data_3AUZ # _entry.id 3AUZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3AUZ pdb_00003auz 10.2210/pdb3auz/pdb RCSB RCSB029727 ? ? WWPDB D_1000029727 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3AUX . unspecified PDB 3AUY . unspecified PDB 3AV0 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3AUZ _pdbx_database_status.recvd_initial_deposition_date 2011-02-18 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Park, Y.B.' 1 'Cho, Y.' 2 # _citation.id primary _citation.title 'Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lim, H.S.' 1 ? primary 'Kim, J.S.' 2 ? primary 'Park, Y.B.' 3 ? primary 'Gwon, G.H.' 4 ? primary 'Cho, Y.' 5 ? # _cell.entry_id 3AUZ _cell.length_a 101.980 _cell.length_b 101.980 _cell.length_c 113.020 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3AUZ _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA double-strand break repair protein mre11' 39163.008 1 ? ? 'Nuclease domain (UNP RESIDUES 1-313)' ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKA LRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKL KNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKE GKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKA IIVDDEFIDMPDN ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKA LRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKL KNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKE GKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKA IIVDDEFIDMPDN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 MET n 1 23 PHE n 1 24 VAL n 1 25 HIS n 1 26 ILE n 1 27 ALA n 1 28 ASP n 1 29 ASN n 1 30 HIS n 1 31 LEU n 1 32 GLY n 1 33 TYR n 1 34 ARG n 1 35 GLN n 1 36 TYR n 1 37 ASN n 1 38 LEU n 1 39 ASP n 1 40 ASP n 1 41 ARG n 1 42 GLU n 1 43 LYS n 1 44 ASP n 1 45 ILE n 1 46 TYR n 1 47 ASP n 1 48 SER n 1 49 PHE n 1 50 LYS n 1 51 LEU n 1 52 CYS n 1 53 ILE n 1 54 LYS n 1 55 LYS n 1 56 ILE n 1 57 LEU n 1 58 GLU n 1 59 ILE n 1 60 LYS n 1 61 PRO n 1 62 ASP n 1 63 VAL n 1 64 VAL n 1 65 LEU n 1 66 HIS n 1 67 SER n 1 68 GLY n 1 69 ASP n 1 70 LEU n 1 71 PHE n 1 72 ASN n 1 73 ASP n 1 74 LEU n 1 75 ARG n 1 76 PRO n 1 77 PRO n 1 78 VAL n 1 79 LYS n 1 80 ALA n 1 81 LEU n 1 82 ARG n 1 83 ILE n 1 84 ALA n 1 85 MET n 1 86 GLN n 1 87 ALA n 1 88 PHE n 1 89 LYS n 1 90 LYS n 1 91 LEU n 1 92 HIS n 1 93 GLU n 1 94 ASN n 1 95 ASN n 1 96 ILE n 1 97 LYS n 1 98 VAL n 1 99 TYR n 1 100 ILE n 1 101 VAL n 1 102 ALA n 1 103 GLY n 1 104 ASN n 1 105 HIS n 1 106 GLU n 1 107 MET n 1 108 PRO n 1 109 ARG n 1 110 ARG n 1 111 LEU n 1 112 GLY n 1 113 GLU n 1 114 GLU n 1 115 SER n 1 116 PRO n 1 117 LEU n 1 118 ALA n 1 119 LEU n 1 120 LEU n 1 121 LYS n 1 122 ASP n 1 123 TYR n 1 124 VAL n 1 125 LYS n 1 126 ILE n 1 127 LEU n 1 128 ASP n 1 129 GLY n 1 130 LYS n 1 131 ASP n 1 132 VAL n 1 133 ILE n 1 134 ASN n 1 135 VAL n 1 136 ASN n 1 137 GLY n 1 138 GLU n 1 139 GLU n 1 140 ILE n 1 141 PHE n 1 142 ILE n 1 143 CYS n 1 144 GLY n 1 145 THR n 1 146 TYR n 1 147 TYR n 1 148 HIS n 1 149 LYS n 1 150 LYS n 1 151 SER n 1 152 LYS n 1 153 ARG n 1 154 GLU n 1 155 GLU n 1 156 MET n 1 157 LEU n 1 158 ASP n 1 159 LYS n 1 160 LEU n 1 161 LYS n 1 162 ASN n 1 163 PHE n 1 164 GLU n 1 165 SER n 1 166 GLU n 1 167 ALA n 1 168 LYS n 1 169 ASN n 1 170 TYR n 1 171 LYS n 1 172 LYS n 1 173 LYS n 1 174 ILE n 1 175 LEU n 1 176 MET n 1 177 LEU n 1 178 HIS n 1 179 GLN n 1 180 GLY n 1 181 ILE n 1 182 ASN n 1 183 PRO n 1 184 TYR n 1 185 ILE n 1 186 PRO n 1 187 LEU n 1 188 ASP n 1 189 TYR n 1 190 GLU n 1 191 LEU n 1 192 GLU n 1 193 HIS n 1 194 PHE n 1 195 ASP n 1 196 LEU n 1 197 PRO n 1 198 LYS n 1 199 PHE n 1 200 SER n 1 201 TYR n 1 202 TYR n 1 203 ALA n 1 204 LEU n 1 205 GLY n 1 206 HIS n 1 207 ILE n 1 208 HIS n 1 209 LYS n 1 210 ARG n 1 211 ILE n 1 212 LEU n 1 213 GLU n 1 214 ARG n 1 215 PHE n 1 216 ASN n 1 217 ASP n 1 218 GLY n 1 219 ILE n 1 220 LEU n 1 221 ALA n 1 222 TYR n 1 223 SER n 1 224 GLY n 1 225 SER n 1 226 THR n 1 227 GLU n 1 228 ILE n 1 229 ILE n 1 230 TYR n 1 231 ARG n 1 232 ASN n 1 233 GLU n 1 234 TYR n 1 235 GLU n 1 236 ASP n 1 237 TYR n 1 238 LYS n 1 239 LYS n 1 240 GLU n 1 241 GLY n 1 242 LYS n 1 243 GLY n 1 244 PHE n 1 245 TYR n 1 246 LEU n 1 247 VAL n 1 248 ASP n 1 249 PHE n 1 250 SER n 1 251 GLY n 1 252 ASN n 1 253 ASP n 1 254 LEU n 1 255 ASP n 1 256 ILE n 1 257 SER n 1 258 ASP n 1 259 ILE n 1 260 GLU n 1 261 LYS n 1 262 ILE n 1 263 ASP n 1 264 ILE n 1 265 GLU n 1 266 CYS n 1 267 ARG n 1 268 GLU n 1 269 PHE n 1 270 VAL n 1 271 GLU n 1 272 VAL n 1 273 ASN n 1 274 ILE n 1 275 LYS n 1 276 ASP n 1 277 LYS n 1 278 LYS n 1 279 SER n 1 280 PHE n 1 281 ASN n 1 282 GLU n 1 283 ALA n 1 284 VAL n 1 285 ASN n 1 286 LYS n 1 287 ILE n 1 288 GLU n 1 289 ARG n 1 290 CYS n 1 291 LYS n 1 292 ASN n 1 293 LYS n 1 294 PRO n 1 295 VAL n 1 296 VAL n 1 297 PHE n 1 298 GLY n 1 299 LYS n 1 300 ILE n 1 301 LYS n 1 302 ARG n 1 303 GLU n 1 304 PHE n 1 305 LYS n 1 306 PRO