data_3BUT # _entry.id 3BUT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3BUT pdb_00003but 10.2210/pdb3but/pdb RCSB RCSB045982 ? ? WWPDB D_1000045982 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-10193b _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3BUT _pdbx_database_status.recvd_initial_deposition_date 2008-01-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bonanno, J.B.' 1 ? 'Patskovsky, Y.' 2 ? 'Ozyurt, S.' 3 ? 'Ashok, S.' 4 ? 'Zhang, F.' 5 ? 'Groshong, C.' 6 ? 'Wasserman, S.R.' 7 ? 'Sauder, J.M.' 8 0000-0002-0254-4955 'Burley, S.K.' 9 0000-0002-2487-9713 'Almo, S.C.' 10 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 11 ? # _citation.id primary _citation.title 'Crystal structure of protein Af_0446 from Archaeoglobus fulgidus.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bonanno, J.B.' 1 ? primary 'Patskovsky, Y.' 2 ? primary 'Ozyurt, S.' 3 ? primary 'Ashok, S.' 4 ? primary 'Zhang, F.' 5 ? primary 'Groshong, C.' 6 ? primary 'Wasserman, S.R.' 7 ? primary 'Sauder, J.M.' 8 ? primary 'Burley, S.K.' 9 0000-0002-2487-9713 primary 'Almo, S.C.' 10 ? # _cell.entry_id 3BUT _cell.length_a 131.050 _cell.length_b 28.330 _cell.length_c 29.510 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3BUT _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein Af_0446' 15424.122 1 ? 'K62A, K64A, L78I, I104V' ? ? 2 water nat water 18.015 50 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SLESVKA(MSE)WGVVTDSQTEIVALAKVRNEDVVPIVVSGYHYTIE(MSE)NGVKVADGYENSPVTVKPASATT LKFSLRLNNSFLREWWVTHIANGEKTKIRVAIKPTIEIGGRDVEVPVFLRESEFTTKLLSEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLESVKAMWGVVTDSQTEIVALAKVRNEDVVPIVVSGYHYTIEMNGVKVADGYENSPVTVKPASATTLKFSLRLNNSFL REWWVTHIANGEKTKIRVAIKPTIEIGGRDVEVPVFLRESEFTTKLLSEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-10193b # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 LEU n 1 4 GLU n 1 5 SER n 1 6 VAL n 1 7 LYS n 1 8 ALA n 1 9 MSE n 1 10 TRP n 1 11 GLY n 1 12 VAL n 1 13 VAL n 1 14 THR n 1 15 ASP n 1 16 SER n 1 17 GLN n 1 18 THR n 1 19 GLU n 1 20 ILE n 1 21 VAL n 1 22 ALA n 1 23 LEU n 1 24 ALA n 1 25 LYS n 1 26 VAL n 1 27 ARG n 1 28 ASN n 1 29 GLU n 1 30 ASP n 1 31 VAL n 1 32 VAL n 1 33 PRO n 1 34 ILE n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 GLY n 1 39 TYR n 1 40 HIS n 1 41 TYR n 1 42 THR n 1 43 ILE n 1 44 GLU n 1 45 MSE n 1 46 ASN n 1 47 GLY n 1 48 VAL n 1 49 LYS n 1 50 VAL n 1 51 ALA n 1 52 ASP n 1 53 GLY n 1 54 TYR n 1 55 GLU n 1 56 ASN n 1 57 SER n 1 58 PRO n 1 59 VAL n 1 60 THR n 1 61 VAL n 1 62 LYS n 1 63 PRO n 1 64 ALA n 1 65 SER n 1 66 ALA n 1 67 THR n 1 68 THR n 1 69 LEU n 1 70 LYS n 1 71 PHE n 1 72 SER n 1 73 LEU n 1 74 ARG n 1 75 LEU n 1 76 ASN n 1 77 ASN n 1 78 SER n 1 79 PHE n 1 80 LEU n 1 81 ARG n 1 82 GLU n 1 83 TRP n 1 84 TRP n 1 85 VAL n 1 86 THR n 1 87 HIS n 1 88 ILE n 1 89 ALA n 1 90 ASN n 1 91 GLY n 1 92 GLU n 1 93 LYS n 1 94 THR n 1 95 LYS n 1 96 ILE n 1 97 ARG n 1 98 VAL n 1 99 ALA n 1 100 ILE n 1 101 LYS n 1 102 PRO n 1 103 THR n 1 104 ILE n 1 105 GLU n 1 106 ILE