data_3B32 # _entry.id 3B32 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.377 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3B32 pdb_00003b32 10.2210/pdb3b32/pdb RCSB RCSB045016 ? ? WWPDB D_1000045016 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3IFK _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3B32 _pdbx_database_status.recvd_initial_deposition_date 2007-10-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Newman, R.A.' 1 'Shea, M.A.' 2 # _citation.id primary _citation.title 'Thermodynamics and conformational change governing domain-domain interactions of calmodulin.' _citation.journal_abbrev 'Methods Enzymol.' _citation.journal_volume 466 _citation.page_first 503 _citation.page_last 526 _citation.year 2009 _citation.journal_id_ASTM MENZAU _citation.country US _citation.journal_id_ISSN 0076-6879 _citation.journal_id_CSD 0878 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21609874 _citation.pdbx_database_id_DOI '10.1016/S0076-6879(09)66021-3' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary ;O'Donnell, S.E. ; 1 ? primary 'Newman, R.A.' 2 ? primary 'Witt, T.J.' 3 ? primary 'Hultman, R.' 4 ? primary 'Froehlig, J.R.' 5 ? primary 'Christensen, A.P.' 6 ? primary 'Shea, M.A.' 7 ? # _cell.entry_id 3B32 _cell.length_a 34.352 _cell.length_b 66.096 _cell.length_c 57.823 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3B32 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 20 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 8323.156 1 ? ? 'N-Terminal Domain Fragment, Residues 1-75' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 water nat water 18.015 106 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CaM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK _entity_poly.pdbx_seq_one_letter_code_can ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 GLN n 1 4 LEU n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 GLN n 1 9 ILE n 1 10 ALA n 1 11 GLU n 1 12 PHE n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 PHE n 1 17 SER n 1 18 LEU n 1 19 PHE n 1 20 ASP n 1 21 LYS n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLY n 1 26 THR n 1 27 ILE n 1 28 THR n 1 29 THR n 1 30 LYS n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 MET n 1 37 ARG n 1 38 SER n 1 39 LEU n 1 40 GLY n 1 41 GLN n 1 42 ASN n 1 43 PRO n 1 44 THR n 1 45 GLU n 1 46 ALA n 1 47 GLU n 1 48 LEU n 1 49 GLN n 1 50 ASP n 1 51 MET n 1 52 ILE n 1 53 ASN n 1 54 GLU n 1 55 VAL n 1 56 ASP n 1 57 ALA n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 GLY n 1 62 THR n 1 63 ILE n 1 64 ASP n 1 65 PHE n 1 66 PRO n 1 67 GLU n 1 68 PHE n 1 69 LEU n 1 70 THR n 1 71 MET n 1 72 MET n 1 73 ALA n 1 74 ARG n 1 75 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Lys-S _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pT7-7 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALM_RAT _struct_ref.pdbx_db_accession P62161 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3B32 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62161 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3B32 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.97 _exptl_crystal.density_percent_sol 37.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_details '100 mM Na acetate, 0.01% Na azide, 21.25% PEG 8000, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2004-10-06 _diffrn_detector.details 'Osmic Blue Mirrors' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Ni Filter' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3B32 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 15.24 _reflns.d_resolution_high 1.45 _reflns.number_obs 11740 _reflns.number_all 11740 _reflns.percent_possible_obs 97.8 _reflns.pdbx_Rmerge_I_obs 0.049 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 19.4 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.45 _reflns_shell.d_res_low 1.53 _reflns_shell.percent_possible_all 94.2 _reflns_shell.Rmerge_I_obs 0.248 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.3 _reflns_shell.pdbx_redundancy 3.