n 1 307 TRP n 1 308 PHE n 1 309 ASP n 1 310 THR n 1 311 LEU n 1 312 LYS n 1 313 ASP n 1 314 LYS n 1 315 ILE n 1 316 LEU n 1 317 ILE n 1 318 ASN n 1 319 LYS n 1 320 ALA n 1 321 ILE n 1 322 ILE n 1 323 VAL n 1 324 ASP n 1 325 ASP n 1 326 GLU n 1 327 PHE n 1 328 ILE n 1 329 ASP n 1 330 MET n 1 331 PRO n 1 332 ASP n 1 333 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MJ1323, mre11' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2190 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector plasmid _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MRE11_METJA _struct_ref.pdbx_db_accession Q58719 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYI VAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQG INPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIE KIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3AUZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 333 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q58719 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 313 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 313 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3AUZ MET A 1 ? UNP Q58719 ? ? 'expression tag' -19 1 1 3AUZ GLY A 2 ? UNP Q58719 ? ? 'expression tag' -18 2 1 3AUZ SER A 3 ? UNP Q58719 ? ? 'expression tag' -17 3 1 3AUZ SER A 4 ? UNP Q58719 ? ? 'expression tag' -16 4 1 3AUZ HIS A 5 ? UNP Q58719 ? ? 'expression tag' -15 5 1 3AUZ HIS A 6 ? UNP Q58719 ? ? 'expression tag' -14 6 1 3AUZ HIS A 7 ? UNP Q58719 ? ? 'expression tag' -13 7 1 3AUZ HIS A 8 ? UNP Q58719 ? ? 'expression tag' -12 8 1 3AUZ HIS A 9 ? UNP Q58719 ? ? 'expression tag' -11 9 1 3AUZ HIS A 10 ? UNP Q58719 ? ? 'expression tag' -10 10 1 3AUZ SER A 11 ? UNP Q58719 ? ? 'expression tag' -9 11 1 3AUZ SER A 12 ? UNP Q58719 ? ? 'expression tag' -8 12 1 3AUZ GLY A 13 ? UNP Q58719 ? ? 'expression tag' -7 13 1 3AUZ LEU A 14 ? UNP Q58719 ? ? 'expression tag' -6 14 1 3AUZ VAL A 15 ? UNP Q58719 ? ? 'expression tag' -5 15 1 3AUZ PRO A 16 ? UNP Q58719 ? ? 'expression tag' -4 16 1 3AUZ ARG A 17 ? UNP Q58719 ? ? 'expression tag' -3 17 1 3AUZ GLY A 18 ? UNP Q58719 ? ? 'expression tag' -2 18 1 3AUZ SER A 19 ? UNP Q58719 ? ? 'expression tag' -1 19 1 3AUZ HIS A 20 ? UNP Q58719 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3AUZ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 5 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.75 _exptl_crystal.density_percent_sol 67.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details ;60% Tacsimate pH 7.0, 0.5mM manganese chloride , VAPOR DIFFUSION, HANGING DROP, temperature 295K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 113 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2010-11-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator mirrors _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3AUZ _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 3.2 _reflns.number_obs 10290 _reflns.number_all 10307 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.2 _reflns_shell.d_res_low 3.31 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3AUZ _refine.ls_number_reflns_obs 9873 _refine.ls_number_reflns_all 10254 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.07 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.045 _refine.ls_d_res_high 3.206 _refine.ls_percent_reflns_obs 96.28 _refine.ls_R_factor_obs 0.2235 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2192 _refine.ls_R_factor_R_free 0.2625 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.98 _refine.ls_number_reflns_R_free 985 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -3.3425 _refine.aniso_B[2][2] -3.3425 _refine.aniso_B[3][3] 6.6851 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.346 _refine.solvent_model_param_bsol 72.262 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 3AV0 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.45 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_phase_error 26.11 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2627 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2635 _refine_hist.d_res_high 3.206 _refine_hist.d_res_low 29.045 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 2697 'X-RAY DIFFRACTION' ? f_angle_d 1.250 ? ? 3619 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 21.202 ? ? 1028 'X-RAY DIFFRACTION' ? f_chiral_restr 0.075 ? ? 379 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 463 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 3.2062 3.3750 1151 0.3143 90.00 0.3765 . . 128 . . 'X-RAY DIFFRACTION' . 3.3750 3.5861 1214 0.2758 94.00 0.3218 . . 133 . . 'X-RAY DIFFRACTION' . 3.5861 3.8624 1237 0.2280 96.00 0.2765 . . 137 . . 'X-RAY DIFFRACTION' . 3.8624 4.2500 1277 0.2008 97.00 0.2332 . . 141 . . 'X-RAY DIFFRACTION' . 4.2500 4.8624 1295 0.1880 98.00 0.2734 . . 145 . . 'X-RAY DIFFRACTION' . 