data_3BI3 # _entry.id 3BI3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3BI3 pdb_00003bi3 10.2210/pdb3bi3/pdb NDB PD1059 ? ? RCSB RCSB045548 ? ? WWPDB D_1000045548 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2FD8 'the same protein' unspecified PDB 2BHZ homolog unspecified PDB 2IUW homolog unspecified PDB 3BHZ . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3BI3 _pdbx_database_status.recvd_initial_deposition_date 2007-11-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yi, C.' 1 'Yang, C.-G.' 2 # _citation.id primary _citation.title 'Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.' _citation.journal_abbrev Nature _citation.journal_volume 452 _citation.page_first 961 _citation.page_last 965 _citation.year 2008 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18432238 _citation.pdbx_database_id_DOI 10.1038/nature06889 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, C.G.' 1 ? primary 'Yi, C.' 2 ? primary 'Duguid, E.M.' 3 ? primary 'Sullivan, C.T.' 4 ? primary 'Jian, X.' 5 ? primary 'Rice, P.A.' 6 ? primary 'He, C.' 7 ? # _cell.entry_id 3BI3 _cell.length_a 41.407 _cell.length_b 75.629 _cell.length_c 50.972 _cell.angle_alpha 90.00 _cell.angle_beta 107.73 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3BI3 _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Alpha-ketoglutarate-dependent dioxygenase alkB' 22314.504 1 1.14.11.- S129C 'catalytic repair domain' ? 2 polymer syn ;DNA (5'-D(*TP*AP*GP*GP*TP*AP*AP*(MA7)P*AP*(2YR)P*CP*GP*T)-3') ; 4074.788 1 ? ? ? ? 3 polymer syn ;DNA (5'-D(*DAP*DAP*DCP*DGP*DGP*DTP*DAP*DTP*DTP*DAP*DCP*DCP*DT)-3') ; 3950.598 1 ? ? ? ? 4 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 5 non-polymer syn '2-OXOGLUTARIC ACID' 146.098 1 ? ? ? ? 6 water nat water 18.015 168 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Alkylated DNA repair protein alkB' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAM PQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEH GDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG ; ;EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAM PQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEH GDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG ; A ? 2 polydeoxyribonucleotide no yes '(DT)(DA)(DG)(DG)(DT)(DA)(DA)(MA7)(DA)(2YR)(DC)(DG)(DT)' TAGGTAAAAXCGT B ? 3 polydeoxyribonucleotide no no '(DA)(DA)(DC)(DG)(DG)(DT)(DA)(DT)(DT)(DA)(DC)(DC)(DT)' AACGGTATTACCT C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PRO n 1 3 LEU n 1 4 ALA n 1 5 ALA n 1 6 GLY n 1 7 ALA n 1 8 VAL n 1 9 ILE n 1 10 LEU n 1 11 ARG n 1 12 ARG n 1 13 PHE n 1 14 ALA n 1 15 PHE n 1 16 ASN n 1 17 ALA n 1 18 ALA n 1 19 GLU n 1 20 GLN n 1 21 LEU n 1 22 ILE n 1 23 ARG n 1 24 ASP n 1 25 ILE n 1 26 ASN n 1 27 ASP n 1 28 VAL n 1 29 ALA n 1 30 SER n 1 31 GLN n 1 32 SER n 1 33 PRO n 1 34 PHE n 1 35 ARG n 1 36 GLN n 1 37 MET n 1 38 VAL n 1 39 THR n 1 40 PRO n 1 41 GLY n 1 42 GLY n 1 43 TYR n 1 44 THR n 1 45 MET n 1 46 SER n 1 47 VAL n 1 48 ALA n 1 49 MET n 1 50 THR n 1 51 ASN n 1 52 CYS n 1 53 GLY n 1 54 HIS n 1 55 LEU n 1 56 GLY n 1 57 TRP n 1 58 THR n 1 59 THR n 1 60 HIS n 1 61 ARG n 1 62 GLN n 1 63 GLY n 1 64 TYR n 1 65 LEU n 1 66 TYR n 1 67 SER n 1 68 PRO n 1 69 ILE n 1 70 ASP n 1 71 PRO n 1 72 GLN n 1 73 THR n 1 74 ASN n 1 75 LYS n 1 76 PRO n 1 77 TRP n 1 78 PRO n 1 79 ALA n 1 80 MET n 1 81 PRO n 1 82 GLN n 1 83 SER n 1 84 PHE n 1 85 HIS n 1 86 ASN n 1 87 LEU n 1 88 CYS n 1 89 GLN n 1 90 ARG n 1 91 ALA n 1 92 ALA n 1 93 THR n 1 94 ALA n 1 95 ALA n 1 96 GLY n 1 97 TYR n 1 98 PRO n 1 99 ASP n 1 100 PHE n 1 101 GLN n 1 102 PRO n 1 103 ASP n 1 104 ALA n 1 105 CYS n 1 106 LEU n 1 107 ILE n 1 108 ASN n 1 109 ARG n 1 110 TYR n 1 111 ALA n 1 112 PRO n 1 113 GLY n 1 114 ALA n 1 115 LYS n 1 116 LEU n 1 117 CYS n 1 118 LEU n 1 119 HIS n 1 120 GLN n 1 121 ASP n 1 122 LYS n 1 123 ASP n 1 124 GLU n 1 125 PRO n 1 126 ASP n 1 127 LEU n 1 128 ARG n 1 129 ALA n 1 130 PRO n 1 131 ILE n 1 132 VAL n 1 133 SER n 1 134 VAL n 1 135 SER n 1 136 LEU n 1 137 GLY n 1 138 LEU n 1 139 PRO n 1 140 ALA n 1 141 ILE n 1 142 PHE n 1 143 GLN n 1 144 PHE n 1 145 GLY n 1 146 GLY n 1 147 LEU n 1 148 LYS n 1 149 ARG n 1 150 ASN n 1 151 ASP n 1 152 PRO n 1 153 LEU n 1 154 LYS n 1 155 ARG n 1 156 LEU n 1 157 LEU n 1 158 LEU n 1 159 GLU n 1 160 HIS n 1 161 GLY n 1 162 ASP n 1 163 VAL n 1 164 VAL n 1 165 VAL n 1 166 TRP n 1 167 GLY n 1 168 GLY n 1 169 GLU n 1 170 SER n 1 171 ARG n 1 172 LEU n 1 173 PHE n 1 174 TYR n 1 175 HIS n 1 