n 1 107 GLY n 1 108 GLY n 1 109 ARG n 1 110 ASP n 1 111 VAL n 1 112 GLU n 1 113 VAL n 1 114 PRO n 1 115 VAL n 1 116 PHE n 1 117 LEU n 1 118 ARG n 1 119 GLU n 1 120 SER n 1 121 GLU n 1 122 PHE n 1 123 THR n 1 124 THR n 1 125 LYS n 1 126 LEU n 1 127 LEU n 1 128 SER n 1 129 GLU n 1 130 GLY n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Archaeoglobus _entity_src_gen.pdbx_gene_src_gene AF_0446 _entity_src_gen.gene_src_species 'Archaeoglobus fulgidus' _entity_src_gen.gene_src_strain 'DSM 4304, VC-16, JCM 9628, NBRC 100126' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Archaeoglobus fulgidus DSM 4304' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224325 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 49558 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector pET _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'BC-pSGX3(BC)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O29803_ARCFU _struct_ref.pdbx_db_accession O29803 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ESVKAMWGVVTDSQTEIVALAKVRNEDVVPIVVSGYHYTIEMNGVKVADGYENSPVTVKPKSKTTLKFSLRLNNSFIREW WVTHIANGEKTKIRVAIKPTIEVGGRDVEVPVFLRESEFTTKLLS ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3BUT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O29803 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 126 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3BUT MSE A 1 ? UNP O29803 ? ? 'expression tag' -1 1 1 3BUT SER A 2 ? UNP O29803 ? ? 'expression tag' 0 2 1 3BUT LEU A 3 ? UNP O29803 ? ? 'expression tag' 1 3 1 3BUT ALA A 64 ? UNP O29803 LYS 62 'engineered mutation' 62 4 1 3BUT ALA A 66 ? UNP O29803 LYS 64 'engineered mutation' 64 5 1 3BUT LEU A 80 ? UNP O29803 ILE 78 'engineered mutation' 78 6 1 3BUT ILE A 106 ? UNP O29803 VAL 104 'engineered mutation' 104 7 1 3BUT GLU A 129 ? UNP O29803 ? ? 'expression tag' 127 8 1 3BUT GLY A 130 ? UNP O29803 ? ? 'expression tag' 128 9 1 3BUT HIS A 131 ? UNP O29803 ? ? 'expression tag' 129 10 1 3BUT HIS A 132 ? UNP O29803 ? ? 'expression tag' 130 11 1 3BUT HIS A 133 ? UNP O29803 ? ? 'expression tag' 131 12 1 3BUT HIS A 134 ? UNP O29803 ? ? 'expression tag' 132 13 1 3BUT HIS A 135 ? UNP O29803 ? ? 'expression tag' 133 14 1 3BUT HIS A 136 ? UNP O29803 ? ? 'expression tag' 134 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3BUT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.82 _exptl_crystal.density_percent_sol 32.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '20% PEG 3350, 35mM Proline, 200mM Sodium formate, 10% Glycerol, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 294K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 77.