data_3ZSC # _entry.id 3ZSC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3ZSC PDBE EBI-48824 WWPDB D_1290048824 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3ZSC _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2011-06-24 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'McDonough, M.A.' 1 ? 'Thymark, M.' 2 ? 'Frisner, H.' 3 ? 'Hotchkiss, A.' 4 ? 'Sonksen, C.' 5 ? 'Bjornvad, M.' 6 ? 'Johansen, K.S.' 7 ? 'Larsen, S.' 8 ? # _citation.id primary _citation.title 'Catalytic Function and Substrate Recognition of the Pectate Lyase from Thermotoga Maritima' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McDonough, M.A.' 1 ? primary 'Thymark, M.' 2 ? primary 'Frisner, H.' 3 ? primary 'Hotchkiss, A.' 4 ? primary 'Sonksen, C.' 5 ? primary 'Bjornvad, M.' 6 ? primary 'Johansen, K.S.' 7 ? primary 'Larsen, S.' 8 ? # _cell.entry_id 3ZSC _cell.length_a 80.602 _cell.length_b 80.602 _cell.length_c 148.819 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 9 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3ZSC _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PECTATE TRISACCHARIDE-LYASE' 37763.523 1 4.2.2.22 YES ? ? 2 branched man '4-deoxy-beta-L-threo-hex-4-enopyranuronic acid-(1-4)-alpha-D-galactopyranuronic acid-(1-4)-alpha-D-galactopyranuronic acid' 528.372 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 5 water nat water 18.015 165 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PECTATE LYASE A, PELA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SLNDKPVGFASVPTADLPEGTVGGLGGEIVFVRTAEELEKYTTAEGKYVIVVDGTIVFEPKREIKVLSDKTIVGINDAKI VGGGLVIKDAQNVIIRNIHFEGFYMEDDPRGKKYDFDYINVENSHHIWIDHITFVNGNDGAVDIKKYSNYITVSWNKFVD HDKVSLVGSSDKEDPEQAGQAYKVTYHHNYFKNLIQRMPRIRFGMAHVFNNFYSMGLRTGVSGNVFPIYGVASAMGAKVH VEGNYFMGYGAVMAEAGIAFLPTRIMGPVEGYLTLGEGDAKNEFYYCKEPEVRPVEEGKPALDPREYYDYTLDPVQDVPK IVVDGAGAGKLVFEELNTAQ ; _entity_poly.pdbx_seq_one_letter_code_can ;SLNDKPVGFASVPTADLPEGTVGGLGGEIVFVRTAEELEKYTTAEGKYVIVVDGTIVFEPKREIKVLSDKTIVGINDAKI VGGGLVIKDAQNVIIRNIHFEGFYMEDDPRGKKYDFDYINVENSHHIWIDHITFVNGNDGAVDIKKYSNYITVSWNKFVD HDKVSLVGSSDKEDPEQAGQAYKVTYHHNYFKNLIQRMPRIRFGMAHVFNNFYSMGLRTGVSGNVFPIYGVASAMGAKVH VEGNYFMGYGAVMAEAGIAFLPTRIMGPVEGYLTLGEGDAKNEFYYCKEPEVRPVEEGKPALDPREYYDYTLDPVQDVPK IVVDGAGAGKLVFEELNTAQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 ASN n 1 4 ASP n 1 5 LYS n 1 6 PRO n 1 7 VAL n 1 8 GLY n 1 9 PHE n 1 10 ALA n 1 11 SER n 1 12 VAL n 1 13 PRO n 1 14 THR n 1 15 ALA n 1 16 ASP n 1 17 LEU n 1 18 PRO n 1 19 GLU n 1 20 GLY n 1 21 THR n 1 22 VAL n 1 23 GLY n 1 24 GLY n 1 25 LEU n 1 26 GLY n 1 27 GLY n 1 28 GLU n 1 29 ILE n 1 30 VAL n 1 31 PHE n 1 32 VAL n 1 33 ARG n 1 34 THR n 1 35 ALA n 1 36 GLU n 1 37 GLU n 1 38 LEU n 1 39 GLU n 1 40 LYS n 1 41 TYR n 1 42 THR n 1 43 THR n 1 44 ALA n 1 45 GLU n 1 46 GLY n 1 47 LYS n 1 48 TYR n 1 49 VAL n 1 50 ILE n 1 51 VAL n 1 52 VAL n 1 53 ASP n 1 54 GLY n 1 55 THR n 1 56 ILE n 1 57 VAL n 1 58 PHE n 1 59 GLU n 1 60 PRO n 1 61 LYS n 1 62 ARG n 1 63 GLU n 1 64 ILE n 1 65 LYS n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 ASP n 1 70 LYS n 1 71 THR n 1 72 ILE n 1 73 VAL n 1 74 GLY n 1 75 ILE n 1 76 ASN n 1 77 ASP n 1 78 ALA n 1 79 LYS n 1 80 ILE n 1 81 VAL n 1 82 GLY n 1 83 GLY n 1 84 GLY n 1 85 LEU n 1 86 VAL n 1 87 ILE n 1 88 LYS n 1 89 ASP n 1 90 ALA n 1 91 GLN n 1 92 ASN n 1 93 VAL n 1 94 ILE n 1 95 ILE n 1 96 ARG n 1 97 ASN n 1 98 ILE n 1 99 HIS n 1 100 PHE n 1 101 GLU n 1 102 GLY n 1 103 PHE n 1 104 TYR n 1 105 MET n 1 106 