4.8624 6.1168 1312 0.2002 99.00 0.2190 . . 144 . . 'X-RAY DIFFRACTION' . 6.1168 29.0465 1402 0.1980 99.00 0.2154 . . 157 . . # _struct.entry_id 3AUZ _struct.title 'Crystal structure of Mre11 with manganese' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3AUZ _struct_keywords.pdbx_keywords RECOMBINATION _struct_keywords.text 'DNA repair, Calcineurin-like phosphoesterase, DNA double-strand break repair nuclease, Rad50, RECOMBINATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 34 ? ASN A 37 ? ARG A 14 ASN A 17 5 ? 4 HELX_P HELX_P2 2 LEU A 38 ? LYS A 60 ? LEU A 18 LYS A 40 1 ? 23 HELX_P HELX_P3 3 PRO A 77 ? ASN A 94 ? PRO A 57 ASN A 74 1 ? 18 HELX_P HELX_P4 4 GLY A 103 ? MET A 107 ? GLY A 83 MET A 87 5 ? 5 HELX_P HELX_P5 5 PRO A 116 ? LEU A 120 ? PRO A 96 LEU A 100 5 ? 5 HELX_P HELX_P6 6 LYS A 149 ? SER A 151 ? LYS A 129 SER A 131 5 ? 3 HELX_P HELX_P7 7 LYS A 152 ? GLU A 166 ? LYS A 132 GLU A 146 1 ? 15 HELX_P HELX_P8 8 GLU A 192 ? LEU A 196 ? GLU A 172 LEU A 176 5 ? 5 HELX_P HELX_P9 9 GLU A 233 ? GLU A 240 ? GLU A 213 GLU A 220 1 ? 8 HELX_P HELX_P10 10 ASP A 255 ? ILE A 259 ? ASP A 235 ILE A 239 5 ? 5 HELX_P HELX_P11 11 ASP A 276 ? ARG A 289 ? ASP A 256 ARG A 269 1 ? 14 HELX_P HELX_P12 12 PHE A 304 ? ASP A 309 ? PHE A 284 ASP A 289 1 ? 6 HELX_P HELX_P13 13 THR A 310 ? ILE A 315 ? THR A 290 ILE A 295 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 28 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 8 A MN 401 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc2 metalc ? ? A HIS 30 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 10 A MN 401 1_555 ? ? ? ? ? ? ? 2.322 ? ? metalc3 metalc ? ? A ASP 69 OD1 ? ? ? 1_555 B MN . MN ? ? A ASP 49 A MN 401 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc4 metalc ? ? A ASP 69 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 49 A MN 402 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc5 metalc ? ? A ASN 104 OD1 ? ? ? 1_555 C MN . MN ? ? A ASN 84 A MN 402 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc6 metalc ? ? A HIS 178 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 158 A MN 402 1_555 ? ? ? ? ? ? ? 2.339 ? ? metalc7 metalc ? ? A HIS 206 ND1 ? ? ? 1_555 C MN . MN ? ? A HIS 186 A MN 402 1_555 ? ? ? ? ? ? ? 2.306 ? ? metalc8 metalc ? ? A HIS 208 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 188 A MN 401 1_555 ? ? ? ? ? ? ? 2.326 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 18 A . ? GLY -2 A SER 19 A ? SER -1 A 1 3.06 2 ASN 136 A . ? ASN 116 A GLY 137 A ? GLY 117 A 1 -8.14 3 LEU 187 A . ? LEU 167 A ASP 188 A ? ASP 168 A 1 0.98 4 TYR 230 A . ? TYR 210 A ARG 231 A ? ARG 211 A 1 24.65 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 6 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? anti-parallel C 1 2 ? parallel C 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 125 ? ILE A 126 ? LYS A 105 ILE A 106 A 2 LYS A 97 ? ILE A 100 ? LYS A 77 ILE A 80 A 3 VAL A 63 ? HIS A 66 ? VAL A 43 HIS A 46 A 4 PHE A 23 ? ILE A 26 ? PHE A 3 ILE A 6 A 5 TYR A 245 ? VAL A 247 ? TYR A 225 VAL A 227 A 6 GLU A 260 ? LYS A 261 ? GLU A 240 LYS A 241 B 1 GLY A 129 ? ILE A 133 ? GLY A 109 ILE A 113 B 2 ILE A 140 ? THR A 145 ? ILE A 120 THR A 125 B 3 LYS A 173 ? HIS A 178 ? LYS A 153 HIS A 158 B 4 TYR A 201 ? GLY A 205 ? TYR A 181 GLY A 185 B 5 GLY A 218 ? TYR A 222 ? GLY A 198 TYR A 202 B 6 GLU A 213 ? PHE A 215 ? GLU A 193 PHE A 195 C 1 PHE A 269 ? ILE A 274 ? PHE A 249 ILE A 254 C 2 VAL A 295 ? LYS A 301 ? VAL A 275 LYS A 281 C 3 ILE A 317 ? VAL A 323 ? ILE A 297 VAL A 303 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 125 ? O LYS A 105 N VAL A 98 ? N VAL A 78 A 2 3 O TYR A 99 ? O TYR A 79 N HIS A 66 ? N HIS A 46 A 3 4 O LEU A 65 ? O LEU A 45 N VAL A 24 ? N VAL A 4 A 4 5 N HIS A 25 ? N HIS A 5 O TYR A 245 ? O TYR A 225 A 5 6 N LEU A 246 ? N LEU A 226 O GLU A 260 ? O GLU A 240 B 1 2 N ASP A 131 ? N ASP A 111 O ILE A 142 ? O ILE A 122 B 2 3 N PHE A 141 ? N PHE A 121 O ILE A 174 ? O ILE A 154 B 3 4 N LEU A 175 ? N LEU A 155 O TYR A 201 ? O TYR A 181 B 4 5 N LEU A 204 ? N LEU A 184 O ALA A 221 ? O ALA A 201 B 5 6 O GLY A 218 ? O GLY A 198 N PHE A 215 ? N PHE A 195 C 1 2 N ILE A 274 ? N ILE A 254 O LYS A 301 ? O LYS A 281 C 2 3 N GLY A 298 ? N GLY A 278 O ILE A 321 ? O ILE A 301 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 401 ? 5 'BINDING SITE FOR RESIDUE MN A 401' AC2 Software A MN 402 ? 5 'BINDING SITE FOR RESIDUE MN A 402' AC3 Software A GOL 411 ? 5 'BINDING SITE FOR RESIDUE GOL A 411' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 28 ? ASP A 8 . ? 1_555 ? 2 AC1 5 HIS A 30 ? HIS A 10 . ? 1_555 ? 3 AC1 5 ASP A 69 ? ASP A 49 . ? 1_555 ? 4 AC1 5 HIS A 208 ? HIS A 188 . ? 1_555 ? 5 AC1 5 MN C . ? MN A 402 . ? 1_555 ? 6 AC2 5 ASP A 69 ? ASP A 49 . ? 1_555 ? 7 AC2 5 ASN A 104 ? ASN A 84 . ? 1_555 ? 8 AC2 5 HIS A 178 ? HIS A 158 . ? 1_555 ? 9 AC2 5 HIS A 206 ? HIS A 186 . ? 