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2007-12-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Diamond _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97960 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 31-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 31-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97960 # _reflns.entry_id 3BUT _reflns.observed_criterion_sigma_I -0.500 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 1.900 _reflns.number_obs 9264 _reflns.number_all ? _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.142 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 4.4000 _reflns.B_iso_Wilson_estimate 34.66 _reflns.pdbx_redundancy 7.500 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.97 _reflns_shell.percent_possible_all 97.1 _reflns_shell.Rmerge_I_obs 0.63 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 0.800 _reflns_shell.pdbx_redundancy 3.40 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3BUT _refine.ls_number_reflns_obs 7375 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.91 _refine.ls_percent_reflns_obs 83.01 _refine.ls_R_factor_obs 0.22816 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.22606 _refine.ls_R_factor_R_free 0.29963 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 3.0 _refine.ls_number_reflns_R_free 231 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.950 _refine.correlation_coeff_Fo_to_Fc_free 0.916 _refine.B_iso_mean 28.881 _refine.aniso_B[1][1] 0.55 _refine.aniso_B[2][2] -0.16 _refine.aniso_B[3][3] -0.40 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.50 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. ANISOTROPY CORRECTION WAS APPLIED TO DIFFRACTION DATA. 3. UNDEFINED LIGAND OR COFACTOR IS BOUND INTO THE CENTRAL CAVITY, A PART OF IT IS MOST LIKELY A LIPID. THIS LIGAND HAS NOT BEEN MODELED. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.278 _refine.pdbx_overall_ESU_R_Free 0.236 _refine.overall_SU_ML 0.162 _refine.overall_SU_B 12.517 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 985 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 1035 _refine_hist.d_res_high 1.91 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.007 0.022 ? 1064 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.122 1.959 ? 1454 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.489 5.000 ? 140 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.760 24.091 ? 44 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 17.893 15.000 ? 203 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 25.339 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.074 0.200 ? 174 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.003 0.020 ? 777 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.127 0.300 ? 363 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.299 0.500 ? 701 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.145 0.500 ? 99 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.104 0.300 ? 64 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.159 0.500 ? 19 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 5.398 2.500 ? 669 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 6.871 3.000 ? 1073 'X-RAY DIFFRACTION' ? r_scbond_it 10.757 3.500 ? 449 'X-RAY DIFFRACTION' ? r_scangle_it 14.800 5.000 ? 