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3B32 _refine.ls_number_reflns_obs 8458 _refine.ls_number_reflns_all 8458 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 15.24 _refine.ls_d_res_high 1.60 _refine.ls_percent_reflns_obs 98.56 _refine.ls_R_factor_obs .20069 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work .19749 _refine.ls_R_factor_R_free .26916 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 418 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc .950 _refine.correlation_coeff_Fo_to_Fc_free .900 _refine.B_iso_mean 13.911 _refine.aniso_B[1][1] .66 _refine.aniso_B[2][2] .32 _refine.aniso_B[3][3] -.98 _refine.aniso_B[1][2] .00 _refine.aniso_B[1][3] .00 _refine.aniso_B[2][3] .00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii .80 _refine.pdbx_solvent_shrinkage_radii .80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 3CLN' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R .112 _refine.pdbx_overall_ESU_R_Free .125 _refine.overall_SU_ML .084 _refine.overall_SU_B 2.348 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 575 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 106 _refine_hist.number_atoms_total 683 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 15.24 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d .012 .022 ? 581 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.226 1.973 ? 781 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.592 5.000 ? 73 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 29.387 27.097 ? 31 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.072 15.000 ? 108 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.216 15.000 ? 2 'X-RAY DIFFRACTION' ? r_chiral_restr .076 .200 ? 88 'X-RAY DIFFRACTION' ? r_gen_planes_refined .004 .020 ? 441 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined .232 .200 ? 329 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined .308 .200 ? 419 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined .136 .200 ? 83 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined .089 .200 ? 8 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined .131 .200 ? 36 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined .346 .200 ? 24 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it .861 1.500 ? 375 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.279 2.000 ? 586 'X-RAY DIFFRACTION' ? r_scbond_it 2.379 3.000 ? 221 'X-RAY DIFFRACTION' ? r_scangle_it 3.962 4.500 ? 195 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.600 _refine_ls_shell.d_res_low 1.641 _refine_ls_shell.number_reflns_R_work 605 _refine_ls_shell.R_factor_R_work .403 _refine_ls_shell.percent_reflns_obs 96.77 _refine_ls_shell.R_factor_R_free .430 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 25 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3B32 _struct.title 'Crystal Structure of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3B32 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Calmodulin, EF hand motif, N-terminal domain, N-domain, Residues 1-75, Methylation, Phosphorylation, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? ASP A 20 ? THR A 5 ASP A 20 1 ? 16 HELX_P HELX_P2 2 THR A 28 ? LEU A 39 ? THR A 28 LEU A 39 1 ? 12 HELX_P HELX_P3 3 THR A 44 ? GLU A 54 ? THR A 44 GLU A 54 1 ? 11 HELX_P HELX_P4 4 ASP A 64 ? ARG A 74 ? ASP A 64 ARG A 74 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 20 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 20 A CA 76 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc2 metalc ? ? A ASP 22 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 22 A CA 76 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc3 metalc ? ? A ASP 24 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 24 A CA 76 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc4 metalc ? ? A THR 26 O ? ? ? 1_555 B CA . CA ? ? A THR 26 A CA 76 1_555 ? ? ? ? ? ? ? 2.377 ? ? metalc5 metalc ? ? A GLU 31 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 76 1_555 ? ? ? ? ? ? ? 2.480 ? ? metalc6 metalc ? ? A GLU 31 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 76 1_555 ? ? ? ? ? ? ? 2.464 ? ? metalc7 metalc ? ? A ASP 56 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 56 A CA 77 1_555 ? ? ? ? ? ? ? 2.248 ? ? metalc8 metalc ? ? A ASP 58 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 58 A CA 77 1_555 ? ? ? ? ? ? ? 2.401 ? ? metalc9 metalc ? ? A ASN 60 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 60 A CA 77 1_555 ? ? ? ? ? ? ? 2.470 ? ? metalc10 metalc ? ? A THR 62 O ? ? ? 1_555 C CA . CA ? ? A THR 62 A CA 77 1_555 ? ? ? ? ? ? ? 2.380 ? ? metalc11 metalc ? ? A GLU 67 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 77 1_555 ? ? ? ? ? ? ? 2.465 ? ? metalc12 metalc ? ? A GLU 67 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 77 1_555 ? ? ? ? ? ? ? 2.535 ? ? metalc13 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 76 A HOH 95 1_555 ? ? ? ? ? ? ? 2.543 ? ? metalc14 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 77 A HOH 112 1_555 ? ? ? ? ? ? ? 2.310 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 76 ? 6 'BINDING SITE FOR RESIDUE CA A 76' AC2 Software A CA 77 ? 6 'BINDING SITE FOR RESIDUE CA A 77' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 20 ? ASP A 20 . ? 1_555 ? 