A . n A 1 108 PHE 108 144 144 PHE PHE A . n A 1 109 SER 109 145 145 SER SER A . n A 1 110 PHE 110 146 146 PHE PHE A . n A 1 111 GLY 111 147 147 GLY GLY A . n A 1 112 GLY 112 148 148 GLY GLY A . n A 1 113 ALA 113 149 149 ALA ALA A . n A 1 114 LEU 114 150 150 LEU LEU A . n A 1 115 CYS 115 151 151 CYS CYS A . n A 1 116 VAL 116 152 152 VAL VAL A . n A 1 117 GLU 117 153 153 GLU GLU A . n A 1 118 SER 118 154 154 SER SER A . n A 1 119 VAL 119 155 155 VAL VAL A . n A 1 120 ASP 120 156 156 ASP ASP A . n A 1 121 LYS 121 157 157 LYS LYS A . n A 1 122 GLU 122 158 158 GLU GLU A . n A 1 123 MET 123 159 159 MET MET A . n A 1 124 GLN 124 160 160 GLN GLN A . n A 1 125 VAL 125 161 161 VAL VAL A . n A 1 126 LEU 126 162 162 LEU LEU A . n A 1 127 VAL 127 163 163 VAL VAL A . n A 1 128 SER 128 164 164 SER SER A . n A 1 129 ARG 129 165 165 ARG ARG A . n A 1 130 ILE 130 166 166 ILE ILE A . n A 1 131 ALA 131 167 167 ALA ALA A . n A 1 132 ALA 132 168 168 ALA ALA A . n A 1 133 TRP 133 169 169 TRP TRP A . n A 1 134 MET 134 170 170 MET MET A . n A 1 135 ALA 135 171 171 ALA ALA A . n A 1 136 THR 136 172 172 THR THR A . n A 1 137 TYR 137 173 173 TYR TYR A . n A 1 138 LEU 138 174 174 LEU LEU A . n A 1 139 ASN 139 175 175 ASN ASN A . n A 1 140 ASP 140 176 176 ASP ASP A . n A 1 141 HIS 141 177 177 HIS HIS A . n A 1 142 LEU 142 178 178 LEU LEU A . n A 1 143 GLU 143 179 179 GLU GLU A . n A 1 144 PRO 144 180 180 PRO PRO A . n A 1 145 TRP 145 181 181 TRP TRP A . n A 1 146 ILE 146 182 182 ILE ILE A . n A 1 147 GLN 147 183 183 GLN GLN A . n A 1 148 GLU 148 184 184 GLU GLU A . n A 1 149 ASN 149 185 185 ASN ASN A . n A 1 150 GLY 150 186 186 GLY GLY A . n A 1 151 GLY 151 187 187 GLY GLY A . n A 1 152 TRP 152 188 188 TRP TRP A . n A 1 153 ASP 153 189 189 ASP ASP A . n A 1 154 THR 154 190 190 THR THR A . n A 1 155 PHE 155 191 191 PHE PHE A . n A 1 156 VAL 156 192 192 VAL VAL A . n A 1 157 GLU 157 193 193 GLU GLU A . n A 1 158 LEU 158 194 194 LEU LEU A . n A 1 159 TYR 159 195 195 TYR TYR A . n A 1 160 GLY 160 196 196 GLY GLY A . n A 1 161 ASN 161 197 197 ASN ASN A . n A 1 162 ASN 162 198 ? ? ? A . n A 1 163 ALA 163 199 ? ? ? A . n A 1 164 ALA 164 200 ? ? ? A . n A 1 165 ALA 165 201 ? ? ? A . n A 1 166 GLU 166 202 ? ? ? A . n A 1 167 SER 167 203 ? ? ? A . n A 1 168 ARG 168 204 ? ? ? A . n A 1 169 LYS 169 205 ? ? ? A . n A 1 170 GLY 170 206 ? ? ? A . n A 1 171 GLN 171 207 ? ? ? A . n A 1 172 GLU 172 208 ? ? ? A . n A 1 173 ARG 173 209 ? ? ? A . n A 1 174 LEU 174 210 ? ? ? A . n A 1 175 GLU 175 211 ? ? ? A . n A 1 176 HIS 176 212 ? ? ? A . n A 1 177 HIS 177 213 ? ? ? A . n A 1 178 HIS 178 214 ? ? ? A . n A 1 179 HIS 179 215 ? ? ? A . n A 1 180 HIS 180 216 ? ? ? A . n A 1 181 HIS 181 217 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 X8U 1 1198 1198 X8U X8U A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-04-24 2 'Structure model' 1 1 2013-05-08 3 'Structure model' 1 2 2013-06-05 4 'Structure model' 1 3 2018-06-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' struct # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.page_last' 2 4 'Structure model' '_struct.title' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 24.3098 -17.9980 10.2882 0.5798 0.6867 0.8034 -0.2062 0.1348 0.0488 4.5959 7.1377 8.2921 -1.8656 0.4301 2.4998 0.4600 0.4506 0.5760 -0.4690 -0.0115 -0.3450 -2.8294 1.1550 -0.5120 'X-RAY DIFFRACTION' 2 ? refined 30.0062 -17.9848 17.8025 0.6871 1.3133 0.7828 -0.3736 -0.0926 -0.2868 2.9739 2.5578 4.0768 -2.2725 -3.2247 1.7197 -0.2396 -0.7391 1.1532 0.5114 0.1119 0.1042 0.4822 1.9492 0.0583 'X-RAY DIFFRACTION' 3 ? refined 14.4693 -19.3449 14.0264 0.6614 0.7318 0.6410 0.0944 0.1333 0.0562 3.8586 3.8372 4.0828 3.8601 -3.9833 -3.9471 0.7302 0.1718 0.3180 0.5840 0.2106 0.6081 -0.8885 -0.8075 -0.5536 'X-RAY DIFFRACTION' 4 ? refined 18.0004 -36.6832 14.0215 1.0021 0.8588 0.8997 -0.0358 0.1138 0.1955 4.1780 8.8352 3.8514 -5.8020 0.6779 0.5875 -1.6024 -0.4176 -0.8457 0.6249 1.0127 0.0889 1.8955 -0.5696 0.6231 'X-RAY DIFFRACTION' 5 ? refined 26.3342 -30.2301 6.6523 0.5028 0.7416 0.4296 0.0261 0.0531 -0.0016 9.2307 6.8934 6.8618 0.9945 -2.1818 -0.6738 0.2166 0.7933 -0.3833 -0.6174 -0.0737 -0.2871 1.4029 0.6151 -0.0843 'X-RAY DIFFRACTION' 6 ? refined 14.2270 -21.7159 -4.4669 0.6727 1.7329 1.0129 0.1713 -0.0966 0.5354 4.6342 7.3531 5.2846 0.5518 4.1423 -2.1784 -0.3633 3.4807 1.4744 -1.2517 0.0495 0.8141 -1.2525 -0.8553 0.4798 'X-RAY DIFFRACTION' 7 ? refined 9.2178 -16.8259 4.7468 0.3781 1.6700 1.2530 0.3878 -0.0843 0.7281 1.8796 0.7328 0.9977 0.0903 0.1019 0.8559 0.0264 -0.0752 -0.2305 0.4427 0.7520 0.6079 -0.3658 -1.4436 1.5520 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 2:19)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 20:81)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 82:100)' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 101:111)' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 112:177)' 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 178:186)' 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 187:196)' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language PHENIX refinement '(PHENIX.REFINE: 1.8.1_1168)' ? 1 ? ? ? ? DENZO 'data reduction' . ? 2 ? ? ? ? SCALEPACK 'data scaling' . ? 3 ? ? ? ? PHASER phasing . ? 4 ? ? ? ? # _pdbx_entry_details.entry_id 3ZLO _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'RESIDUES 45 TO 84 REMOVED, LAST 25 RESIDUES TRUNCATED' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 25 ? ? -49.67 85.16 2 1 ARG A 102 ? ? -28.19 -44.42 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 42 ? CG ? A GLU 46 CG 2 1 Y 1 A GLU 42 ? CD ? A GLU 46 CD 3 1 Y 1 A GLU 42 ? OE1 ? A GLU 46 OE1 4 1 Y 1 A GLU 42 ? OE2 ? A GLU 46 OE2 5 1 Y 1 A ASN 197 ? CA ? A ASN 161 CA 6 1 Y 1 A ASN 197 ? C ? A ASN 161 C 7 1 Y 1 A ASN 197 ? O ? A ASN 161 O 8 1 Y 1 A ASN 197 ? CB ? A ASN 161 CB 9 1 Y 1 A ASN 197 ? CG ? A ASN 161 CG 10 1 Y 1 A ASN 197 ? OD1 ? A ASN 161 OD1 11 1 Y 1 A ASN 197 ? ND2 ? A ASN 161 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -3 ? A MET 1 2 1 Y 1 A SER -2 ? A SER 2 3 1 Y 1 A MET -1 ? A MET 3 4 1 Y 1 A ALA 0 ? A ALA 4 5 1 Y 1 A MET 1 ? A MET 5 6 1 Y 1 A PHE 27 ? A PHE 31 7 1 Y 1 A SER 28 ? A SER 32 8 1 Y 1 A ASP 29 ? A ASP 33 9 1 Y 1 A VAL 30 ? A VAL 34 10 1 Y 1 A GLU 31 ? A GLU 35 11 1 Y 1 A GLU 32 ? A GLU 36 12 1 Y 1 A ASN 33 ? A ASN 37 13 1 Y 1 A ARG 34 ? A ARG 38 14 1 Y 1 A THR 35 ? A THR 39 15 1 Y 1 A GLU 36 ? A GLU 40 16 1 Y 1 A ALA 37 ? A ALA 41 17 1 Y 1 A PRO 38 ? A PRO 42 18 1 Y 1 A GLU 39 ? A GLU 43 19 1 Y 1 A GLY 40 ? A GLY 44 20 1 Y 1 A ASN 198 ? A ASN 162 21 1 Y 1 A ALA 199 ? A ALA 163 22 1 Y 1 A ALA 200 ? A ALA 164 23 1 Y 1 A ALA 201 ? A ALA 165 24 1 Y 1 A GLU 202 ? A GLU 166 25 1 Y 1 A SER 203 ? A SER 167 26 1 Y 1 A ARG 204 ? A ARG 168 27 1 Y 1 A LYS 205 ? A LYS 169 28 1 Y 1 A GLY 206 ? A GLY 170 29 1 Y 1 A GLN 207 ? A GLN 171 30 1 Y 1 A GLU 208 ? A GLU 172 31 1 Y 1 A ARG 209 ? A ARG 173 32 1 Y 1 A LEU 210 ? A LEU 174 33 1 Y 1 A GLU 211 ? A GLU 175 34 1 Y 1 A HIS 212 ? A HIS 176 35 1 Y 1 A HIS 213 ? A HIS 177 36 1 Y 1 A HIS 214 ? A HIS 178 37 1 Y 1 A HIS 215 ? A HIS 179 38 1 Y 1 A HIS 216 ? A HIS 180 39 1 Y 1 A HIS 217 ? A HIS 181 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-[(8E)-8-(1,3-benzothiazol-2-ylhydrazinylidene)-6,7-dihydro-5H-naphthalen-2-yl]-5-(4-phenylbutyl)-1,3-thiazole-4-carboxylic acid' X8U 3 water HOH #