372 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.91 _refine_ls_shell.d_res_low 1.96 _refine_ls_shell.number_reflns_R_work 107 _refine_ls_shell.R_factor_R_work 0.287 _refine_ls_shell.percent_reflns_obs 16.52 _refine_ls_shell.R_factor_R_free 0.36 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 3 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3BUT _struct.title 'Crystal structure of protein Af_0446 from Archaeoglobus fulgidus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3BUT _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;LIPID BINDING PROTEIN, BETA BARREL, PROTEIN STRUCTURE INITIATIVE, PSI-2, New York SGX Research Center for Structural Genomics, NYSGXRC, STRUCTURAL GENOMICS, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'AUTHORS STATE THAT THE DIMERIC ASSEMBLY OF THE BIOLOGICAL UNIT THAT IS SHOWN IN REMARK 350 IS PUTATIVE AT THE TIME OF DEPOSITION.' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 77 ? ARG A 81 ? ASN A 75 ARG A 79 1 ? 5 HELX_P HELX_P2 2 GLU A 82 ? ASN A 90 ? GLU A 80 ASN A 88 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 8 C ? ? ? 1_555 A MSE 9 N ? ? A ALA 6 A MSE 7 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A MSE 9 C ? ? ? 1_555 A TRP 10 N ? ? A MSE 7 A TRP 8 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A GLU 44 C ? ? ? 1_555 A MSE 45 N ? ? A GLU 42 A MSE 43 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A MSE 45 C ? ? ? 1_555 A ASN 46 N ? ? A MSE 43 A ASN 44 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 3 ? TRP A 10 ? LEU A 1 TRP A 8 A 2 GLN A 17 ? ARG A 27 ? GLN A 15 ARG A 25 A 3 ALA A 66 ? ASN A 76 ? ALA A 64 ASN A 74 B 1 VAL A 48 ? GLU A 55 ? VAL A 46 GLU A 53 B 2 ILE A 34 ? MSE A 45 ? ILE A 32 MSE A 43 B 3 LYS A 93 ? GLU A 105 ? LYS A 91 GLU A 103 B 4 VAL A 111 ? GLU A 112 ? VAL A 109 GLU A 110 C 1 VAL A 59 ? VAL A 61 ? VAL A 57 VAL A 59 C 2 ILE A 34 ? MSE A 45 ? ILE A 32 MSE A 43 C 3 LYS A 93 ? GLU A 105 ? LYS A 91 GLU A 103 C 4 PHE A 116 ? THR A 123 ? PHE A 114 THR A 121 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 4 ? N GLU A 2 O LYS A 25 ? O LYS A 23 A 2 3 N ALA A 24 ? N ALA A 22 O LEU A 69 ? O LEU A 67 B 1 2 O GLY A 53 ? O GLY A 51 N TYR A 41 ? N TYR A 39 B 2 3 N HIS A 40 ? N HIS A 38 O LYS A 101 ? O LYS A 99 B 3 4 N ILE A 104 ? N ILE A 102 O GLU A 112 ? O GLU A 110 C 1 2 O VAL A 59 ? O VAL A 57 N VAL A 36 ? N VAL A 34 C 2 3 N HIS A 40 ? N HIS A 38 O LYS A 101 ? O LYS A 99 C 3 4 N VAL A 98 ? N VAL A 96 O ARG A 118 ? O ARG A 116 # _database_PDB_matrix.entry_id 3BUT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3BUT _atom_sites.fract_transf_matrix[1][1] 0.007631 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.035298 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.033887 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -1 ? ? ? A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 LEU 3 1 1 LEU LEU A . n A 1 4 GLU 4 2 2 GLU GLU A . n A 1 5 SER 5 3 3 SER SER A . n A 1 6 VAL 6 4 4 VAL VAL A . n A 1 7 LYS 7 5 5 LYS LYS A . n A 1 8 ALA 8 6 6 ALA ALA A . n A 1 9 MSE 9 7 7 MSE MSE A . n A 1 10 TRP 10 8 8 TRP TRP A . n A 1 11 GLY 11 9 9 GLY GLY