GLU n 1 107 ASP n 1 108 ASP n 1 109 PRO n 1 110 ARG n 1 111 GLY n 1 112 LYS n 1 113 LYS n 1 114 TYR n 1 115 ASP n 1 116 PHE n 1 117 ASP n 1 118 TYR n 1 119 ILE n 1 120 ASN n 1 121 VAL n 1 122 GLU n 1 123 ASN n 1 124 SER n 1 125 HIS n 1 126 HIS n 1 127 ILE n 1 128 TRP n 1 129 ILE n 1 130 ASP n 1 131 HIS n 1 132 ILE n 1 133 THR n 1 134 PHE n 1 135 VAL n 1 136 ASN n 1 137 GLY n 1 138 ASN n 1 139 ASP n 1 140 GLY n 1 141 ALA n 1 142 VAL n 1 143 ASP n 1 144 ILE n 1 145 LYS n 1 146 LYS n 1 147 TYR n 1 148 SER n 1 149 ASN n 1 150 TYR n 1 151 ILE n 1 152 THR n 1 153 VAL n 1 154 SER n 1 155 TRP n 1 156 ASN n 1 157 LYS n 1 158 PHE n 1 159 VAL n 1 160 ASP n 1 161 HIS n 1 162 ASP n 1 163 LYS n 1 164 VAL n 1 165 SER n 1 166 LEU n 1 167 VAL n 1 168 GLY n 1 169 SER n 1 170 SER n 1 171 ASP n 1 172 LYS n 1 173 GLU n 1 174 ASP n 1 175 PRO n 1 176 GLU n 1 177 GLN n 1 178 ALA n 1 179 GLY n 1 180 GLN n 1 181 ALA n 1 182 TYR n 1 183 LYS n 1 184 VAL n 1 185 THR n 1 186 TYR n 1 187 HIS n 1 188 HIS n 1 189 ASN n 1 190 TYR n 1 191 PHE n 1 192 LYS n 1 193 ASN n 1 194 LEU n 1 195 ILE n 1 196 GLN n 1 197 ARG n 1 198 MET n 1 199 PRO n 1 200 ARG n 1 201 ILE n 1 202 ARG n 1 203 PHE n 1 204 GLY n 1 205 MET n 1 206 ALA n 1 207 HIS n 1 208 VAL n 1 209 PHE n 1 210 ASN n 1 211 ASN n 1 212 PHE n 1 213 TYR n 1 214 SER n 1 215 MET n 1 216 GLY n 1 217 LEU n 1 218 ARG n 1 219 THR n 1 220 GLY n 1 221 VAL n 1 222 SER n 1 223 GLY n 1 224 ASN n 1 225 VAL n 1 226 PHE n 1 227 PRO n 1 228 ILE n 1 229 TYR n 1 230 GLY n 1 231 VAL n 1 232 ALA n 1 233 SER n 1 234 ALA n 1 235 MET n 1 236 GLY n 1 237 ALA n 1 238 LYS n 1 239 VAL n 1 240 HIS n 1 241 VAL n 1 242 GLU n 1 243 GLY n 1 244 ASN n 1 245 TYR n 1 246 PHE n 1 247 MET n 1 248 GLY n 1 249 TYR n 1 250 GLY n 1 251 ALA n 1 252 VAL n 1 253 MET n 1 254 ALA n 1 255 GLU n 1 256 ALA n 1 257 GLY n 1 258 ILE n 1 259 ALA n 1 260 PHE n 1 261 LEU n 1 262 PRO n 1 263 THR n 1 264 ARG n 1 265 ILE n 1 266 MET n 1 267 GLY n 1 268 PRO n 1 269 VAL n 1 270 GLU n 1 271 GLY n 1 272 TYR n 1 273 LEU n 1 274 THR n 1 275 LEU n 1 276 GLY n 1 277 GLU n 1 278 GLY n 1 279 ASP n 1 280 ALA n 1 281 LYS n 1 282 ASN n 1 283 GLU n 1 284 PHE n 1 285 TYR n 1 286 TYR n 1 287 CYS n 1 288 LYS n 1 289 GLU n 1 290 PRO n 1 291 GLU n 1 292 VAL n 1 293 ARG n 1 294 PRO n 1 295 VAL n 1 296 GLU n 1 297 GLU n 1 298 GLY n 1 299 LYS n 1 300 PRO n 1 301 ALA n 1 302 LEU n 1 303 ASP n 1 304 PRO n 1 305 ARG n 1 306 GLU n 1 307 TYR n 1 308 TYR n 1 309 ASP n 1 310 TYR n 1 311 THR n 1 312 LEU n 1 313 ASP n 1 314 PRO n 1 315 VAL n 1 316 GLN n 1 317 ASP n 1 318 VAL n 1 319 PRO n 1 320 LYS n 1 321 ILE n 1 322 VAL n 1 323 VAL n 1 324 ASP n 1 325 GLY n 1 326 ALA n 1 327 GLY n 1 328 ALA n 1 329 GLY n 1 330 LYS n 1 331 LEU n 1 332 VAL n 1 333 PHE n 1 334 GLU n 1 335 GLU n 1 336 LEU n 1 337 ASN n 1 338 THR n 1 339 ALA n 1 340 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'THERMOTOGA MARITIMA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2336 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'BACILLUS LICHENIFORMIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1402 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTLY_THEMA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9WYR4 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ZSC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 340 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9WYR4 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 367 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 340 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3ZSC ILE A 132 ? UNP Q9WYR4 CYS 159 'engineered mutation' 132 1 1 3ZSC ASN A 156 ? UNP Q9WYR4 CYS 183 'engineered mutation' 156 2 1 3ZSC LEU A 194 ? UNP Q9WYR4 CYS 221 'engineered mutation' 194 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADA 'D-saccharide, alpha linking' . 