2 AC1 6 ASP A 22 ? ASP A 22 . ? 1_555 ? 3 AC1 6 ASP A 24 ? ASP A 24 . ? 1_555 ? 4 AC1 6 THR A 26 ? THR A 26 . ? 1_555 ? 5 AC1 6 GLU A 31 ? GLU A 31 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 95 . ? 1_555 ? 7 AC2 6 ASP A 56 ? ASP A 56 . ? 1_555 ? 8 AC2 6 ASP A 58 ? ASP A 58 . ? 1_555 ? 9 AC2 6 ASN A 60 ? ASN A 60 . ? 1_555 ? 10 AC2 6 THR A 62 ? THR A 62 . ? 1_555 ? 11 AC2 6 GLU A 67 ? GLU A 67 . ? 1_555 ? 12 AC2 6 HOH D . ? HOH A 112 . ? 1_555 ? # _database_PDB_matrix.entry_id 3B32 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3B32 _atom_sites.fract_transf_matrix[1][1] 0.029110 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015130 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017294 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 76 76 CA CA A . C 2 CA 1 77 77 CA CA A . D 3 HOH 1 78 1 HOH HOH A . D 3 HOH 2 79 2 HOH HOH A . D 3 HOH 3 80 3 HOH HOH A . D 3 HOH 4 81 4 HOH HOH A . D 3 HOH 5 82 5 HOH HOH A . D 3 HOH 6 83 6 HOH HOH A . D 3 HOH 7 84 7 HOH HOH A . D 3 HOH 8 85 8 HOH HOH A . D 3 HOH 9 86 9 HOH HOH A . D 3 HOH 10 87 10 HOH HOH A . D 3 HOH 11 88 11 HOH HOH A . D 3 HOH 12 89 12 HOH HOH A . D 3 HOH 13 90 13 HOH HOH A . D 3 HOH 14 91 14 HOH HOH A . D 3 HOH 15 92 15 HOH HOH A . D 3 HOH 16 93 16 HOH HOH A . D 3 HOH 17 94 17 HOH HOH A . D 3 HOH 18 95 18 HOH HOH A . D 3 HOH 19 96 19 HOH HOH A . D 3 HOH 20 97 20 HOH HOH A . D 3 HOH 21 98 21 HOH HOH A . D 3 HOH 22 99 22 HOH HOH A . D 3 HOH 23 100 23 HOH HOH A . D 3 HOH 24 101 24 HOH HOH A . D 3 HOH 25 102 25 HOH HOH A . D 3 HOH 26 103 26 HOH HOH A . D 3 HOH 27 104 27 HOH HOH A . D 3 HOH 28 105 28 HOH HOH A . D 3 HOH 29 106 29 HOH HOH A . D 3 HOH 30 107 30 HOH HOH A . D 3 HOH 31 108 31 HOH HOH A . D 3 HOH 32 109 32 HOH HOH A . D 3 HOH 33 110 33 HOH HOH A . D 3 HOH 34 111 34 HOH HOH A . D 3 HOH 35 112 35 HOH HOH A . D 3 HOH 36 113 36 HOH HOH A . D 3 HOH 37 114 37 HOH HOH A . D 3 HOH 38 115 38 HOH HOH A . D 3 HOH 39 116 39 HOH HOH A . D 3 HOH 40 117 40 HOH HOH A . D 3 HOH 41 118 41 HOH HOH A . D 3 HOH 42 119 42 HOH HOH A . D 3 HOH 43 120 43 HOH HOH A . D 3 HOH 44 121 44 HOH HOH A . D 3 HOH 45 122 45 HOH HOH A . D 3 HOH 46 123 46 HOH HOH A . D 3 HOH 47 124 47 HOH HOH A . D 3 HOH 48 125 48 HOH HOH A . D 3 HOH 49 126 49 HOH HOH A . D 3 HOH 50 127 50 HOH HOH A . D 3 HOH 51 128 51 HOH HOH A . D 3 HOH 52 129 52 HOH HOH A . D 3 HOH 53 130 53 HOH HOH A . D 3 HOH 54 131 54 HOH HOH A . D 3 HOH 55 132 55 HOH HOH A . D 3 HOH 56 133 56 HOH HOH A . D 3 HOH 57 134 57 HOH HOH A . D 3 HOH 58 135 58 HOH HOH A . D 3 HOH 59 136 59 HOH HOH A . D 3 HOH 60 137 60 HOH HOH A . D 3 HOH 61 138 61 HOH HOH A . D 3 HOH 62 139 62 HOH HOH A . D 3 HOH 63 140 63 HOH HOH A . D 3 HOH 64 141 64 HOH HOH A . D 3 HOH 65 142 65 HOH HOH A . D 3 HOH 66 143 66 HOH HOH A . D 3 HOH 67 144 67 HOH HOH A . D 3 HOH 68 145 68 HOH HOH A . D 3 HOH 69 146 69 HOH HOH A . D 3 HOH 70 147 70 HOH HOH A . D 3 HOH 71 148 71 HOH HOH A . D 3 HOH 72 149 72 HOH HOH A . D 3 HOH 73 150 73 HOH HOH A . D 3 HOH 74 151 74 HOH HOH A . D 3 HOH 75 152 75 HOH HOH A . D 3 HOH 76 153 76 HOH HOH A . D 3 HOH 77 154 77 HOH HOH A . D 3 HOH 78 155 78 HOH HOH A . D 3 HOH 79 156 79 HOH HOH A . D 3 HOH 80 157 80 HOH HOH A . D 3 HOH 81 158 81 HOH HOH A . D 3 HOH 82 159 82 HOH HOH A . D 3 HOH 83 160 83 HOH HOH A . D 3 HOH 84 161 84 HOH HOH A . D 3 HOH 85 162 85 HOH HOH A . D 3 HOH 86 163 86 HOH HOH A . D 3 HOH 87 164 87 HOH HOH A . D 3 HOH 88 165 88 HOH HOH A . D 3 HOH 89 166 89 HOH HOH A . D 3 HOH 90 167 90 HOH HOH A . D 3 HOH 91 168 91 HOH HOH A . D 3 HOH 92 169 92 HOH HOH A . D 3 HOH 93 170 93 HOH HOH A . D 3 HOH 94 171 94 HOH HOH A . D 3 HOH 95 172 95 HOH HOH A . D 3 HOH 96 173 96 HOH HOH A . D 3 HOH 97 174 97 HOH HOH A . D 3 HOH 98 175 98 HOH HOH A . D 3 HOH 99 176 99 HOH HOH A . D 3 HOH 100 177 100 HOH HOH A . D 3 HOH 101 178 101 HOH HOH A . D 3 HOH 102 179 102 HOH HOH A . D 3 HOH 103 180 103 HOH HOH A . D 3 HOH 104 181 104 HOH HOH A . D 3 HOH 105 182 105 HOH HOH A . D 3 HOH 106 183 106 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 3 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D 3 1,3 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 2370 ? 3 'ABSA (A^2)' 2370 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_455 -x-1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 -34.3520000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 28.9115000000 3 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 77.6 ? 2 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 84.4 ? 3 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 81.6 ? 4 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 85.7 ? 5 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 157.1 ? 6 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 81.3 ? 7 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 97.3 ? 8 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 74.9 ? 9 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 155.4 ? 10 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 123.2 ? 11 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 113.0 ? 12 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 127.3 ? 13 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 147.8 ? 14 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 73.6 ? 15 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 53.0 ? 16 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 O ? D HOH . ? A HOH 95 ? 1_555 160.2 ? 17 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 O ? D HOH . ? A HOH 95 ? 1_555 83.1 ? 18 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 O ? D HOH . ? A HOH 95 ? 1_555 88.8 ? 19 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 O ? D HOH . ? A HOH 95 ? 1_555 111.7 ? 20 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 O ? D HOH . ? A HOH 95 ? 1_555 81.3 ? 21 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 76 ? 1_555 O ? D HOH . ? A HOH 95 ? 1_555 82.1 ? 22 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 80.8 ? 23 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 84.1 ? 24 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 75.0 ? 25 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 87.8 ? 26 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 152.2 ? 27 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 78.7 ? 28 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 102.1 ? 29 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 127.1 ? 30 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 157.5 ? 31 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 80.0 ? 32 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 92.3 ? 33 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 75.3 ? 34 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 150.3 ? 35 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 130.8 ? 36 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 51.9 ? 37 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 O ? D HOH . ? A HOH 112 ? 1_555 166.2 ? 38 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 O ? D HOH . ? A HOH 112 ? 1_555 86.0 ? 39 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 O ? D HOH . ? A HOH 112 ? 1_555 88.4 ? 40 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 O ? D HOH . ? A HOH 112 ? 1_555 102.1 ? 41 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 O ? D HOH . ? A HOH 112 ? 1_555 89.2 ? 42 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 77 ? 1_555 O ? D HOH . ? A HOH 112 ? 1_555 88.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-11-13 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-03-21 4 'Structure model' 1 3 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_initial_refinement_model 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 4 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 5 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CrystalClear 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.2.0005 ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 105 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 105 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_555 _pdbx_validate_symm_contact.dist 1.32 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ALA _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ALA _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HOH O O N N 124 HOH H1 H N N 125 HOH H2 H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 VAL N N N N 287 VAL CA C N S 288 VAL C C N N 289 VAL O O N N 290 VAL CB C N N 291 VAL CG1 C N N 292 VAL CG2 C N N 293 VAL OXT O N N 294 VAL H H N N 295 VAL H2 H N N 296 VAL HA H N N 297 VAL HB H N N 298 VAL HG11 H N N 299 VAL HG12 H N N 300 VAL HG13 H N N 301 VAL HG21 H N N 302 VAL HG22 H N N 303 VAL HG23 H N N 304 VAL HXT H N N 305 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 VAL N CA sing N N 272 VAL N H sing N N 273 VAL N H2 sing N N 274 VAL CA C sing N N 275 VAL CA CB sing N N 276 VAL CA HA sing N N 277 VAL C O doub N N 278 VAL C OXT sing N N 279 VAL CB CG1 sing N N 280 VAL CB CG2 sing N N 281 VAL CB HB sing N N 282 VAL CG1 HG11 sing N N 283 VAL CG1 HG12 sing N N 284 VAL CG1 HG13 sing N N 285 VAL CG2 HG21 sing N N 286 VAL CG2 HG22 sing N N 287 VAL CG2 HG23 sing N N 288 VAL OXT HXT sing N N 289 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3CLN _pdbx_initial_refinement_model.details 'PDB ENTRY 3CLN' #