1_555 ? 10 AC2 5 MN B . ? MN A 401 . ? 1_555 ? 11 AC3 5 ILE A 126 ? ILE A 106 . ? 1_555 ? 12 AC3 5 ASP A 128 ? ASP A 108 . ? 1_555 ? 13 AC3 5 TYR A 146 ? TYR A 126 . ? 1_555 ? 14 AC3 5 ARG A 302 ? ARG A 282 . ? 6_445 ? 15 AC3 5 PRO A 306 ? PRO A 286 . ? 6_445 ? # _database_PDB_matrix.entry_id 3AUZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3AUZ _atom_sites.fract_transf_matrix[1][1] 0.009806 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009806 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008848 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 -3 ARG ARG A . n A 1 18 GLY 18 -2 -2 GLY GLY A . n A 1 19 SER 19 -1 -1 SER SER A . n A 1 20 HIS 20 0 0 HIS HIS A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 MET 22 2 2 MET MET A . n A 1 23 PHE 23 3 3 PHE PHE A . n A 1 24 VAL 24 4 4 VAL VAL A . n A 1 25 HIS 25 5 5 HIS HIS A . n A 1 26 ILE 26 6 6 ILE ILE A . n A 1 27 ALA 27 7 7 ALA ALA A . n A 1 28 ASP 28 8 8 ASP ASP A . n A 1 29 ASN 29 9 9 ASN ASN A . n A 1 30 HIS 30 10 10 HIS HIS A . n A 1 31 LEU 31 11 11 LEU LEU A . n A 1 32 GLY 32 12 12 GLY GLY A . n A 1 33 TYR 33 13 13 TYR TYR A . n A 1 34 ARG 34 14 14 ARG ARG A . n A 1 35 GLN 35 15 15 GLN GLN A . n A 1 36 TYR 36 16 16 TYR TYR A . n A 1 37 ASN 37 17 17 ASN ASN A . n A 1 38 LEU 38 18 18 LEU LEU A . n A 1 39 ASP 39 19 19 ASP ASP A . n A 1 40 ASP 40 20 20 ASP ASP A . n A 1 41 ARG 41 21 21 ARG ARG A . n A 1 42 GLU 42 22 22 GLU GLU A . n A 1 43 LYS 43 23 23 LYS LYS A . n A 1 44 ASP 44 24 24 ASP ASP A . n A 1 45 ILE 45 25 25 ILE ILE A . n A 1 46 TYR 46 26 26 TYR TYR A . n A 1 47 ASP 47 27 27 ASP ASP A . n A 1 48 SER 48 28 28 SER SER A . n A 1 49 PHE 49 29 29 PHE PHE A . n A 1 50 LYS 50 30 30 LYS LYS A . n A 1 51 LEU 51 31 31 LEU LEU A . n A 1 52 CYS 52 32 32 CYS CYS A . n A 1 53 ILE 53 33 33 ILE ILE A . n A 1 54 LYS 54 34 34 LYS LYS A . n A 1 55 LYS 55 35 35 LYS LYS A . n A 1 56 ILE 56 36 36 ILE ILE A . n A 1 57 LEU 57 37 37 LEU LEU A . n A 1 58 GLU 58 38 38 GLU GLU A . n A 1 59 ILE 59 39 39 ILE ILE A . n A 1 60 LYS 60 40 40 LYS LYS A . n A 1 61 PRO 61 41 41 PRO PRO A . n A 1 62 ASP 62 42 42 ASP ASP A . n A 1 63 VAL 63 43 43 VAL VAL A . n A 1 64 VAL 64 44 44 VAL VAL A . n A 1 65 LEU 65 45 45 LEU LEU A . n A 1 66 HIS 66 46 46 HIS HIS A . n A 1 67 SER 67 47 47 SER SER A . n A 1 68 GLY 68 48 48 GLY GLY A . n A 1 69 ASP 69 49 49 ASP ASP A . n A 1 70 LEU 70 50 50 LEU LEU A . n A 1 71 PHE 71 51 51 PHE PHE A . n A 1 72 ASN 72 52 52 ASN ASN A . n A 1 73 ASP 73 53 53 ASP ASP A . n A 1 74 LEU 74 54 54 LEU LEU A . n A 1 75 ARG 75 55 55 ARG ARG A . n A 1 76 PRO 76 56 56 PRO PRO A . n A 1 77 PRO 77 57 57 PRO PRO A . n A 1 78 VAL 78 58 58 VAL VAL A . n A 1 79 LYS 79 59 59 LYS LYS A . n A 1 80 ALA 80 60 60 ALA ALA A . n A 1 81 LEU 81 61 61 LEU LEU A . n A 1 82 ARG 82 62 62 ARG ARG A . n A 1 83 ILE 83 63 63 ILE ILE A . n A 1 84 ALA 84 64 64 ALA ALA A . n A 1 85 MET 85 65 65 MET MET A . n A 1 86 GLN 86 66 66 GLN GLN A . n A 1 87 ALA 87 67 67 ALA ALA A . n A 1 88 PHE 88 68 68 PHE PHE A . n A 1 89 LYS 89 69 69 LYS LYS A . n A 1 90 LYS 90 70 70 LYS LYS A . n A 1 91 LEU 91 71 71 LEU LEU A . n A 1 92 HIS 92 72 72 HIS HIS A . n A 1 93 GLU 93 73 73 GLU GLU A . n A 1 94 ASN 94 74 74 ASN ASN A . n A 1 95 ASN 95 75 75 ASN ASN A . n A 1 96 ILE 96 76 76 ILE ILE A . n A 1 97 LYS 97 77 77 LYS LYS A . n A 1 98 VAL 98 78 78 VAL VAL A . n A 1 99 TYR 99 79 79 TYR TYR A . n A 1 100 ILE 100 80 80 ILE ILE A . n A 1 101 VAL 101 81 81 VAL VAL A . n A 1 102 ALA 102 82 82 ALA ALA A . n A 1 103 GLY 103 83 83 GLY GLY A . n A 1 104 ASN 104 84 84 ASN ASN A . n A 1 105 HIS 105 85 85 HIS HIS A . n A 1 106 GLU 106 86 86 GLU GLU A . n A 1 107 MET 107 87 87 MET MET A . n A 1 108 PRO 108 88 88 PRO PRO A . n A 1 109 ARG 109 89 89 ARG ARG A . n A 1 110 ARG 110 90 90 ARG ARG A . n A 1 111 LEU 111 91 91 LEU LEU A . n A 1 112 GLY 112 92 92 GLY GLY A . n A 1 113 GLU 113 93 93 GLU GLU A . n A 1 114 GLU 114 94 94 GLU GLU A . n A 1 115 SER 115 95 95 SER SER A . n A 1 116 PRO 116 96 96 PRO PRO A . n A 1 117 LEU 117 97 97 LEU LEU A . n A 1 118 ALA 118 98 98 ALA ALA A . n A 1 119 LEU 119 99 99 LEU LEU A . n A 1 120 LEU 120 100 100 LEU LEU A . n A 1 121 LYS 121 101 101 LYS LYS A . n A 1 122 ASP 122 102 102 ASP ASP A . n A 1 123 TYR 123 103 103 TYR TYR A . n A 1 124 VAL 124 104 104 VAL VAL A . n A 1 125 LYS 125 105 105 LYS LYS A . n A 1 126 ILE 126 106 106 ILE ILE A . n A 1 127 LEU 127 107 107 LEU LEU A . n A 1 128 ASP 128 108 108 ASP ASP A . n A 1 129 GLY 129 109 109 GLY GLY A . n A 1 130 LYS 130 110 110 LYS LYS A . n A 1 131 ASP 131 111 111 ASP ASP A . n A 1 132 VAL 132 112 112 VAL VAL A . n A 1 133 ILE 133 113 113 ILE ILE A . n A 1 134 ASN 134 114 114 ASN ASN A . n A 1 135 VAL 135 115 115 VAL VAL A . n A 1 136 ASN 136 116 116 ASN ASN A . n A 1 137 GLY 137 117 117 GLY GLY A . n A 1 138 GLU 138 118 118 GLU GLU A . n A 1 139 GLU 