'alpha-D-galactopyranuronic acid' 'ALPHA D-GALACTURONIC ACID' 'C6 H10 O7' 194.139 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AQA 'L-saccharide, beta linking' . '4-deoxy-beta-L-threo-hex-4-enopyranuronic acid' ? 'C6 H8 O6' 176.124 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3ZSC _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_percent_sol 50.1 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 4.2' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARRESEARCH SX-165' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.913 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE X13' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, HAMBURG' _diffrn_source.pdbx_synchrotron_beamline X13 _diffrn_source.pdbx_wavelength 0.913 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 3ZSC _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 14.00 _reflns.d_resolution_high 1.95 _reflns.number_obs 26478 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.10 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 18.60 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.6 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 14.00 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.44 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.50 _reflns_shell.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3ZSC _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 25137 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 63.25 _refine.ls_d_res_high 1.94 _refine.ls_percent_reflns_obs 99.62 _refine.ls_R_factor_obs 0.18168 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17877 _refine.ls_R_factor_R_free 0.23699 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1339 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.938 _refine.B_iso_mean 33.708 _refine.aniso_B[1][1] 0.90 _refine.aniso_B[2][2] 0.90 _refine.aniso_B[3][3] -1.35 _refine.aniso_B[1][2] 0.45 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model 'PDB ENTRY 2BSP' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.158 _refine.pdbx_overall_ESU_R_Free 0.156 _refine.overall_SU_ML 0.109 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 3.788 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2568 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 53 _refine_hist.number_atoms_solvent 165 _refine_hist.number_atoms_total 2786 _refine_hist.d_res_high 1.94 _refine_hist.d_res_low 63.25 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 2693 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.699 1.970 ? 3649 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.893 5.000 ? 330 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.455 24.435 ? 124 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.750 15.000 ? 425 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 16.404 15.000 ? 11 'X-RAY DIFFRACTION' ? r_chiral_restr 0.132 0.200 ? 393 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 2065 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.213 0.200 ? 1277 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.326 0.200 ? 1818 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.158 0.200 ? 203 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.202 0.200 ? 55 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.148 0.200 ? 12 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.019 1.500 ? 1668 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.670 2.000 ? 2631 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.458 3.000 ? 1159 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.619 4.500 ? 1018 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.943 _refine_ls_shell.d_res_low 1.993 _refine_ls_shell.number_reflns_R_work 1836 _refine_ls_shell.R_factor_R_work 0.238 _refine_ls_shell.percent_reflns_obs 98.78 _refine_ls_shell.R_factor_R_free 0.276 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 104 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 3ZSC _struct.title 'Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima' _struct.pdbx_descriptor 'PECTATE TRISACCHARIDE-LYASE (E.C.4.2.2.22)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ZSC _struct_keywords.pdbx_keywords LYASE _struct_keywords.text 'LYASE, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 8 ? VAL A 12 ? GLY A 8 VAL A 12 5 ? 5 HELX_P HELX_P2 2 THR A 34 ? THR A 43 ? THR A 34 THR A 43 1 ? 10 HELX_P HELX_P3 3 ASP A 174 ? ALA A 181 ? ASP A 174 ALA A 181 1 ? 8 HELX_P HELX_P4 4 GLY A 250 ? ALA A 256 ? GLY A 250 ALA A 256 1 ? 7 HELX_P HELX_P5 5 GLU A 277 ? LYS A 281 ? GLU A 277 LYS A 281 5 ? 5 HELX_P HELX_P6 6 ASP A 303 ? TYR A 307 ? ASP A 303 TYR A 307 5 ? 5 HELX_P HELX_P7 7 PRO A 314 ? GLN A 316 ? PRO A 314 GLN A 316 5 ? 3 HELX_P HELX_P8 8 ASP A 317 ? ALA A 326 ? ASP A 317 ALA A 326 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? B ADA . O4 ? ? ? 1_555 B ADA . C1 ? ? B ADA 1 B ADA 2 1_555 ? ? ? ? ? ? ? 1.469 ? ? covale2 covale one ? B ADA . O4 ? ? ? 1_555 B AQA . C1 ? ? B ADA 2 B AQA 3 1_555 ? ? ? ? ? ? ? 1.445 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 59 A . ? GLU 59 A PRO 60 A ? PRO 60 A 1 1.32 2 MET 198 A . ? MET 198 A PRO 199 A ? PRO 199 A 1 -5.33 3 GLY 267 A . ? GLY 267 A PRO 268 A ? PRO 268 A 1 7.49 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 10 ? AC ? 10 ? AD ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? parallel AA 3 4 ? anti-parallel AA 4 5 ? parallel AB 1 2 ? parallel AB 2 3 ? parallel AB 3 4 ? anti-parallel AB 4 5 ? parallel AB 5 6 ? parallel AB 6 7 ? anti-parallel AB 7 8 ? anti-parallel AB 8 9 ? anti-parallel AB 9 10 ? parallel AC 1 2 ? parallel AC 2 3 ? parallel AC 3 4 ? parallel AC 4 5 ? parallel AC 5 6 ? parallel AC 6 7 ? parallel AC 7 8 ? parallel AC 8 9 ? parallel AC 9 10 ? parallel AD 1 2 ? parallel AD 2 3 ? parallel AD 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLU A 28 ? VAL A 32 ? GLU A 28 VAL A 32 AA 2 TYR A 48 ? VAL A 66 ? TYR A 48 VAL A 66 AA 3 LYS A 70 ? LYS A 88 ? LYS A 70 LYS A 88 AA 4 ILE A 119 ? GLU A 122 ? ILE A 119 GLU A 122 AA 5 VAL A 142 ? LYS A 145 ? VAL A 142 LYS A 145 AB 1 GLU A 28 ? VAL A 32 ? GLU A 28 VAL A 32 AB 2 TYR A 48 ? VAL A 66 ? TYR A 48 VAL A 66 AB 3 LYS A 70 ? LYS A 88 ? LYS A 70 LYS A 88 AB 4 HIS A 99 ? GLU A 101 ? HIS A 99 GLU A 101 AB 5 THR A 133 ? VAL A 135 ? THR A 133 VAL A 135 AB 6 LYS A 157 ? VAL A 159 ? LYS A 157 VAL A 159 AB 7 TYR A 190 ? LYS A 192 ? TYR A 190 LYS A 192 AB 8 PHE A 212 ? SER A 214 ? PHE A 212 SER A 214 AB 9 TYR A 245 ? MET A 247 ? TYR A 245 MET A 247 AB 10 GLU A 283 ? TYR A 285 ? GLU A 283 TYR