176 GLY n 1 177 ILE n 1 178 GLN n 1 179 PRO n 1 180 LEU n 1 181 LYS n 1 182 ALA n 1 183 GLY n 1 184 PHE n 1 185 HIS n 1 186 PRO n 1 187 LEU n 1 188 THR n 1 189 ILE n 1 190 ASP n 1 191 CYS n 1 192 ARG n 1 193 TYR n 1 194 ASN n 1 195 LEU n 1 196 THR n 1 197 PHE n 1 198 ARG n 1 199 GLN n 1 200 ALA n 1 201 GLY n 2 1 DT n 2 2 DA n 2 3 DG n 2 4 DG n 2 5 DT n 2 6 DA n 2 7 DA n 2 8 MA7 n 2 9 DA n 2 10 2YR n 2 11 DC n 2 12 DG n 2 13 DT n 3 1 DA n 3 2 DA n 3 3 DC n 3 4 DG n 3 5 DG n 3 6 DT n 3 7 DA n 3 8 DT n 3 9 DT n 3 10 DA n 3 11 DC n 3 12 DC n 3 13 DT n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene 'alkB, aidD' _entity_src_gen.gene_src_species 'Escherichia coli' _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP ALKB_ECOLI P05050 1 ;EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAM PQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEH GDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG ; 13 ? 2 PDB 3BI3 3BI3 2 TAGGTAAAACCGT 1 ? 3 PDB 3BI3 3BI3 3 AACGGTATTACCT 1 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3BI3 A 1 ? 201 ? P05050 13 ? 213 ? 13 213 2 2 3BI3 B 1 ? 13 ? 3BI3 1 ? 13 ? 1 13 3 3 3BI3 C 1 ? 13 ? 3BI3 1 ? 13 ? 1 13 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3BI3 _struct_ref_seq_dif.mon_id CYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 117 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P05050 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 129 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 129 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2YR non-polymer . ;2'-deoxy-N-(2-sulfanylethyl)cytidine 5'-(dihydrogen phosphate) ; ? 'C11 H18 N3 O7 P S' 367.315 AKG non-polymer . '2-OXOGLUTARIC ACID' ? 'C5 H6 O5' 146.098 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MA7 'DNA linking' n "1N-METHYLADENOSINE-5'-MONOPHOSPHATE" ? 'C11 H17 N5 O6 P 1' 346.256 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3BI3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.51 _exptl_crystal.density_percent_sol 50.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details ;20% (w/v) PEG 8K, 100 mM Sodium Chloride, 25 mM magnesium chloride, 0.1M cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K ; _exptl_crystal_grow.pdbx_pH_range . # loop_ _exptl_crystal_grow_comp.crystal_id _exptl_crystal_grow_comp.id _exptl_crystal_grow_comp.sol_id _exptl_crystal_grow_comp.name _exptl_crystal_grow_comp.volume _exptl_crystal_grow_comp.conc _exptl_crystal_grow_comp.details 1 1 1 'PEG 8K' ? ? ? 1 2 1 'Sodium Chloride' ? ? ? 1 3 1 'magnesium chloride' ? ? ? 1 4 1 cacodylate ? ? ? 1 5 2 'PEG 8K' ? ? ? 1 6 2 'Sodium Chloride' ? ? ? 1 7 2 'magnesium chloride' ? ? ? 1 8 2 cacodylate ? ? ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2007-11-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 14-BM-C' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 14-BM-C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3BI3 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.8 _reflns.number_obs 24645 _reflns.number_all 24645 _reflns.percent_possible_obs 89.7 _reflns.pdbx_Rmerge_I_obs 0.093 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 10 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.2 _reflns.R_free_details ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_all 69.8 _reflns_shell.Rmerge_I_obs 0.25 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.6 _reflns_shell.pdbx_redundancy 3.1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3BI3 _refine.ls_number_reflns_obs 20726 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.90 _refine.ls_percent_reflns_obs 92.53 _refine.ls_R_factor_obs 0.21634 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.21462 _refine.ls_R_factor_R_free 0.24714 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1114 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.934 _refine.correlation_coeff_Fo_to_Fc_free 0.913 _refine.B_iso_mean 32.669 _refine.aniso_B[1][1] -2.14 _refine.aniso_B[2][2] -2.55 _refine.aniso_B[3][3] 4.65 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.08 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.191 _refine.pdbx_overall_ESU_R_Free 0.164 _refine.overall_SU_ML 0.116 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 6.117 _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1572 _refine_hist.pdbx_number_atoms_nucleic_acid 515 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 168 _refine_hist.number_atoms_total 2266 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.006 0.021 ? 