139 119 119 GLU GLU A . n A 1 140 ILE 140 120 120 ILE ILE A . n A 1 141 PHE 141 121 121 PHE PHE A . n A 1 142 ILE 142 122 122 ILE ILE A . n A 1 143 CYS 143 123 123 CYS CYS A . n A 1 144 GLY 144 124 124 GLY GLY A . n A 1 145 THR 145 125 125 THR THR A . n A 1 146 TYR 146 126 126 TYR TYR A . n A 1 147 TYR 147 127 127 TYR TYR A . n A 1 148 HIS 148 128 128 HIS HIS A . n A 1 149 LYS 149 129 129 LYS LYS A . n A 1 150 LYS 150 130 130 LYS LYS A . n A 1 151 SER 151 131 131 SER SER A . n A 1 152 LYS 152 132 132 LYS LYS A . n A 1 153 ARG 153 133 133 ARG ARG A . n A 1 154 GLU 154 134 134 GLU GLU A . n A 1 155 GLU 155 135 135 GLU GLU A . n A 1 156 MET 156 136 136 MET MET A . n A 1 157 LEU 157 137 137 LEU LEU A . n A 1 158 ASP 158 138 138 ASP ASP A . n A 1 159 LYS 159 139 139 LYS LYS A . n A 1 160 LEU 160 140 140 LEU LEU A . n A 1 161 LYS 161 141 141 LYS LYS A . n A 1 162 ASN 162 142 142 ASN ASN A . n A 1 163 PHE 163 143 143 PHE PHE A . n A 1 164 GLU 164 144 144 GLU GLU A . n A 1 165 SER 165 145 145 SER SER A . n A 1 166 GLU 166 146 146 GLU GLU A . n A 1 167 ALA 167 147 147 ALA ALA A . n A 1 168 LYS 168 148 148 LYS LYS A . n A 1 169 ASN 169 149 149 ASN ASN A . n A 1 170 TYR 170 150 150 TYR TYR A . n A 1 171 LYS 171 151 151 LYS LYS A . n A 1 172 LYS 172 152 152 LYS LYS A . n A 1 173 LYS 173 153 153 LYS LYS A . n A 1 174 ILE 174 154 154 ILE ILE A . n A 1 175 LEU 175 155 155 LEU LEU A . n A 1 176 MET 176 156 156 MET MET A . n A 1 177 LEU 177 157 157 LEU LEU A . n A 1 178 HIS 178 158 158 HIS HIS A . n A 1 179 GLN 179 159 159 GLN GLN A . n A 1 180 GLY 180 160 160 GLY GLY A . n A 1 181 ILE 181 161 161 ILE ILE A . n A 1 182 ASN 182 162 162 ASN ASN A . n A 1 183 PRO 183 163 163 PRO PRO A . n A 1 184 TYR 184 164 164 TYR TYR A . n A 1 185 ILE 185 165 165 ILE ILE A . n A 1 186 PRO 186 166 166 PRO PRO A . n A 1 187 LEU 187 167 167 LEU LEU A . n A 1 188 ASP 188 168 168 ASP ASP A . n A 1 189 TYR 189 169 169 TYR TYR A . n A 1 190 GLU 190 170 170 GLU GLU A . n A 1 191 LEU 191 171 171 LEU LEU A . n A 1 192 GLU 192 172 172 GLU GLU A . n A 1 193 HIS 193 173 173 HIS HIS A . n A 1 194 PHE 194 174 174 PHE PHE A . n A 1 195 ASP 195 175 175 ASP ASP A . n A 1 196 LEU 196 176 176 LEU LEU A . n A 1 197 PRO 197 177 177 PRO PRO A . n A 1 198 LYS 198 178 178 LYS LYS A . n A 1 199 PHE 199 179 179 PHE PHE A . n A 1 200 SER 200 180 180 SER SER A . n A 1 201 TYR 201 181 181 TYR TYR A . n A 1 202 TYR 202 182 182 TYR TYR A . n A 1 203 ALA 203 183 183 ALA ALA A . n A 1 204 LEU 204 184 184 LEU LEU A . n A 1 205 GLY 205 185 185 GLY GLY A . n A 1 206 HIS 206 186 186 HIS HIS A . n A 1 207 ILE 207 187 187 ILE ILE A . n A 1 208 HIS 208 188 188 HIS HIS A . n A 1 209 LYS 209 189 189 LYS LYS A . n A 1 210 ARG 210 190 190 ARG ARG A . n A 1 211 ILE 211 191 191 ILE ILE A . n A 1 212 LEU 212 192 192 LEU LEU A . n A 1 213 GLU 213 193 193 GLU GLU A . n A 1 214 ARG 214 194 194 ARG ARG A . n A 1 215 PHE 215 195 195 PHE PHE A . n A 1 216 ASN 216 196 196 ASN ASN A . n A 1 217 ASP 217 197 197 ASP ASP A . n A 1 218 GLY 218 198 198 GLY GLY A . n A 1 219 ILE 219 199 199 ILE ILE A . n A 1 220 LEU 220 200 200 LEU LEU A . n A 1 221 ALA 221 201 201 ALA ALA A . n A 1 222 TYR 222 202 202 TYR TYR A . n A 1 223 SER 223 203 203 SER SER A . n A 1 224 GLY 224 204 204 GLY GLY A . n A 1 225 SER 225 205 205 SER SER A . n A 1 226 THR 226 206 206 THR THR A . n A 1 227 GLU 227 207 207 GLU GLU A . n A 1 228 ILE 228 208 208 ILE ILE A . n A 1 229 ILE 229 209 209 ILE ILE A . n A 1 230 TYR 230 210 210 TYR TYR A . n A 1 231 ARG 231 211 211 ARG ARG A . n A 1 232 ASN 232 212 212 ASN ASN A . n A 1 233 GLU 233 213 213 GLU GLU A . n A 1 234 TYR 234 214 214 TYR TYR A . n A 1 235 GLU 235 215 215 GLU GLU A . n A 1 236 ASP 236 216 216 ASP ASP A . n A 1 237 TYR 237 217 217 TYR TYR A . n A 1 238 LYS 238 218 218 LYS LYS A . n A 1 239 LYS 239 219 219 LYS LYS A . n A 1 240 GLU 240 220 220 GLU GLU A . n A 1 241 GLY 241 221 221 GLY GLY A . n A 1 242 LYS 242 222 222 LYS LYS A . n A 1 243 GLY 243 223 223 GLY GLY A . n A 1 244 PHE 244 224 224 PHE PHE A . n A 1 245 TYR 245 225 225 TYR TYR A . n A 1 246 LEU 246 226 226 LEU LEU A . n A 1 247 VAL 247 227 227 VAL VAL A . n A 1 248 ASP 248 228 228 ASP ASP A . n A 1 249 PHE 249 229 229 PHE PHE A . n A 1 250 SER 250 230 230 SER SER A . n A 1 251 GLY 251 231 231 GLY GLY A . n A 1 252 ASN 252 232 232 ASN ASN A . n A 1 253 ASP 253 233 233 ASP ASP A . n A 1 254 LEU 254 234 234 LEU LEU A . n A 1 255 ASP 255 235 235 ASP ASP A . n A 1 256 ILE 256 236 236 ILE ILE A . n A 1 257 SER 257 237 237 SER SER A . n A 1 258 ASP 258 238 238 ASP ASP A . n A 1 259 ILE 259 239 239 ILE ILE A . n A 1 260 GLU 260 240 240 GLU GLU A . n A 1 261 LYS 261 241 241 LYS LYS A . n A 1 262 ILE 262 242 242 ILE ILE A . n A 1 263 ASP 263 243 243 ASP ASP A . n A 1 264 ILE 264 244 244 ILE ILE A . n A 1 265 GLU 265 245 245 GLU GLU A . n A 1 266 CYS 266 246 246 CYS