A 285 AC 1 GLU A 28 ? VAL A 32 ? GLU A 28 VAL A 32 AC 2 TYR A 48 ? VAL A 66 ? TYR A 48 VAL A 66 AC 3 LYS A 70 ? LYS A 88 ? LYS A 70 LYS A 88 AC 4 GLN A 91 ? ARG A 96 ? GLN A 91 ARG A 96 AC 5 HIS A 125 ? ASP A 130 ? HIS A 125 ASP A 130 AC 6 ASN A 149 ? SER A 154 ? ASN A 149 SER A 154 AC 7 LYS A 183 ? HIS A 187 ? LYS A 183 HIS A 187 AC 8 MET A 205 ? PHE A 209 ? MET A 205 PHE A 209 AC 9 LYS A 238 ? GLU A 242 ? LYS A 238 GLU A 242 AC 10 TYR A 272 ? LEU A 275 ? TYR A 272 LEU A 275 AD 1 LEU A 166 ? VAL A 167 ? LEU A 166 VAL A 167 AD 2 ARG A 200 ? ARG A 202 ? ARG A 200 ARG A 202 AD 3 TYR A 229 ? ALA A 234 ? TYR A 229 ALA A 234 AD 4 LEU A 261 ? ILE A 265 ? LEU A 261 ILE A 265 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N VAL A 30 ? N VAL A 30 O VAL A 49 ? O VAL A 49 AA 2 3 N ILE A 50 ? N ILE A 50 O THR A 71 ? O THR A 71 AA 3 4 N ILE A 87 ? N ILE A 87 O ASN A 120 ? O ASN A 120 AA 4 5 N VAL A 121 ? N VAL A 121 O ASP A 143 ? O ASP A 143 AB 1 2 N VAL A 30 ? N VAL A 30 O VAL A 49 ? O VAL A 49 AB 2 3 N ILE A 50 ? N ILE A 50 O THR A 71 ? O THR A 71 AB 3 4 N ILE A 80 ? N ILE A 80 O HIS A 99 ? O HIS A 99 AB 4 5 N PHE A 100 ? N PHE A 100 O THR A 133 ? O THR A 133 AB 5 6 N PHE A 134 ? N PHE A 134 O LYS A 157 ? O LYS A 157 AB 6 7 N PHE A 158 ? N PHE A 158 O TYR A 190 ? O TYR A 190 AB 7 8 N PHE A 191 ? N PHE A 191 O PHE A 212 ? O PHE A 212 AB 8 9 N TYR A 213 ? N TYR A 213 O TYR A 245 ? O TYR A 245 AB 9 10 N PHE A 246 ? N PHE A 246 O GLU A 283 ? O GLU A 283 AC 1 2 N VAL A 30 ? N VAL A 30 O VAL A 49 ? O VAL A 49 AC 2 3 N ILE A 50 ? N ILE A 50 O THR A 71 ? O THR A 71 AC 3 4 N LYS A 70 ? N LYS A 70 O ASN A 92 ? O ASN A 92 AC 4 5 N ASN A 92 ? N ASN A 92 O HIS A 125 ? O HIS A 125 AC 5 6 N HIS A 126 ? N HIS A 126 O ASN A 149 ? O ASN A 149 AC 6 7 N ILE A 151 ? N ILE A 151 O LYS A 183 ? O LYS A 183 AC 7 8 N VAL A 184 ? N VAL A 184 O MET A 205 ? O MET A 205 AC 8 9 N ALA A 206 ? N ALA A 206 O LYS A 238 ? O LYS A 238 AC 9 10 N VAL A 239 ? N VAL A 239 O TYR A 272 ? O TYR A 272 AD 1 2 N VAL A 167 ? N VAL A 167 O ARG A 200 ? O ARG A 200 AD 2 3 N ILE A 201 ? N ILE A 201 O ALA A 232 ? O ALA A 232 AD 3 4 N GLY A 230 ? N GLY A 230 O LEU A 261 ? O LEU A 261 # _database_PDB_matrix.entry_id 3ZSC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3ZSC _atom_sites.fract_transf_matrix[1][1] 0.012407 _atom_sites.fract_transf_matrix[1][2] 0.007163 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014326 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006720 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 TRP 155 155 155 TRP TRP A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 ILE 195 195 195 ILE ILE A . n A 1 196 GLN 196 196 196 GLN GLN A . n A 1 197 ARG 197 197 197 ARG ARG A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 MET 205 205 205 MET MET A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 PHE 209 209 209 PHE PHE A . n A 1 210 ASN 210 210 210 ASN ASN A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 TYR 213 213 213 TYR TYR A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 MET 215 215 215 MET MET A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 TYR 229 229 229 TYR TYR A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 ALA 232 232 232 ALA ALA A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 HIS 240 240 240 HIS HIS A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 TYR 245 245 245 TYR TYR A . n A 1 246 PHE 246 246 246 PHE PHE A . n A 1 247 MET 247 247 247 MET MET A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 VAL 252 252 252 VAL VAL A . n A 1 253 MET 253 253 253 MET MET A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 PHE 260 260 260 PHE PHE A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 PRO 262 262 262 PRO PRO A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 ARG 264 264 264 ARG ARG A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 MET 266 266 266 MET MET A . n A 1 267 GLY 267 267 267 GLY GLY A . n A 1 268 PRO 268 268 268 PRO PRO A . n A 1 269 VAL 269 269 269 VAL VAL A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 GLY 271 271 271 GLY GLY A . n A 1 272 TYR 272 272 272 TYR TYR A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 THR 274 274 274 THR THR A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 GLU 277 277 277 GLU GLU A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 ASP 279 279 279 ASP ASP A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 LYS 281 281 281 LYS LYS A . n A 1 282 ASN 282 282 282 ASN ASN A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 PHE 284 284 284 PHE PHE A . n A 1 285 TYR 285 285 285 TYR TYR A . n A 1 286 TYR 286 286 286 TYR TYR A . n A 1 287 CYS 287 287 287 CYS CYS A . n A 1 288 LYS 288 288 288 LYS LYS A . n A 1 289 GLU 289 289 289 GLU GLU A . n A 1 290 PRO 290 290 290 PRO PRO A . n A 1 291 GLU 291 291 291 GLU GLU A . n A 1 292 VAL 292 292 292 VAL VAL A . n A 1 293 ARG 293 293 293 ARG ARG A . n A 1 294 PRO 294 294 294 PRO PRO A . n A 1 295 VAL 295 295 295 VAL VAL A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 GLU 297 297 297 GLU GLU A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 LYS 299 299 299 LYS LYS A . n A 1 300 PRO 300 300 300 PRO PRO A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 LEU 302 302 302 LEU LEU A . n A 1 303 ASP 303 303 303 ASP ASP A . n A 1 304 PRO 304 304 304 PRO PRO A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 GLU 306 306 306 GLU GLU A . n A 1 307 TYR 307 307 307 TYR TYR A . n A 1 308 TYR 308 308 308 TYR TYR A . n A 1 309 ASP 309 309 309 ASP ASP A . n A 1 310 TYR 310 310 310 TYR TYR A . n A 1 311 THR 311 311 311 THR THR A . n A 1 312 LEU 312 312 312 LEU LEU A . n A 1 313 ASP 313 313 313 ASP ASP A . n A 1 314 PRO 314 314 314 PRO PRO A . n A 1 315 VAL 315 315 315 VAL VAL A . n A 1 316 GLN 316 316 316 GLN GLN A . n A 1 317 ASP 317 317 317 ASP ASP A . n A 1 318 VAL 318 318 318 VAL VAL A . n A 1 319 PRO 319 319 319 PRO PRO A . n A 1 320 LYS 320 320 320 LYS LYS A . n A 1 321 ILE 321 321 321 ILE ILE A . n A 1 322 VAL 322 322 322 VAL VAL A . n A 1 323 VAL 323 323 323 VAL VAL A . n A 1 324 ASP 324 324 324 ASP ASP A . n A 1 325 GLY 325 325 325 GLY GLY A . n A 1 326 ALA 326 326 326 ALA ALA A . n A 1 327 GLY 327 327 327 GLY GLY A . n A 1 328 ALA 328 328 328 ALA ALA A . n A 1 329 GLY 329 329 329 GLY GLY A . n A 1 330 LYS 330 330 330 LYS LYS A . n A 1 331 LEU 331 331 331 LEU LEU A . n A 1 332 VAL 332 332 332 VAL VAL A . n A 1 333 PHE 333 333 ? ? ? A . n A 1 334 GLU 334 334 ? ? ? A . n A 1 335 GLU 335 335 ? ? ? A . n A 1 336 LEU 336 336 ? ? ? A . n A 1 337 ASN 337 337 ? ? ? A . n A 1 338 THR 338 338 ? ? ? A . n A 1 339 ALA 339 339 ? ? ? A . n A 1 340 GLN 340 340 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 1333 1333 GOL GOL A . D 3 GOL 1 1334 1334 GOL GOL A . E 4 PO4 1 1335 1335 PO4 PO4 A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . F 5 HOH 95 2095 2095 HOH HOH A . F 5 HOH 96 2096 2096 HOH HOH A . F 5 HOH 