A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 VAL 13 11 11 VAL VAL A . n A 1 14 THR 14 12 12 THR THR A . n A 1 15 ASP 15 13 13 ASP ASP A . n A 1 16 SER 16 14 14 SER SER A . n A 1 17 GLN 17 15 15 GLN GLN A . n A 1 18 THR 18 16 16 THR THR A . n A 1 19 GLU 19 17 17 GLU GLU A . n A 1 20 ILE 20 18 18 ILE ILE A . n A 1 21 VAL 21 19 19 VAL VAL A . n A 1 22 ALA 22 20 20 ALA ALA A . n A 1 23 LEU 23 21 21 LEU LEU A . n A 1 24 ALA 24 22 22 ALA ALA A . n A 1 25 LYS 25 23 23 LYS LYS A . n A 1 26 VAL 26 24 24 VAL VAL A . n A 1 27 ARG 27 25 25 ARG ARG A . n A 1 28 ASN 28 26 26 ASN ASN A . n A 1 29 GLU 29 27 27 GLU GLU A . n A 1 30 ASP 30 28 28 ASP ASP A . n A 1 31 VAL 31 29 29 VAL VAL A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 PRO 33 31 31 PRO PRO A . n A 1 34 ILE 34 32 32 ILE ILE A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 VAL 36 34 34 VAL VAL A . n A 1 37 SER 37 35 35 SER SER A . n A 1 38 GLY 38 36 36 GLY GLY A . n A 1 39 TYR 39 37 37 TYR TYR A . n A 1 40 HIS 40 38 38 HIS HIS A . n A 1 41 TYR 41 39 39 TYR TYR A . n A 1 42 THR 42 40 40 THR THR A . n A 1 43 ILE 43 41 41 ILE ILE A . n A 1 44 GLU 44 42 42 GLU GLU A . n A 1 45 MSE 45 43 43 MSE MSE A . n A 1 46 ASN 46 44 44 ASN ASN A . n A 1 47 GLY 47 45 45 GLY GLY A . n A 1 48 VAL 48 46 46 VAL VAL A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 VAL 50 48 48 VAL VAL A . n A 1 51 ALA 51 49 49 ALA ALA A . n A 1 52 ASP 52 50 50 ASP ASP A . n A 1 53 GLY 53 51 51 GLY GLY A . n A 1 54 TYR 54 52 52 TYR TYR A . n A 1 55 GLU 55 53 53 GLU GLU A . n A 1 56 ASN 56 54 54 ASN ASN A . n A 1 57 SER 57 55 55 SER SER A . n A 1 58 PRO 58 56 56 PRO PRO A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 THR 60 58 58 THR THR A . n A 1 61 VAL 61 59 59 VAL VAL A . n A 1 62 LYS 62 60 60 LYS LYS A . n A 1 63 PRO 63 61 61 PRO PRO A . n A 1 64 ALA 64 62 62 ALA ALA A . n A 1 65 SER 65 63 63 SER SER A . n A 1 66 ALA 66 64 64 ALA ALA A . n A 1 67 THR 67 65 65 THR THR A . n A 1 68 THR 68 66 66 THR THR A . n A 1 69 LEU 69 67 67 LEU LEU A . n A 1 70 LYS 70 68 68 LYS LYS A . n A 1 71 PHE 71 69 69 PHE PHE A . n A 1 72 SER 72 70 70 SER SER A . n A 1 73 LEU 73 71 71 LEU LEU A . n A 1 74 ARG 74 72 72 ARG ARG A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 ASN 76 74 74 ASN ASN A . n A 1 77 ASN 77 75 75 ASN ASN A . n A 1 78 SER 78 76 76 SER SER A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 LEU 80 78 78 LEU LEU A . n A 1 81 ARG 81 79 79 ARG ARG A . n A 1 82 GLU 82 80 80 GLU GLU A . n A 1 83 TRP 83 81 81 TRP TRP A . n A 1 84 TRP 84 82 82 TRP TRP A . n A 1 85 VAL 85 83 83 VAL VAL A . n A 1 86 THR 86 84 84 THR THR A . n A 1 87 HIS 87 85 85 HIS HIS A . n A 1 88 ILE 88 86 86 ILE ILE A . n A 1 89 ALA 89 87 87 ALA ALA A . n A 1 90 ASN 90 88 88 ASN ASN A . n A 1 91 GLY 91 89 89 GLY GLY A . n A 1 92 GLU 92 90 90 GLU GLU A . n A 1 93 LYS 93 91 91 LYS LYS A . n A 1 94 THR 94 92 92 THR THR A . n A 1 95 LYS 95 93 93 LYS LYS A . n A 1 96 ILE 96 94 94 ILE ILE A . n A 1 97 ARG 97 95 95 ARG ARG A . n A 1 98 VAL 98 96 96 VAL VAL A . n A 1 99 ALA 99 97 97 ALA