2247 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.093 2.254 ? 3163 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.651 5.000 ? 208 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.257 23.038 ? 79 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.089 15.000 ? 257 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.316 15.000 ? 14 'X-RAY DIFFRACTION' ? r_chiral_restr 0.061 0.200 ? 335 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.003 0.020 ? 1605 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.175 0.200 ? 937 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.299 0.200 ? 1420 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.097 0.200 ? 198 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.090 0.200 ? 32 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.106 0.200 ? 16 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.279 1.500 ? 1057 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 0.459 2.000 ? 1661 'X-RAY DIFFRACTION' ? r_scbond_it 0.643 3.000 ? 1532 'X-RAY DIFFRACTION' ? r_scangle_it 1.150 4.500 ? 1502 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.900 _refine_ls_shell.d_res_low 1.949 _refine_ls_shell.number_reflns_R_work 1263 _refine_ls_shell.R_factor_R_work 0.235 _refine_ls_shell.percent_reflns_obs 78.49 _refine_ls_shell.R_factor_R_free 0.234 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 65 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3BI3 _struct.title 'X-ray structure of AlkB protein bound to dsDNA containing 1meA/A with cofactors' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3BI3 _struct_keywords.pdbx_keywords Oxidoreductase/DNA _struct_keywords.text ;Dioxygenase, protein DNA interaction, alkylation repair, DNA damage, DNA repair, Iron, Metal-binding, Oxidoreductase, Oxidoreductase-DNA COMPLEX ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 6 ? H N N 6 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 17 ? SER A 30 ? ALA A 29 SER A 42 1 ? 14 HELX_P HELX_P2 2 PRO A 81 ? ALA A 95 ? PRO A 93 ALA A 107 1 ? 15 HELX_P HELX_P3 3 GLY A 167 ? ARG A 171 ? GLY A 179 ARG A 183 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A CYS 117 SG ? ? ? 1_555 B 2YR 10 S ? ? A CYS 129 B 2YR 10 1_555 ? ? ? ? ? ? ? 2.038 ? ? covale2 covale both ? B DA 7 "O3'" ? ? ? 1_555 B MA7 8 P ? ? B DA 7 B MA7 8 1_555 ? ? ? ? ? ? ? 1.596 ? ? covale3 covale both ? B MA7 8 "O3'" ? ? ? 1_555 B DA 9 P ? ? B MA7 8 B DA 9 1_555 ? ? ? ? ? ? ? 1.599 ? ? covale4 covale both ? B DA 9 "O3'" ? ? ? 1_555 B 2YR 10 P ? ? B DA 9 B 2YR 10 1_555 ? ? ? ? ? ? ? 1.595 ? ? covale5 covale both ? B 2YR 10 "O3'" ? ? ? 1_555 B DC 11 P ? ? B 2YR 10 B DC 11 1_555 ? ? ? ? ? ? ? 1.603 ? ? metalc1 metalc ? ? A HIS 119 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 131 A MN 301 1_555 ? ? ? ? ? ? ? 2.167 ? ? metalc2 metalc ? ? A ASP 121 OD1 ? ? ? 1_555 D MN . MN ? ? A ASP 133 A MN 301 1_555 ? ? ? ? ? ? ? 2.184 ? ? metalc3 metalc ? ? A HIS 175 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 187 A MN 301 1_555 ? ? ? ? ? ? ? 2.124 ? ? metalc4 metalc ? ? D MN . MN ? ? ? 1_555 E AKG . O2 ? ? A MN 301 A AKG 302 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc5 metalc ? ? D MN . MN ? ? ? 1_555 E AKG . O5 ? ? A MN 301 A AKG 302 1_555 ? ? ? ? ? ? ? 2.471 ? ? metalc6 metalc ? ? D MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 301 A HOH 427 1_555 ? ? ? ? ? ? ? 2.466 ? ? hydrog1 hydrog ? ? B DA 2 N1 ? ? ? 1_555 C DT 13 N3 ? ? B DA 2 C DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog2 hydrog ? ? B DA 2 N6 ? ? ? 1_555 C DT 13 O4 ? ? B DA 2 C DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog3 hydrog ? ? B DG 3 N1 ? ? ? 1_555 C DC 12 N3 ? ? B DG 3 C DC 12 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? ? hydrog4 hydrog ? ? B DG 4 N1 ? ? ? 1_555 C DC 11 N3 ? ? B DG 4 C DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? B DG 4 N2 ? ? ? 1_555 C DC 11 O2 ? ? B DG 4 C DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? B DG 4 O6 ? ? ? 1_555 C DC 11 N4 ? ? B DG 4 C DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? B DT 5 N3 ? ? ? 1_555 C DA 10 N1 ? ? B DT 5 C DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? B DT 5 O4 ? ? ? 1_555 C DA 10 N6 ? ? B DT 5 C DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog9 hydrog ? ? B DA 6 N1 ? ? ? 1_555 C DT 9 N3 ? ? B DA 6 C DT 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog10 hydrog ? ? B DA 6 N6 ? ? ? 