97 2097 2097 HOH HOH A . F 5 HOH 98 2098 2098 HOH HOH A . F 5 HOH 99 2099 2099 HOH HOH A . F 5 HOH 100 2100 2100 HOH HOH A . F 5 HOH 101 2101 2101 HOH HOH A . F 5 HOH 102 2102 2102 HOH HOH A . F 5 HOH 103 2103 2103 HOH HOH A . F 5 HOH 104 2104 2104 HOH HOH A . F 5 HOH 105 2105 2105 HOH HOH A . F 5 HOH 106 2106 2106 HOH HOH A . F 5 HOH 107 2107 2107 HOH HOH A . F 5 HOH 108 2108 2108 HOH HOH A . F 5 HOH 109 2109 2109 HOH HOH A . F 5 HOH 110 2110 2110 HOH HOH A . F 5 HOH 111 2111 2111 HOH HOH A . F 5 HOH 112 2112 2112 HOH HOH A . F 5 HOH 113 2113 2113 HOH HOH A . F 5 HOH 114 2114 2114 HOH HOH A . F 5 HOH 115 2115 2115 HOH HOH A . F 5 HOH 116 2116 2116 HOH HOH A . F 5 HOH 117 2117 2117 HOH HOH A . F 5 HOH 118 2118 2118 HOH HOH A . F 5 HOH 119 2119 2119 HOH HOH A . F 5 HOH 120 2120 2120 HOH HOH A . F 5 HOH 121 2121 2121 HOH HOH A . F 5 HOH 122 2122 2122 HOH HOH A . F 5 HOH 123 2123 2123 HOH HOH A . F 5 HOH 124 2124 2124 HOH HOH A . F 5 HOH 125 2125 2125 HOH HOH A . F 5 HOH 126 2126 2126 HOH HOH A . F 5 HOH 127 2127 2127 HOH HOH A . F 5 HOH 128 2128 2128 HOH HOH A . F 5 HOH 129 2129 2129 HOH HOH A . F 5 HOH 130 2130 2130 HOH HOH A . F 5 HOH 131 2131 2131 HOH HOH A . F 5 HOH 132 2132 2132 HOH HOH A . F 5 HOH 133 2133 2133 HOH HOH A . F 5 HOH 134 2134 2134 HOH HOH A . F 5 HOH 135 2135 2135 HOH HOH A . F 5 HOH 136 2136 2136 HOH HOH A . F 5 HOH 137 2137 2137 HOH HOH A . F 5 HOH 138 2138 2138 HOH HOH A . F 5 HOH 139 2139 2139 HOH HOH A . F 5 HOH 140 2140 2140 HOH HOH A . F 5 HOH 141 2141 2141 HOH HOH A . F 5 HOH 142 2142 2142 HOH HOH A . F 5 HOH 143 2143 2143 HOH HOH A . F 5 HOH 144 2144 2144 HOH HOH A . F 5 HOH 145 2145 2145 HOH HOH A . F 5 HOH 146 2146 2146 HOH HOH A . F 5 HOH 147 2147 2147 HOH HOH A . F 5 HOH 148 2148 2148 HOH HOH A . F 5 HOH 149 2149 2149 HOH HOH A . F 5 HOH 150 2150 2150 HOH HOH A . F 5 HOH 151 2151 2151 HOH HOH A . F 5 HOH 152 2152 2152 HOH HOH A . F 5 HOH 153 2153 2153 HOH HOH A . F 5 HOH 154 2154 2154 HOH HOH A . F 5 HOH 155 2155 2155 HOH HOH A . F 5 HOH 156 2156 2156 HOH HOH A . F 5 HOH 157 2157 2157 HOH HOH A . F 5 HOH 158 2158 2158 HOH HOH A . F 5 HOH 159 2159 2159 HOH HOH A . F 5 HOH 160 2160 2160 HOH HOH A . F 5 HOH 161 2161 2161 HOH HOH A . F 5 HOH 162 2162 2162 HOH HOH A . F 5 HOH 163 2163 2163 HOH HOH A . F 5 HOH 164 2164 2164 HOH HOH A . F 5 HOH 165 2165 2165 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8940 ? 1 MORE -35.8 ? 1 'SSA (A^2)' 34220 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -40.3010000000 -0.8660254038 -0.5000000000 0.0000000000 69.8033795958 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 40.3010000000 0.8660254038 -0.5000000000 0.0000000000 69.8033795958 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-07-11 2 'Structure model' 1 1 2018-02-21 3 'Structure model' 1 2 2019-07-17 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation_author 2 3 'Structure model' diffrn_source 3 3 'Structure model' struct_conn 4 4 'Structure model' atom_site 5 4 'Structure model' chem_comp 6 4 'Structure model' entity 7 4 'Structure model' pdbx_branch_scheme 8 4 'Structure model' pdbx_chem_comp_identifier 9 4 'Structure model' pdbx_database_status 10 4 'Structure model' pdbx_entity_branch 11 4 'Structure model' pdbx_entity_branch_descriptor 12 4 'Structure model' pdbx_entity_branch_link 13 4 'Structure model' pdbx_entity_branch_list 14 4 'Structure model' pdbx_entity_nonpoly 15 4 'Structure model' pdbx_nonpoly_scheme 16 4 'Structure model' pdbx_struct_assembly_gen 17 4 'Structure model' struct_asym 18 4 'Structure model' struct_conn 19 4 'Structure model' struct_site 20 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation_author.name' 2 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_atom_site.B_iso_or_equiv' 5 4 'Structure model' '_atom_site.Cartn_x' 6 4 'Structure model' '_atom_site.Cartn_y' 7 4 'Structure model' '_atom_site.Cartn_z' 8 4 'Structure model' '_atom_site.auth_asym_id' 9 4 'Structure model' '_atom_site.auth_atom_id' 10 4 'Structure model' '_atom_site.auth_comp_id' 11 4 'Structure model' '_atom_site.auth_seq_id' 12 4 'Structure model' '_atom_site.label_asym_id' 13 4 'Structure model' '_atom_site.label_atom_id' 14 4 'Structure model' '_atom_site.label_comp_id' 15 4 'Structure model' '_atom_site.label_entity_id' 16 4 'Structure model' '_atom_site.type_symbol' 17 4 'Structure model' '_chem_comp.name' 18 4 'Structure model' '_chem_comp.type' 19 4 'Structure model' '_pdbx_database_status.status_code_sf' 20 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 21 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 DENZO 'data reduction' . ? 2 EPMR phasing . ? 3 # _pdbx_entry_details.entry_id 3ZSC _pdbx_entry_details.compound_details ;ENGINEERED RESIDUE IN CHAIN A, CYS 159 TO ILE ENGINEERED RESIDUE IN CHAIN A, CYS 183 TO ASN ENGINEERED RESIDUE IN CHAIN A, CYS 221 TO LEU ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 92 ? ? 66.13 62.67 2 1 HIS A 126 ? ? 56.87 71.48 3 1 ASN A 136 ? ? 25.03 82.91 4 1 ASN A 138 ? ? -99.87 -74.03 5 1 ASP A 139 ? ? -98.45 -102.10 6 1 ASP A 162 ? ? -84.06 -76.62 7 1 ALA A 181 ? ? -102.75 -165.02 8 1 ARG A 197 ? ? 68.75 71.60 9 1 PHE A 203 ? ? 69.50 -47.83 10 1 ILE A 228 ? ? -98.67 -62.94 11 1 ARG A 293 ? ? -164.36 94.61 12 1 GLU A 297 ? ? -32.88 125.51 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 176 ? CG ? A GLU 176 CG 2 1 Y 1 A GLU 176 ? CD ? A GLU 176 CD 3 1 Y 1 A GLU 176 ? OE1 ? A GLU 176 OE1 4 1 Y 1 A GLU 176 ? OE2 ? A GLU 176 OE2 5 1 Y 1 A GLN 177 ? CG ? A GLN 177 CG 6 1 Y 1 A GLN 177 ? CD ? A GLN 177 CD 7 1 Y 1 A GLN 177 ? OE1 ? A GLN 177 OE1 8 1 Y 1 A GLN 177 ? NE2 ? A GLN 177 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A PHE 333 ? A PHE 333 5 1 Y 1 A GLU 334 ? A GLU 334 6 1 Y 1 A GLU 335 ? A GLU 335 7 1 Y 1 A LEU 336 ? A LEU 336 8 1 Y 1 A ASN 337 ? A ASN 337 9 1 Y 1 A THR 338 ? A THR 338 10 1 Y 1 A ALA 339 ? A ALA 339 11 1 Y 1 A GLN 340 ? A GLN 340 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 ADA 1 B ADA 1 A ADA 1336 n B 2 ADA 2 B ADA 2 A ADA 1337 n B 2 AQA 3 B AQA 3 A AQA 1338 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier ADA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpAa ADA 'COMMON NAME' GMML 1.0 'a-D-galactopyranuronic acid' ADA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-GalpA ADA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GalA AQA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-4-deoxy-GlcpA4en # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'WURCS=2.0/2,3,2/[a2112A-1a_1-5][a21eEA-1b_1-5]/1-1-2/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 2 2 '[][a-D-GalpA]{[(4+1)][a-D-GalpA]{[(4+1)][a-D-4-deoxy-GlcpA]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 ADA C1 O1 1 ADA O4 HO4 sing ? 2 2 3 AQA C1 O1 2 ADA O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 ADA 1 n 2 ADA 2 n 2 AQA 3 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 'PHOSPHATE ION' PO4 5 water HOH #