CYS A . n A 1 267 ARG 267 247 247 ARG ARG A . n A 1 268 GLU 268 248 248 GLU GLU A . n A 1 269 PHE 269 249 249 PHE PHE A . n A 1 270 VAL 270 250 250 VAL VAL A . n A 1 271 GLU 271 251 251 GLU GLU A . n A 1 272 VAL 272 252 252 VAL VAL A . n A 1 273 ASN 273 253 253 ASN ASN A . n A 1 274 ILE 274 254 254 ILE ILE A . n A 1 275 LYS 275 255 255 LYS LYS A . n A 1 276 ASP 276 256 256 ASP ASP A . n A 1 277 LYS 277 257 257 LYS LYS A . n A 1 278 LYS 278 258 258 LYS LYS A . n A 1 279 SER 279 259 259 SER SER A . n A 1 280 PHE 280 260 260 PHE PHE A . n A 1 281 ASN 281 261 261 ASN ASN A . n A 1 282 GLU 282 262 262 GLU GLU A . n A 1 283 ALA 283 263 263 ALA ALA A . n A 1 284 VAL 284 264 264 VAL VAL A . n A 1 285 ASN 285 265 265 ASN ASN A . n A 1 286 LYS 286 266 266 LYS LYS A . n A 1 287 ILE 287 267 267 ILE ILE A . n A 1 288 GLU 288 268 268 GLU GLU A . n A 1 289 ARG 289 269 269 ARG ARG A . n A 1 290 CYS 290 270 270 CYS CYS A . n A 1 291 LYS 291 271 271 LYS LYS A . n A 1 292 ASN 292 272 272 ASN ASN A . n A 1 293 LYS 293 273 273 LYS LYS A . n A 1 294 PRO 294 274 274 PRO PRO A . n A 1 295 VAL 295 275 275 VAL VAL A . n A 1 296 VAL 296 276 276 VAL VAL A . n A 1 297 PHE 297 277 277 PHE PHE A . n A 1 298 GLY 298 278 278 GLY GLY A . n A 1 299 LYS 299 279 279 LYS LYS A . n A 1 300 ILE 300 280 280 ILE ILE A . n A 1 301 LYS 301 281 281 LYS LYS A . n A 1 302 ARG 302 282 282 ARG ARG A . n A 1 303 GLU 303 283 283 GLU GLU A . n A 1 304 PHE 304 284 284 PHE PHE A . n A 1 305 LYS 305 285 285 LYS LYS A . n A 1 306 PRO 306 286 286 PRO PRO A . n A 1 307 TRP 307 287 287 TRP TRP A . n A 1 308 PHE 308 288 288 PHE PHE A . n A 1 309 ASP 309 289 289 ASP ASP A . n A 1 310 THR 310 290 290 THR THR A . n A 1 311 LEU 311 291 291 LEU LEU A . n A 1 312 LYS 312 292 292 LYS LYS A . n A 1 313 ASP 313 293 293 ASP ASP A . n A 1 314 LYS 314 294 294 LYS LYS A . n A 1 315 ILE 315 295 295 ILE ILE A . n A 1 316 LEU 316 296 296 LEU LEU A . n A 1 317 ILE 317 297 297 ILE ILE A . n A 1 318 ASN 318 298 298 ASN ASN A . n A 1 319 LYS 319 299 299 LYS LYS A . n A 1 320 ALA 320 300 300 ALA ALA A . n A 1 321 ILE 321 301 301 ILE ILE A . n A 1 322 ILE 322 302 302 ILE ILE A . n A 1 323 VAL 323 303 303 VAL VAL A . n A 1 324 ASP 324 304 304 ASP ASP A . n A 1 325 ASP 325 305 305 ASP ASP A . n A 1 326 GLU 326 306 306 GLU GLU A . n A 1 327 PHE 327 307 307 PHE PHE A . n A 1 328 ILE 328 308 308 ILE ILE A . n A 1 329 ASP 329 309 309 ASP ASP A . n A 1 330 MET 330 310 310 MET MET A . n A 1 331 PRO 331 311 311 PRO PRO A . n A 1 332 ASP 332 312 312 ASP ASP A . n A 1 333 ASN 333 313 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 401 401 MN MN A . C 2 MN 1 402 402 MN MN A . D 3 GOL 1 411 411 GOL GOL A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 28 ? A ASP 8 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 NE2 ? A HIS 30 ? A HIS 10 ? 1_555 117.4 ? 2 OD2 ? A ASP 28 ? A ASP 8 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OD1 ? A ASP 69 ? A ASP 49 ? 1_555 98.2 ? 3 NE2 ? A HIS 30 ? A HIS 10 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OD1 ? A ASP 69 ? A ASP 49 ? 1_555 102.3 ? 4 OD2 ? A ASP 28 ? A ASP 8 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 NE2 ? A HIS 208 ? A HIS 188 ? 1_555 97.3 ? 5 NE2 ? A HIS 30 ? A HIS 10 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 NE2 ? A HIS 208 ? A HIS 188 ? 1_555 75.2 ? 6 OD1 ? A ASP 69 ? A ASP 49 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 NE2 ? A HIS 208 ? A HIS 188 ? 1_555 163.6 ? 7 OD1 ? A ASP 69 ? A ASP 49 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OD1 ? A ASN 104 ? A ASN 84 ? 1_555 102.6 ? 8 OD1 ? A ASP 69 ? A ASP 49 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 NE2 ? A HIS 178 ? A HIS 158 ? 1_555 85.5 ? 9 OD1 ? A ASN 104 ? A ASN 84 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 NE2 ? A HIS 178 ? A HIS 158 ? 1_555 79.7 ? 10 OD1 ? A ASP 69 ? A ASP 49 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 ND1 ? A HIS 206 ? A HIS 186 ? 1_555 158.3 ? 11 OD1 ? A ASN 104 ? A ASN 84 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 ND1 ? A HIS 206 ? A HIS 186 ? 1_555 95.3 ? 12 NE2 ? A HIS 178 ? A HIS 158 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 ND1 ? A HIS 206 ? A HIS 186 ? 1_555 85.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-05-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-11 4 'Structure model' 1 3 2023-11-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_struct_conn_angle 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.name' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_ref_seq_dif.details' 26 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 27 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 28 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CrystalClear 'data collection' . ? 1 PHENIX 'model building' . ? 2 PHENIX refinement '(phenix.refine)' ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 PHENIX phasing . ? 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 MET _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 228 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ILE _pdbx_validate_rmsd_angle.auth_seq_id_1 165 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 166 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 166 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 128.81 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 9.51 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A -1 ? ? -167.25 -147.03 2 1 ASP A 8 ? ? 49.03 82.74 3 1 ARG A 14 ? ? -102.21 78.27 4 1 TYR A 16 ? ? 41.38 27.63 5 1 PHE A 29 ? ? -52.04 -72.37 6 1 GLU A 38 ? ? -68.16 -72.65 7 1 ILE A 39 ? ? -43.83 -14.78 8 1 LYS A 40 ? ? 32.87 46.39 9 1 ASN A 74 ? ? -80.11 41.78 10 1 ASN A 75 ? ? 24.85 61.66 11 1 PRO A 88 ? ? -49.81 151.31 12 1 ASP A 108 ? ? -159.86 46.80 13 1 VAL A 115 ? ? 56.33 -159.94 14 1 GLU A 118 ? ? 150.38 -160.18 15 1 TYR A 126 ? ? -63.77 -161.02 16 1 LYS A 130 ? ? -26.87 -49.36 17 1 LYS A 132 ? ? -72.33 34.76 18 1 ASN A 149 ? ? -68.94 19.33 19 1 PRO A 166 ? ? -32.03 -36.37 20 1 LEU A 167 ? ? -171.11 126.01 21 1 PRO A 177 ? ? -52.69 179.91 22 1 TYR A 182 ? ? -104.79 72.90 23 1 ALA A 183 ? ? -64.99 87.67 24 1 HIS A 186 ? ? 101.14 -3.11 25 1 LYS A 189 ? ? -179.57 136.52 26 1 ASN A 196 ? ? 21.22 80.01 27 1 SER A 203 ? ? -24.74 -45.08 28 1 GLU A 207 ? ? -173.56 146.87 29 1 ILE A 208 ? ? -57.34 85.69 30 1 ASN A 212 ? ? 153.78 -53.27 31 1 GLU A 213 ? ? -62.22 21.17 32 1 TYR A 214 ? ? -60.82 -83.43 33 1 GLU A 220 ? ? -96.94 -65.55 34 1 ASP A 228 ? ? -142.89 -43.49 35 1 ASN A 232 ? ? -47.65 -75.88 36 1 ILE A 236 ? ? -46.06 -9.27 37 1 ARG A 247 ? ? -28.78 135.35 38 1 LYS A 255 ? ? -145.70 -21.41 39 1 ARG A 269 ? ? -39.93 -25.02 40 1 ASP A 309 ? ? -56.46 101.14 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ASN 313 ? A ASN 333 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 MN MN MN N N 261 PHE N N N N 262 PHE CA C N S 263 PHE C C N N 264 PHE O O N N 265 PHE CB C N N 266 PHE CG C Y N 267 PHE CD1 C Y N 268 PHE CD2 C Y N 269 PHE CE1 C Y N 270 PHE CE2 C Y N 271 PHE CZ C Y N 272 PHE OXT O N N 273 PHE H H N N 274 PHE H2 H N N 275 PHE HA H N N 276 PHE HB2 H N N 277 PHE HB3 H N N 278 PHE HD1 H N N 279 PHE HD2 H N N 280 PHE HE1 H N N 281 PHE HE2 H N N 282 PHE HZ H N N 283 PHE HXT H N N 284 PRO N N N N 285 PRO CA C N S 286 PRO C C N N 287 PRO O O N N 288 PRO CB C N N 289 PRO CG C N N 290 PRO CD C N N 291 PRO OXT O N N 292 PRO H H N N 293 PRO HA H N N 294 PRO HB2 H N N 295 PRO HB3 H N N 296 PRO HG2 H N N 297 PRO HG3 H N N 298 PRO HD2 H N N 299 PRO HD3 H N N 300 PRO HXT H N N 301 SER N N N N 302 SER CA C N S 303 SER C C N N 304 SER O O N N 305 SER CB C N N 306 SER OG O N N 307 SER OXT O N N 308 SER H H N N 309 SER H2 H N N 310 SER HA H N N 311 SER HB2 H N N 312 SER HB3 H N N 313 SER HG H N N 314 SER HXT H N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TRP N N N N 333 TRP CA C N S 334 TRP C C N N 335 TRP O O N N 336 TRP CB C N N 337 TRP CG C Y N 338 TRP CD1 C Y N 339 TRP CD2 C Y N 340 TRP NE1 N Y N 341 TRP CE2 C Y N 342 TRP CE3 C Y N 343 TRP CZ2 C Y N 344 TRP CZ3 C Y N 345 TRP CH2 C Y N 346 TRP OXT O N N 347 TRP H H N N 348 TRP H2 H N N 349 TRP HA H N N 350 TRP HB2 H N N 351 TRP HB3 H N N 352 TRP HD1 H N N 353 TRP HE1 H N N 354 TRP HE3 H N N 355 TRP HZ2 H N N 356 TRP HZ3 H N N 357 TRP HH2 H N N 358 TRP HXT H N N 359 TYR N N N N 360 TYR CA C N S 361 TYR C C N N 362 TYR O O N N 363 TYR CB C N N 364 TYR CG C Y N 365 TYR CD1 C Y N 366 TYR CD2 C Y N 367 TYR CE1 C Y N 368 TYR CE2 C Y N 369 TYR CZ C Y N 370 TYR OH O N N 371 TYR OXT O N N 372 TYR H H N N 373 TYR H2 H N N 374 TYR HA H N N 375 TYR HB2 H N N 376 TYR HB3 H N N 377 TYR HD1 H N N 378 TYR HD2 H N N 379 TYR HE1 H N N 380 TYR HE2 H N N 381 TYR HH H N N 382 TYR HXT H N N 383 VAL N N N N 384 VAL CA C N S 385 VAL C C N N 386 VAL O O N N 387 VAL CB C N N 388 VAL CG1 C N N 389 VAL CG2 C N N 390 VAL OXT O N N 391 VAL H H N N 392 VAL H2 H N N 393 VAL HA H N N 394 VAL HB H N N 395 VAL HG11 H N N 396 VAL HG12 H N N 397 VAL HG13 H N N 398 VAL HG21 H N N 399 VAL HG22 H N N 400 VAL HG23 H N N 401 VAL HXT H N N 402 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 ILE N CA sing N N 163 ILE N H sing N N 164 ILE N H2 sing N N 165 ILE CA C sing N N 166 ILE CA CB sing N N 167 ILE CA HA sing N N 168 ILE C O doub N N 169 ILE C OXT sing N N 170 ILE CB CG1 sing N N 171 ILE CB CG2 sing N N 172 ILE CB HB sing N N 173 ILE CG1 CD1 sing N N 174 ILE CG1 HG12 sing N N 175 ILE CG1 HG13 sing N N 176 ILE CG2 HG21 sing N N 177 ILE CG2 HG22 sing N N 178 ILE CG2 HG23 sing N N 179 ILE CD1 HD11 sing N N 180 ILE CD1 HD12 sing N N 181 ILE CD1 HD13 sing N N 182 ILE OXT HXT sing N N 183 LEU N CA sing N N 184 LEU N H sing N N 185 LEU N H2 sing N N 186 LEU CA C sing N N 187 LEU CA CB sing N N 188 LEU CA HA sing N N 189 LEU C O doub N N 190 LEU C OXT sing N N 191 LEU CB CG sing N N 192 LEU CB HB2 sing N N 193 LEU CB HB3 sing N N 194 LEU CG CD1 sing N N 195 LEU CG CD2 sing N N 196 LEU CG HG sing N N 197 LEU CD1 HD11 sing N N 198 LEU CD1 HD12 sing N N 199 LEU CD1 HD13 sing N N 200 LEU CD2 HD21 sing N N 201 LEU CD2 HD22 sing N N 202 LEU CD2 HD23 sing N N 203 LEU OXT HXT sing N N 204 LYS N CA sing N N 205 LYS N H sing N N 206 LYS N H2 sing N N 207 LYS CA C sing N N 208 LYS CA CB sing N N 209 LYS CA HA sing N N 210 LYS C O doub N N 211 LYS C OXT sing N N 212 LYS CB CG sing N N 213 LYS CB HB2 sing N N 214 LYS CB HB3 sing N N 215 LYS CG CD sing N N 216 LYS CG HG2 sing N N 217 LYS CG HG3 sing N N 218 LYS CD CE sing N N 219 LYS CD HD2 sing N N 220 LYS CD HD3 sing N N 221 LYS CE NZ sing N N 222 LYS CE HE2 sing N N 223 LYS CE HE3 sing N N 224 LYS NZ HZ1 sing N N 225 LYS NZ HZ2 sing N N 226 LYS NZ HZ3 sing N N 227 LYS OXT HXT sing N N 228 MET N CA sing N N 229 MET N H sing N N 230 MET N H2 sing N N 231 MET CA C sing N N 232 MET CA CB sing N N 233 MET CA HA sing N N 234 MET C O doub N N 235 MET C OXT sing N N 236 MET CB CG sing N N 237 MET CB HB2 sing N N 238 MET CB HB3 sing N N 239 MET CG SD sing N N 240 MET CG HG2 sing N N 241 MET CG HG3 sing N N 242 MET SD CE sing N N 243 MET CE HE1 sing N N 244 MET CE HE2 sing N N 245 MET CE HE3 sing N N 246 MET OXT HXT sing N N 247 PHE N CA sing N N 248 PHE N H sing N N 249 PHE N H2 sing N N 250 PHE CA C sing N N 251 PHE CA CB sing N N 252 PHE CA HA sing N N 253 PHE C O doub N N 254 PHE C OXT sing N N 255 PHE CB CG sing N N 256 PHE CB HB2 sing N N 257 PHE CB HB3 sing N N 258 PHE CG CD1 doub Y N 259 PHE CG CD2 sing Y N 260 PHE CD1 CE1 sing Y N 261 PHE CD1 HD1 sing N N 262 PHE CD2 CE2 doub Y N 263 PHE CD2 HD2 sing N N 264 PHE CE1 CZ doub Y N 265 PHE CE1 HE1 sing N N 266 PHE CE2 CZ sing Y N 267 PHE CE2 HE2 sing N N 268 PHE CZ HZ sing N N 269 PHE OXT HXT sing N N 270 PRO N CA sing N N 271 PRO N CD sing N N 272 PRO N H sing N N 273 PRO CA C sing N N 274 PRO CA CB sing N N 275 PRO CA HA sing N N 276 PRO C O doub N N 277 PRO C OXT sing N N 278 PRO CB CG sing N N 279 PRO CB HB2 sing N N 280 PRO CB HB3 sing N N 281 PRO CG CD sing N N 282 PRO CG HG2 sing N N 283 PRO CG HG3 sing N N 284 PRO CD HD2 sing N N 285 PRO CD HD3 sing N N 286 PRO OXT HXT sing N N 287 SER N CA sing N N 288 SER N H sing N N 289 SER N H2 sing N N 290 SER CA C sing N N 291 SER CA CB sing N N 292 SER CA HA sing N N 293 SER C O doub N N 294 SER C OXT sing N N 295 SER CB OG sing N N 296 SER CB HB2 sing N N 297 SER CB HB3 sing N N 298 SER OG HG sing N N 299 SER OXT HXT sing N N 300 THR N CA sing N N 301 THR N H sing N N 302 THR N H2 sing N N 303 THR CA C sing N N 304 THR CA CB sing N N 305 THR CA HA sing N N 306 THR C O doub N N 307 THR C OXT sing N N 308 THR CB OG1 sing N N 309 THR CB CG2 sing N N 310 THR CB HB sing N N 311 THR OG1 HG1 sing N N 312 THR CG2 HG21 sing N N 313 THR CG2 HG22 sing N N 314 THR CG2 HG23 sing N N 315 THR OXT HXT sing N N 316 TRP N CA sing N N 317 TRP N H sing N N 318 TRP N H2 sing N N 319 TRP CA C sing N N 320 TRP CA CB sing N N 321 TRP CA HA sing N N 322 TRP C O doub N N 323 TRP C OXT sing N N 324 TRP CB CG sing N N 325 TRP CB HB2 sing N N 326 TRP CB HB3 sing N N 327 TRP CG CD1 doub Y N 328 TRP CG CD2 sing Y N 329 TRP CD1 NE1 sing Y N 330 TRP CD1 HD1 sing N N 331 TRP CD2 CE2 doub Y N 332 TRP CD2 CE3 sing Y N 333 TRP NE1 CE2 sing Y N 334 TRP NE1 HE1 sing N N 335 TRP CE2 CZ2 sing Y N 336 TRP CE3 CZ3 doub Y N 337 TRP CE3 HE3 sing N N 338 TRP CZ2 CH2 doub Y N 339 TRP CZ2 HZ2 sing N N 340 TRP CZ3 CH2 sing Y N 341 TRP CZ3 HZ3 sing N N 342 TRP CH2 HH2 sing N N 343 TRP OXT HXT sing N N 344 TYR N CA sing N N 345 TYR N H sing N N 346 TYR N H2 sing N N 347 TYR CA C sing N N 348 TYR CA CB sing N N 349 TYR CA HA sing N N 350 TYR C O doub N N 351 TYR C OXT sing N N 352 TYR CB CG sing N N 353 TYR CB HB2 sing N N 354 TYR CB HB3 sing N N 355 TYR CG CD1 doub Y N 356 TYR CG CD2 sing Y N 357 TYR CD1 CE1 sing Y N 358 TYR CD1 HD1 sing N N 359 TYR CD2 CE2 doub Y N 360 TYR CD2 HD2 sing N N 361 TYR CE1 CZ doub Y N 362 TYR CE1 HE1 sing N N 363 TYR CE2 CZ sing Y N 364 TYR CE2 HE2 sing N N 365 TYR CZ OH sing N N 366 TYR OH HH sing N N 367 TYR OXT HXT sing N N 368 VAL N CA sing N N 369 VAL N H sing N N 370 VAL N H2 sing N N 371 VAL CA C sing N N 372 VAL CA CB sing N N 373 VAL CA HA sing N N 374 VAL C O doub N N 375 VAL C OXT sing N N 376 VAL CB CG1 sing N N 377 VAL CB CG2 sing N N 378 VAL CB HB sing N N 379 VAL CG1 HG11 sing N N 380 VAL CG1 HG12 sing N N 381 VAL CG1 HG13 sing N N 382 VAL CG2 HG21 sing N N 383 VAL CG2 HG22 sing N N 384 VAL CG2 HG23 sing N N 385 VAL OXT HXT sing N N 386 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 GLYCEROL GOL # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3AV0 _pdbx_initial_refinement_model.details ? #