1_555 C DT 9 O4 ? ? B DA 6 C DT 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog11 hydrog ? ? B DA 9 N1 ? ? ? 1_555 C DT 6 N3 ? ? B DA 9 C DT 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog12 hydrog ? ? B DA 9 N6 ? ? ? 1_555 C DT 6 O4 ? ? B DA 9 C DT 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog13 hydrog ? ? B DC 11 N3 ? ? ? 1_555 C DG 4 N1 ? ? B DC 11 C DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog14 hydrog ? ? B DC 11 N4 ? ? ? 1_555 C DG 4 O6 ? ? B DC 11 C DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? B DC 11 O2 ? ? ? 1_555 C DG 4 N2 ? ? B DC 11 C DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? B DG 12 N1 ? ? ? 1_555 C DC 3 N3 ? ? B DG 12 C DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? B DG 12 N2 ? ? ? 1_555 C DC 3 O2 ? ? B DG 12 C DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? B DG 12 O6 ? ? ? 1_555 C DC 3 N4 ? ? B DG 12 C DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog19 hydrog ? ? B DT 13 N3 ? ? ? 1_555 C DA 2 N1 ? ? B DT 13 C DA 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog20 hydrog ? ? B DT 13 O4 ? ? ? 1_555 C DA 2 N6 ? ? B DT 13 C DA 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? hydrog ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PRO A 2 ? ALA A 4 ? PRO A 14 ALA A 16 A 2 ALA A 7 ? LEU A 10 ? ALA A 19 LEU A 22 A 3 VAL A 163 ? TRP A 166 ? VAL A 175 TRP A 178 A 4 ILE A 131 ? GLY A 137 ? ILE A 143 GLY A 149 A 5 ARG A 192 ? ARG A 198 ? ARG A 204 ARG A 210 A 6 ALA A 104 ? TYR A 110 ? ALA A 116 TYR A 122 A 7 ALA A 48 ? CYS A 52 ? ALA A 60 CYS A 64 B 1 GLY A 56 ? HIS A 60 ? GLY A 68 HIS A 72 B 2 GLY A 63 ? SER A 67 ? GLY A 75 SER A 79 C 1 LEU A 116 ? HIS A 119 ? LEU A 128 HIS A 131 C 2 HIS A 175 ? ILE A 177 ? HIS A 187 ILE A 189 C 3 ALA A 140 ? PHE A 144 ? ALA A 152 PHE A 156 C 4 LYS A 154 ? LEU A 158 ? LYS A 166 LEU A 170 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 4 ? N ALA A 16 O ALA A 7 ? O ALA A 19 A 2 3 N LEU A 10 ? N LEU A 22 O VAL A 163 ? O VAL A 175 A 3 4 O TRP A 166 ? O TRP A 178 N ILE A 131 ? N ILE A 143 A 4 5 N VAL A 132 ? N VAL A 144 O PHE A 197 ? O PHE A 209 A 5 6 O ARG A 192 ? O ARG A 204 N TYR A 110 ? N TYR A 122 A 6 7 O ILE A 107 ? O ILE A 119 N THR A 50 ? N THR A 62 B 1 2 N GLY A 56 ? N GLY A 68 O SER A 67 ? O SER A 79 C 1 2 N LEU A 116 ? N LEU A 128 O ILE A 177 ? O ILE A 189 C 2 3 O GLY A 176 ? O GLY A 188 N GLN A 143 ? N GLN A 155 C 3 4 N PHE A 142 ? N PHE A 154 O LEU A 156 ? O LEU A 168 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 301 ? 5 'BINDING SITE FOR RESIDUE MN A 301' AC2 Software A AKG 302 ? 16 'BINDING SITE FOR RESIDUE AKG A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 119 ? HIS A 131 . ? 1_555 ? 2 AC1 5 ASP A 121 ? ASP A 133 . ? 1_555 ? 3 AC1 5 HIS A 175 ? HIS A 187 . ? 1_555 ? 4 AC1 5 AKG E . ? AKG A 302 . ? 1_555 ? 5 AC1 5 HOH F . ? HOH A 427 . ? 1_555 ? 6 AC2 16 LEU A 106 ? LEU A 118 . ? 1_555 ? 7 AC2 16 ASN A 108 ? ASN A 120 . ? 1_555 ? 8 AC2 16 TYR A 110 ? TYR A 122 . ? 1_555 ? 9 AC2 16 LEU A 116 ? LEU A 128 . ? 1_555 ? 10 AC2 16 HIS A 119 ? HIS A 131 . ? 1_555 ? 11 AC2 16 ASP A 121 ? ASP A 133 . ? 1_555 ? 12 AC2 16 HIS A 175 ? HIS A 187 . ? 1_555 ? 13 AC2 16 ILE A 177 ? ILE A 189 . ? 1_555 ? 14 AC2 16 ARG A 192 ? ARG A 204 . ? 1_555 ? 15 AC2 16 ASN A 194 ? ASN A 206 . ? 1_555 ? 16 AC2 16 THR A 196 ? THR A 208 . ? 1_555 ? 17 AC2 16 ARG A 198 ? ARG A 210 . ? 1_555 ? 18 AC2 16 MN D . ? MN A 301 . ? 1_555 ? 19 AC2 16 HOH F . ? HOH A 403 . ? 1_555 ? 20 AC2 16 HOH F . ? HOH A 427 . ? 1_555 ? 21 AC2 16 MA7 B 8 ? MA7 B 8 . ? 1_555 ? # _database_PDB_matrix.entry_id 3BI3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3BI3 _atom_sites.fract_transf_matrix[1][1] 0.024151 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007721 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013222 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020597 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 13 13 GLU GLU A . n A 1 2 PRO 2 14 14 PRO PRO A . n A 1 3 LEU 3 15 15 LEU LEU A . n A 1 4 ALA 4 16 16 ALA ALA A . n A 1 5 ALA 5 17 17 ALA ALA A . n A 1 6 GLY 6 18 18 GLY GLY A . n A 1 7 ALA 7 19 19 ALA ALA A . n A 1 8 VAL 8 20 20 VAL VAL A . n A 1 9 ILE 9 21 21 ILE ILE A . n A 1 10 LEU 10 22 22 LEU LEU A . n A 1 11 ARG 11 23 23 ARG ARG A . n A 1 12 ARG 12 24 24 ARG ARG A . n A 1 13 PHE 13 25 25 PHE PHE A . n A 1 14 ALA 14 26 26 ALA ALA A . n A 1 15 PHE 15 27 27 PHE PHE A . n A 1 16 ASN 16 28 28 ASN ASN A . n A 1 17 ALA 17 29 29 ALA ALA A . n A 1 18 ALA 18 30 30 ALA ALA A . n A 1 19 GLU 19 31 31 GLU GLU A . n A 1 20 GLN 20 32 32 GLN GLN A . n A 1 21 LEU 21 33 33 LEU LEU A . n A 1 22 ILE 22 34 34 ILE ILE A . n A 1 23 ARG 23 35 35 ARG ARG A . n A 1 24 ASP 24 36 36 ASP ASP A . n A 1 25 ILE 25 37 37 ILE ILE A . n A 1 26 ASN 26 38 38 ASN ASN A . n A 1 27 ASP 27 39 39 ASP ASP A . n A 1 28 VAL 28 40 40 VAL VAL A . n A 1 29 ALA 29 41 41 ALA ALA A . n A 1 30 SER 30 42 42 SER SER A . n A 1 31 GLN 31 43 43 GLN GLN A . n A 1 32 SER 32 44 44 SER SER A . n A 1 33 PRO 33 45 45 PRO PRO A . n A 1 34 PHE 34 46 46 PHE PHE A . n A 1 35 ARG 35 47 47 ARG ARG A . n A 1 36 GLN 36 48 48 GLN GLN A . n A 1 37 MET 37 49 49 MET MET A . n A 1 38 VAL 38 50 50 VAL VAL A . n A 1 39 THR 39 51 51 THR THR A . n A 1 40 PRO 40 52 52 PRO PRO A . n A 1 41 GLY 41 53 53 GLY GLY A . n A 1 42 GLY 42 54 54 GLY GLY A . n A 1 43 TYR 43 55 55 TYR TYR A . n A 1 44 THR 44 56 56 THR THR A . n A 1 45 MET 45 57 57 MET MET A . n A 1 46 SER 46 58 58 SER SER A . n A 1 47 VAL 47 59 59 VAL VAL A . n A 1 48 ALA 48 60 60 ALA ALA A . n A 1 49 MET 49 61 61 MET MET A . n A 1 50 THR 50 62 62 THR THR A . n A 1 51 ASN 51 63 63 ASN ASN A . n A 1 52 CYS 52 64 64 CYS CYS A . n A 1 53 GLY 53 65 65 GLY GLY A . n A 1 54 HIS 54 66 66 HIS HIS A . n A 1 55 LEU 55 67 67 LEU LEU A . n A 1 56 GLY 56 68 68 GLY GLY A . n A 1 57 TRP 57 69 69 TRP TRP A . n A 1 58 THR 58 70 70 THR THR A . n A 1 59 THR 59 71 71 THR THR A . n A 1 60 HIS 60 72 72 HIS HIS A . n A 1 61 ARG 61 73 73 ARG ARG A . n A 1 62 GLN 62 74 74 GLN GLN A . n A 1 63 GLY 63 75 75 GLY GLY A . n A 1 64 TYR 64 76 76 TYR TYR A . n A 1 65 LEU 65 77 77 LEU LEU A . n A 1 66 TYR 66 78 78 TYR TYR A . n A 1 67 SER 67 79 79 SER SER A . n A 1 68 PRO 68 80 80 PRO PRO A . n A 1 69 ILE 69 81 81 ILE ILE A . n A 1 70 ASP 70 82 82 ASP ASP A . n A 1 71 PRO 71 83 83 PRO PRO A . n A 1 72 GLN 72 84 84 GLN GLN A . n A 1 73 THR 73 85 85 THR THR A . n A 1 74 ASN 74 86 86 ASN ASN A . n A 1 75 LYS 75 87 87 LYS LYS A . n A 1 76 PRO 76 88 88 PRO PRO A . n A 1 77 TRP 77 89 89 TRP TRP A . n A 1 78 PRO 78 90 90 PRO PRO A . n A 1 79 ALA 79 91 91 ALA ALA A . n A 1 80 MET 80 92 92 MET MET A . n A 1 81 PRO 81 93 93 PRO PRO A . n A 1 82 GLN 82 94 94 GLN GLN A . n A 1 83 SER 83 95 95 SER SER A . n A 1 84 PHE 84 96 96 PHE PHE A . n A 1 85 HIS 85 97 97 HIS HIS A . n A 1 86 ASN 86 98 98 ASN ASN A . n A 1 87 LEU 87 99 99 LEU LEU A . n A 1 88 CYS 88 100 100 CYS CYS A . n A 1 89 GLN 89 101 101 GLN GLN A . n A 1 90 ARG 90 102 102 ARG ARG A . n A 1 91 ALA 91 103 103 ALA ALA A . n A 1 92 ALA 92 104 104 ALA ALA A . n A 1 93 THR 93 105 105 THR THR A . n A 1 94 ALA 94 106 106 ALA ALA A . n A 1 95 ALA 95 107 107 ALA ALA A . n A 1 96 GLY 96 108 108 GLY GLY A . n A 1 97 TYR 97 109 109 TYR TYR A . n A 1 98 PRO 98 110 110 PRO PRO A . n A 1 99 ASP 99 111 111 ASP ASP A . n A 1 100 PHE 100 112 112 PHE PHE A . n A 1 101 GLN 101 113 113 GLN GLN A . n A 1 102 PRO 102 114 114 PRO PRO A . n A 1 103 ASP 103 115 115 ASP ASP A . n A 1 104 ALA 104 116 116 ALA ALA A . n A 1 105 CYS 105 117 117 CYS CYS A . n A 1 106 LEU 106 118 118 LEU LEU A . n A 1 107 ILE 107 119 119 ILE ILE A . n A 1 108 ASN 108 120 120 ASN ASN A . n A 1 109 ARG 109 121 121 ARG ARG A . n A 1 110 TYR 110 122 122 TYR TYR A . n A 1 111 ALA 111 123 123 ALA ALA A . n A 1 112 PRO 112 124 124 PRO PRO A . n A 1 113 GLY 113 125 125 GLY GLY A . n A 1 114 ALA 114 126 126 ALA ALA A . n A 1 115 LYS 115 127 127 LYS LYS A . n A 1 116 LEU 116 128 128 LEU LEU A . n A 1 117 CYS 117 129 129 CYS CYS A . n A 1 118 LEU 118 130 130 LEU LEU A . n A 1 119 HIS 119 131 131 HIS HIS A . n A 1 120 GLN 120 132 132 GLN GLN A . n A 1 121 ASP 121 133 133 ASP ASP A . n A 1 122 LYS 122 134 134 LYS LYS A . n A 1 123 ASP 123 135 135 ASP ASP A . n A 1 124 GLU 124 136 136 GLU GLU A . n A 1 125 PRO 125 137 137 PRO PRO A . n A 1 126 ASP 126 138 138 ASP ASP A . n A 1 127 LEU 127 139 139 LEU LEU A . n A 1 128 ARG 128 140 140 ARG ARG A . n A 1 129 ALA 129 141 141 ALA ALA A . n A 1 130 PRO 130 142 142 PRO PRO A . n A 1 131 ILE 131 143 143 ILE ILE A . n A 1 132 VAL 132 144 144 VAL VAL A . n A 1 133 SER 133 145 145 SER SER A . n A 1 134 VAL 134 146 146 VAL VAL A . n A 1 135 SER 135 147 147 SER SER A . n A 1 136 LEU 136 148 148 LEU LEU A . n A 1 137 GLY 137 149 149 GLY GLY A . n A 1 138 LEU 138 150 150 LEU LEU A . n A 1 139 PRO 139 151 151 PRO PRO A . n A 1 140 ALA 140 152 152 ALA ALA A . n A 1 141 ILE 141 153 153 ILE ILE A . n A 1 142 PHE 142 154 154 PHE PHE A . n A 1 143 GLN 143 155 155 GLN GLN A . n A 1 144 PHE 144 156 156 PHE PHE A . n A 1 145 GLY 145 157 157 GLY GLY A . n A 1 146 GLY 146 158 158 GLY GLY A . n A 1 147 LEU 147 159 159 LEU LEU A . n A 1 148 LYS 148 160 160 LYS LYS A . n A 1 149 ARG 149 161 161 ARG ARG A . n A 1 150 ASN 150 162 162 ASN ASN A . n A 1 151 ASP 151 163 163 ASP ASP A . n A 1 152 PRO 152 164 164 PRO PRO A . n A 1 153 LEU 153 165 165 LEU LEU A . n A 1 154 LYS 154 166 166 LYS LYS A . n A 1 155 ARG 155 167 167 ARG ARG A . n A 1 156 LEU 156 168 168 LEU LEU A . n A 1 157 LEU 157 169 169 LEU LEU A . n A 1 158 LEU 158 170 170 LEU LEU A . n A 1 159 GLU 159 171 171 GLU GLU A . n A 1 160 HIS 160 172 172 HIS HIS A . n A 1 161 GLY 161 173 173 GLY GLY A . n A 1 162 ASP 162 174 174 ASP ASP A . n A 1 163 VAL 163 175 175 VAL VAL A . n A 1 164 VAL 164 176 176 VAL VAL A . n A 1 165 VAL 165 177 177 VAL VAL A . n A 1 166 TRP 166 178 178 TRP TRP A . n A 1 167 GLY 167 179 179 GLY GLY A . n A 1 168 GLY 168 180 180 GLY GLY A . n A 1 169 GLU 169 181 181 GLU GLU A . n A 1 170 SER 170 182 182 SER SER A . n A 1 171 ARG 171 183 183 ARG ARG A . n A 1 172 LEU 172 184 184 LEU LEU A . n A 1 173 PHE 173 185 185 PHE PHE A . n A 1 174 TYR 174 186 186 TYR TYR A . n A 1 175 HIS 175 187 187 HIS HIS A . n A 1 176 GLY 176 188 188 GLY GLY A . n A 1 177 ILE 177 189 189 ILE ILE A . n A 1 178 GLN 178 190 190 GLN GLN A . n A 1 179 PRO 179 191 191 PRO PRO A . n A 1 180 LEU 180 192 192 LEU LEU A . n A 1 181 LYS 181 193 193 LYS LYS A . n A 1 182 ALA 182 194 194 ALA ALA A . n A 1 183 GLY 183 195 195 GLY GLY A . n A 1 184 PHE 184 196 196 PHE PHE A . n A 1 185 HIS 185 197 197 HIS HIS A . n A 1 186 PRO 186 198 198 PRO PRO A . n A 1 187 LEU 187 199 199 LEU LEU A . n A 1 188 THR 188 200 200 THR THR A . n A 1 189 ILE 189 201 201 ILE ILE A . n A 1 190 ASP 190 202 202 ASP ASP A . n A 1 191 CYS 191 203 203 CYS CYS A . n A 1 192 ARG 192 204 204 ARG ARG A . n A 1 193 TYR 193 205 205 TYR TYR A . n A 1 194 ASN 194 206 206 ASN ASN A . n A 1 195 LEU 195 207 207 LEU LEU A . n A 1 196 THR 196 208 208 THR THR A . n A 1 197 PHE 197 209 209 PHE PHE A . n A 1 198 ARG 198 210 210 ARG ARG A . n A 1 199 GLN 199 211 211 GLN GLN A . n A 1 200 ALA 200 212 212 ALA ALA A . n A 1 201 GLY 201 213 213 GLY GLY A . n B 2 1 DT 1 1 ? ? ? B . n B 2 2 DA 2 2 2 DA DA B . n B 2 3 DG 3 3 3 DG DG B . n B 2 4 DG 4 4 4 DG DG B . n B 2 5 DT 5 5 5 DT DT B . n B 2 6 DA 6 6 6 DA DA B . n B 2 7 DA 7 7 7 DA DA B . n B 2 8 MA7 8 8 8 MA7 MA7 B . n B 2 9 DA 9 9 9 DA DA B . n B 2 10 2YR 10 10 10 2YR DC B . n B 2 11 DC 11 11 11 DC DC B . n B 2 12 DG 12 12 12 DG DG B . n B 2 13 DT 13 13 13 DT DT B . n C 3 1 DA 1 1 1 DA DA C . n C 3 2 DA 2 2 2 DA DA C . n C 3 3 DC 3 3 3 DC DC C . n C 3 4 DG 4 4 4 DG DG C . n C 3 5 DG 5 5 5 DG DG C . n C 3 6 DT 6 6 6 DT DT C . n C 3 7 DA 7 7 7 DA DA C . n C 3 8 DT 8 8 8 DT DT C . n C 3 9 DT 9 9 9 DT DT C . n C 3 10 DA 10 10 10 DA DA C . n C 3 11 DC 11 11 11 DC DC C . n C 3 12 DC 12 12 12 DC DC C . n C 3 13 DT 13 13 13 DT DT C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 MN 1 301 214 MN MN A . E 5 AKG 1 302 216 AKG AKG A . F 6 HOH 1 401 2 HOH HOH A . F 6 HOH 2 402 3 HOH HOH A . F 6 HOH 3 403 4 HOH HOH A . F 6 HOH 4 404 5 HOH HOH A . F 6 HOH 5 405 8 HOH HOH A . F 6 HOH 6 406 9 HOH HOH A . F 6 HOH 7 407 10 HOH HOH A . F 6 HOH 8 408 11 HOH HOH A . F 6 HOH 9 409 12 HOH HOH A . F 6 HOH 10 410 13 HOH HOH A . F 6 HOH 11 411 14 HOH HOH A . F 6 HOH 12 412 15 HOH HOH A . F 6 HOH 13 413 16 HOH HOH A . F 6 HOH 14 414 17 HOH HOH A . F 6 HOH 15 415 18 HOH HOH A . F 6 HOH 16 416 19 HOH HOH A . F 6 HOH 17 417 21 HOH HOH A . F 6 HOH 18 418 22 HOH HOH A . F 6 HOH 19 419 23 HOH HOH A . F 6 HOH 20 420 25 HOH HOH A . F 6 HOH 21 421 26 HOH HOH A . F 6 HOH 22 422 27 HOH HOH A . F 6 HOH 23 423 28 HOH HOH A . F 6 HOH 24 424 30 HOH HOH A . F 6 HOH 25 425 32 HOH HOH A . F 6 HOH 26 426 33 HOH HOH A . F 6 HOH 27 427 34 HOH HOH A . F 6 HOH 28 428 35 HOH HOH A . F 6 HOH 29 429 36 HOH HOH A . F 6 HOH 30 430 37 HOH HOH A . F 6 HOH 31 431 38 HOH HOH A . F 6 HOH 32 432 39 HOH HOH A . F 6 HOH 33 433 40 HOH HOH A . F 6 HOH 34 434 41 HOH HOH A . F 6 HOH 35 435 42 HOH HOH A . F 6 HOH 36 436 43 HOH HOH A . F 6 HOH 37 437 45 HOH HOH A . F 6 HOH 38 438 46 HOH HOH A . F 6 HOH 39 439 49 HOH HOH A . F 6 HOH 40 440 50 HOH HOH A . F 6 HOH 41 441 52 HOH HOH A . F 6 HOH 42 442 53 HOH HOH A . F 6 HOH 43 443 54 HOH HOH A . F 6 HOH 44 444 56 HOH HOH A . F 6 HOH 45 445 59 HOH HOH A . F 6 HOH 46 446 60 HOH HOH A . F 6 HOH 47 447 61 HOH HOH A . F 6 HOH 48 448 62 HOH HOH A . F 6 HOH 49 449 64 HOH HOH A . F 6 HOH 50 450 66 HOH HOH A . F 6 HOH 51 451 67 HOH HOH A . F 6 HOH 52 452 68 HOH HOH A . F 6 HOH 53 453 69 HOH HOH A . F 6 HOH 54 454 70 HOH HOH A . F 6 HOH 55 455 71 HOH HOH A . F 6 HOH 56 456 73 HOH HOH A . F 6 HOH 57 457 74 HOH HOH A . F 6 HOH 58 458 77 HOH HOH A . F 6 HOH 59 459 78 HOH HOH A . F 6 HOH 60 460 79 HOH HOH A . F 6 HOH 61 461 80 HOH HOH A . F 6 HOH 62 462 81 HOH HOH A . F 6 HOH 63 463 83 HOH HOH A . F 6 HOH 64 464 84 HOH HOH A . F 6 HOH 65 465 85 HOH HOH A . F 6 HOH 66 466 86 HOH HOH A . F 6 HOH 67 467 87 HOH HOH A . F 6 HOH 68 468 88 HOH HOH A . F 6 HOH 69 469 89 HOH HOH A . F 6 HOH 70 470 90 HOH HOH A . F 6 HOH 71 471 91 HOH HOH A . F 6 HOH 72 472 92 HOH HOH A . F 6 HOH 73 473 93 HOH HOH A . F 6 HOH 74 474 94 HOH HOH A . F 6 HOH 75 475 97 HOH HOH A . F 6 HOH 76 476 98 HOH HOH A . F 6 HOH 77 477 99 HOH HOH A . F 6 HOH 78 478 102 HOH HOH A . F 6 HOH 79 479 103 HOH HOH A . F 6 HOH 80 480 104 HOH HOH A . F 6 HOH 81 481 105 HOH HOH A . F 6 HOH 82 482 107 HOH HOH A . F 6 HOH 83 483 108 HOH HOH A . F 6 HOH 84 484 109 HOH HOH A . F 6 HOH 85 485 110 HOH HOH A . F 6 HOH 86 486 113 HOH HOH A . F 6 HOH 87 487 114 HOH HOH A . F 6 HOH 88 488 117 HOH HOH A . F 6 HOH 89 489 118 HOH HOH A . F 6 HOH 90 490 120 HOH HOH A . F 6 HOH 91 491 121 HOH HOH A . F 6 HOH 92 492 122 HOH HOH A . F 6 HOH 93 493 124 HOH HOH A . F 6 HOH 94 494 126 HOH HOH A . F 6 HOH 95 495 127 HOH HOH A . F 6 HOH 96 496 128 HOH HOH A . F 6 HOH 97 497 129 HOH HOH A . F 6 HOH 98 498 130 HOH HOH A . F 6 HOH 99 499 131 HOH HOH A . F 6 HOH 100 500 132 HOH HOH A . F 6 HOH 101 501 133 HOH HOH A . F 6 HOH 102 502 134 HOH HOH A . F 6 HOH 103 503 135 HOH HOH A . F 6 HOH 104 504 136 HOH HOH A . F 6 HOH 105 505 137 HOH HOH A . F 6 HOH 106 506 138 HOH HOH A . F 6 HOH 107 507 139 HOH HOH A . F 6 HOH 108 508 140 HOH HOH A . F 6 HOH 109 509 141 HOH HOH A . F 6 HOH 110 510 142 HOH HOH A . F 6 HOH 111 511 143 HOH HOH A . F 6 HOH 112 512 144 HOH HOH A . F 6 HOH 113 513 145 HOH HOH A . F 6 HOH 114 514 146 HOH HOH A . F 6 HOH 115 515 147 HOH HOH A . F 6 HOH 116 516 148 HOH HOH A . F 6 HOH 117 517 149 HOH HOH A . F 6 HOH 118 518 150 HOH HOH A . F 6 HOH 119 519 151 HOH HOH A . F 6 HOH 120 520 152 HOH HOH A . F 6 HOH 121 521 153 HOH HOH A . F 6 HOH 122 522 155 HOH HOH A . F 6 HOH 123 523 157 HOH HOH A . F 6 HOH 124 524 158 HOH HOH A . F 6 HOH 125 525 159 HOH HOH A . F 6 HOH 126 526 160 HOH HOH A . F 6 HOH 127 527 161 HOH HOH A . F 6 HOH 128 528 162 HOH HOH A . F 6 HOH 129 529 163 HOH HOH A . F 6 HOH 130 530 167 HOH HOH A . F 6 HOH 131 531 168 HOH HOH A . G 6 HOH 1 101 1 HOH HOH B . G 6 HOH 2 102 6 HOH HOH B . G 6 HOH 3 103 29 HOH HOH B . G 6 HOH 4 104 31 HOH HOH B . G 6 HOH 5 105 44 HOH HOH B . G 6 HOH 6 106 47 HOH HOH B . G 6 HOH 7 107 48 HOH HOH B . G 6 HOH 8 108 55 HOH HOH B . G 6 HOH 9 109 57 HOH HOH B . G 6 HOH 10 110 58 HOH HOH B . G 6 HOH 11 111 63 HOH HOH B . G 6 HOH 12 112 75 HOH HOH B . G 6 HOH 13 113 82 HOH HOH B . G 6 HOH 14 114 95 HOH HOH B . G 6 HOH 15 115 96 HOH HOH B . G 6 HOH 16 116 101 HOH HOH B . G 6 HOH 17 117 106 HOH HOH B . G 6 HOH 18 118 119 HOH HOH B . G 6 HOH 19 119 123 HOH HOH B . G 6 HOH 20 120 125 HOH HOH B . G 6 HOH 21 121 165 HOH HOH B . H 6 HOH 1 101 7 HOH HOH C . H 6 HOH 2 102 20 HOH HOH C . H 6 HOH 3 103 24 HOH HOH C . H 6 HOH 4 104 51 HOH HOH C . H 6 HOH 5 105 65 HOH HOH C . H 6 HOH 6 106 72 HOH HOH C . H 6 HOH 7 107 76 HOH HOH C . H 6 HOH 8 108 100 HOH HOH C . H 6 HOH 9 109 111 HOH HOH C . H 6 HOH 10 110 112 HOH HOH C . H 6 HOH 11 111 115 HOH HOH C . H 6 HOH 12 112 116 HOH HOH C . H 6 HOH 13 113 154 HOH HOH C . H 6 HOH 14 114 156 HOH HOH C . H 6 HOH 15 115 164 HOH HOH C . H 6 HOH 16 116 166 HOH HOH C . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id MA7 _pdbx_struct_mod_residue.label_seq_id 8 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id MA7 _pdbx_struct_mod_residue.auth_seq_id 8 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id DA _pdbx_struct_mod_residue.details "1N-METHYLADENOSINE-5'-MONOPHOSPHATE" # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_prop.biol_id 1 _pdbx_struct_assembly_prop.type 'ABSA (A^2)' _pdbx_struct_assembly_prop.value 4280 _pdbx_struct_assembly_prop.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 119 ? A HIS 131 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 OD1 ? A ASP 121 ? A ASP 133 ? 1_555 96.2 ? 2 NE2 ? A HIS 119 ? A HIS 131 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 NE2 ? A HIS 175 ? A HIS 187 ? 1_555 94.0 ? 3 OD1 ? A ASP 121 ? A ASP 133 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 NE2 ? A HIS 175 ? A HIS 187 ? 1_555 93.5 ? 4 NE2 ? A HIS 119 ? A HIS 131 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O2 ? E AKG . ? A AKG 302 ? 1_555 98.6 ? 5 OD1 ? A ASP 121 ? A ASP 133 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O2 ? E AKG . ? A AKG 302 ? 1_555 104.4 ? 6 NE2 ? A HIS 175 ? A HIS 187 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O2 ? E AKG . ? A AKG 302 ? 1_555 156.7 ? 7 NE2 ? A HIS 119 ? A HIS 131 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O5 ? E AKG . ? A AKG 302 ? 1_555 90.8 ? 8 OD1 ? A ASP 121 ? A ASP 133 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O5 ? E AKG . ? A AKG 302 ? 1_555 171.7 ? 9 NE2 ? A HIS 175 ? A HIS 187 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O5 ? E AKG . ? A AKG 302 ? 1_555 90.4 ? 10 O2 ? E AKG . ? A AKG 302 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O5 ? E AKG . ? A AKG 302 ? 1_555 70.0 ? 11 NE2 ? A HIS 119 ? A HIS 131 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O ? F HOH . ? A HOH 427 ? 1_555 174.1 ? 12 OD1 ? A ASP 121 ? A ASP 133 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O ? F HOH . ? A HOH 427 ? 1_555 89.7 ? 13 NE2 ? A HIS 175 ? A HIS 187 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O ? F HOH . ? A HOH 427 ? 1_555 86.4 ? 14 O2 ? E AKG . ? A AKG 302 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O ? F HOH . ? A HOH 427 ? 1_555 79.1 ? 15 O5 ? E AKG . ? A AKG 302 ? 1_555 MN ? D MN . ? A MN 301 ? 1_555 O ? F HOH . ? A HOH 427 ? 1_555 83.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2014-05-21 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Refinement description' 3 2 'Structure model' 'Version format compliance' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 18 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 4 'Structure model' '_struct_ref_seq_dif.details' 32 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 33 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 34 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -6.5917 _pdbx_refine_tls.origin_y 1.7121 _pdbx_refine_tls.origin_z -23.2903 _pdbx_refine_tls.T[1][1] -0.1581 _pdbx_refine_tls.T[2][2] -0.1479 _pdbx_refine_tls.T[3][3] -0.1743 _pdbx_refine_tls.T[1][2] -0.0012 _pdbx_refine_tls.T[1][3] -0.0212 _pdbx_refine_tls.T[2][3] 0.0171 _pdbx_refine_tls.L[1][1] 2.2419 _pdbx_refine_tls.L[2][2] 2.5970 _pdbx_refine_tls.L[3][3] 0.5785 _pdbx_refine_tls.L[1][2] -0.1061 _pdbx_refine_tls.L[1][3] -0.3796 _pdbx_refine_tls.L[2][3] 0.4873 _pdbx_refine_tls.S[1][1] -0.0304 _pdbx_refine_tls.S[2][2] 0.0229 _pdbx_refine_tls.S[3][3] 0.0075 _pdbx_refine_tls.S[1][2] 0.0560 _pdbx_refine_tls.S[1][3] 0.1167 _pdbx_refine_tls.S[2][3] 0.0618 _pdbx_refine_tls.S[2][1] -0.1516 _pdbx_refine_tls.S[3][1] -0.0290 _pdbx_refine_tls.S[3][2] 0.0066 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 13 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 213 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 ADSC 'data collection' Quantum ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 PHASES phasing . ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "C3'" B DA 6 ? ? "O3'" B DA 6 ? ? P B DA 7 ? ? 127.11 119.70 7.41 1.20 Y 2 1 "O4'" C DG 4 ? ? "C1'" C DG 4 ? ? N9 C DG 4 ? ? 111.21 108.30 2.91 0.30 N 3 1 "O4'" C DT 6 ? ? "C1'" C DT 6 ? ? N1 C DT 6 ? ? 111.51 108.30 3.21 0.30 N 4 1 "O4'" C DA 7 ? ? "C1'" C DA 7 ? ? N9 C DA 7 ? ? 110.99 108.30 2.69 0.30 N 5 1 "C3'" C DT 8 ? ? "O3'" C DT 8 ? ? P C DT 9 ? ? 128.25 119.70 8.55 1.20 Y 6 1 "C3'" C DA 10 ? ? "O3'" C DA 10 ? ? P C DC 11 ? ? 128.08 119.70 8.38 1.20 Y 7 1 "O4'" C DC 11 ? ? "C1'" C DC 11 ? ? N1 C DC 11 ? ? 110.88 108.30 2.58 0.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 14 ? ? -67.94 97.03 2 1 ARG A 24 ? B 59.81 18.82 3 1 ILE A 201 ? ? 67.83 -72.40 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id B _pdbx_unobs_or_zero_occ_residues.auth_comp_id DT _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id B _pdbx_unobs_or_zero_occ_residues.label_comp_id DT _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 3BI3 'double helix' 3BI3 'b-form double helix' 3BI3 'internal loop' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'MANGANESE (II) ION' MN 5 '2-OXOGLUTARIC ACID' AKG 6 water HOH #