ALA A . n A 1 100 ILE 100 98 98 ILE ILE A . n A 1 101 LYS 101 99 99 LYS LYS A . n A 1 102 PRO 102 100 100 PRO PRO A . n A 1 103 THR 103 101 101 THR THR A . n A 1 104 ILE 104 102 102 ILE ILE A . n A 1 105 GLU 105 103 103 GLU GLU A . n A 1 106 ILE 106 104 104 ILE ILE A . n A 1 107 GLY 107 105 105 GLY GLY A . n A 1 108 GLY 108 106 ? ? ? A . n A 1 109 ARG 109 107 107 ARG ARG A . n A 1 110 ASP 110 108 108 ASP ASP A . n A 1 111 VAL 111 109 109 VAL VAL A . n A 1 112 GLU 112 110 110 GLU GLU A . n A 1 113 VAL 113 111 111 VAL VAL A . n A 1 114 PRO 114 112 112 PRO PRO A . n A 1 115 VAL 115 113 113 VAL VAL A . n A 1 116 PHE 116 114 114 PHE PHE A . n A 1 117 LEU 117 115 115 LEU LEU A . n A 1 118 ARG 118 116 116 ARG ARG A . n A 1 119 GLU 119 117 117 GLU GLU A . n A 1 120 SER 120 118 118 SER SER A . n A 1 121 GLU 121 119 119 GLU GLU A . n A 1 122 PHE 122 120 120 PHE PHE A . n A 1 123 THR 123 121 121 THR THR A . n A 1 124 THR 124 122 122 THR THR A . n A 1 125 LYS 125 123 123 LYS LYS A . n A 1 126 LEU 126 124 124 LEU LEU A . n A 1 127 LEU 127 125 125 LEU LEU A . n A 1 128 SER 128 126 ? ? ? A . n A 1 129 GLU 129 127 ? ? ? A . n A 1 130 GLY 130 128 ? ? ? A . n A 1 131 HIS 131 129 ? ? ? A . n A 1 132 HIS 132 130 ? ? ? A . n A 1 133 HIS 133 131 ? ? ? A . n A 1 134 HIS 134 132 ? ? ? A . n A 1 135 HIS 135 133 ? ? ? A . n A 1 136 HIS 136 134 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 135 5 HOH HOH A . B 2 HOH 2 136 6 HOH HOH A . B 2 HOH 3 137 7 HOH HOH A . B 2 HOH 4 138 8 HOH HOH A . B 2 HOH 5 139 9 HOH HOH A . B 2 HOH 6 140 10 HOH HOH A . B 2 HOH 7 141 11 HOH HOH A . B 2 HOH 8 142 12 HOH HOH A . B 2 HOH 9 143 13 HOH HOH A . B 2 HOH 10 144 15 HOH HOH A . B 2 HOH 11 145 16 HOH HOH A . B 2 HOH 12 146 17 HOH HOH A . B 2 HOH 13 147 19 HOH HOH A . B 2 HOH 14 148 20 HOH HOH A . B 2 HOH 15 149 25 HOH HOH A . B 2 HOH 16 150 26 HOH HOH A . B 2 HOH 17 151 28 HOH HOH A . B 2 HOH 18 152 29 HOH HOH A . B 2 HOH 19 153 30 HOH HOH A . B 2 HOH 20 154 31 HOH HOH A . B 2 HOH 21 155 32 HOH HOH A . B 2 HOH 22 156 33 HOH HOH A . B 2 HOH 23 157 34 HOH HOH A . B 2 HOH 24 158 35 HOH HOH A . B 2 HOH 25 159 36 HOH HOH A . B 2 HOH 26 160 37 HOH HOH A . B 2 HOH 27 161 38 HOH HOH A . B 2 HOH 28 162 39 HOH HOH A . B 2 HOH 29 163 40 HOH HOH A . B 2 HOH 30 164 41 HOH HOH A . B 2 HOH 31 165 42 HOH HOH A . B 2 HOH 32 166 43 HOH HOH A . B 2 HOH 33 167 44 HOH HOH A . B 2 HOH 34 168 45 HOH HOH A . B 2 HOH 35 169 46 HOH HOH A . B 2 HOH 36 170 47 HOH HOH A . B 2 HOH 37 171 48 HOH HOH A . B 2 HOH 38 172 49 HOH HOH A . B 2 HOH 39 173 50 HOH HOH A . B 2 HOH 40 174 51 HOH HOH A . B 2 HOH 41 175 52 HOH HOH A . B 2 HOH 42 176 2 HOH HOH A . B 2 HOH 43 177 3 HOH HOH A . B 2 HOH 44 178 5 HOH HOH A . B 2 HOH 45 179 6 HOH HOH A . B 2 HOH 46 180 8 HOH HOH A . B 2 HOH 47 181 10 HOH HOH A . B 2 HOH 48 182 11 HOH HOH A . B 2 HOH 49 183 12 HOH HOH A . B 2 HOH 50 184 13 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 9 A MSE 7 ? MET SELENOMETHIONINE 2 A MSE 45 A MSE 43 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_prop.biol_id 1 _pdbx_struct_assembly_prop.type 'ABSA (A^2)' _pdbx_struct_assembly_prop.value 1890 _pdbx_struct_assembly_prop.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_565 -x,-y+1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 28.3300000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-01-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 4 'Structure model' 1 3 2018-11-14 5 'Structure model' 1 4 2021-02-03 6 'Structure model' 1 5 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Structure summary' 9 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' audit_author 3 5 'Structure model' audit_author 4 5 'Structure model' citation_author 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_ref_seq_dif 7 6 'Structure model' database_2 8 6 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.name' 2 4 'Structure model' '_audit_author.identifier_ORCID' 3 5 'Structure model' '_audit_author.identifier_ORCID' 4 5 'Structure model' '_citation_author.identifier_ORCID' 5 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 5 'Structure model' '_struct_ref_seq_dif.details' 7 6 'Structure model' '_database_2.pdbx_DOI' 8 6 'Structure model' '_database_2.pdbx_database_accession' 9 6 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -17.6380 _pdbx_refine_tls.origin_y 7.9100 _pdbx_refine_tls.origin_z -8.0060 _pdbx_refine_tls.T[1][1] -0.0195 _pdbx_refine_tls.T[2][2] 0.0179 _pdbx_refine_tls.T[3][3] -0.0488 _pdbx_refine_tls.T[1][2] 0.0430 _pdbx_refine_tls.T[1][3] 0.0273 _pdbx_refine_tls.T[2][3] 0.0053 _pdbx_refine_tls.L[1][1] 7.7901 _pdbx_refine_tls.L[2][2] 4.7840 _pdbx_refine_tls.L[3][3] 0.1200 _pdbx_refine_tls.L[1][2] 4.4907 _pdbx_refine_tls.L[1][3] 0.3151 _pdbx_refine_tls.L[2][3] -0.0534 _pdbx_refine_tls.S[1][1] -0.0649 _pdbx_refine_tls.S[1][2] 0.2184 _pdbx_refine_tls.S[1][3] 0.2178 _pdbx_refine_tls.S[2][1] -0.1533 _pdbx_refine_tls.S[2][2] 0.0294 _pdbx_refine_tls.S[2][3] -0.0455 _pdbx_refine_tls.S[3][1] 0.0289 _pdbx_refine_tls.S[3][2] 0.0474 _pdbx_refine_tls.S[3][3] 0.0354 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 0 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 2 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 125 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 127 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHELX 'model building' . ? 1 REFMAC refinement 5.3.0034 ? 2 MAR345 'data collection' CCD ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 SHELXD phasing . ? 6 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 50 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -163.35 _pdbx_validate_torsion.psi 97.77 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -1 ? A MSE 1 2 1 Y 1 A GLY 106 ? A GLY 108 3 1 Y 1 A SER 126 ? A SER 128 4 1 Y 1 A GLU 127 ? A GLU 129 5 1 Y 1 A GLY 128 ? A GLY 130 6 1 Y 1 A HIS 129 ? A HIS 131 7 1 Y 1 A HIS 130 ? A HIS 132 8 1 Y 1 A HIS 131 ? A HIS 133 9 1 Y 1 A HIS 132 ? A HIS 134 10 1 Y 1 A HIS 133 ? A HIS 135 11 1 Y 1 A HIS 134 ? A HIS 136 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #