data_3CWK # _entry.id 3CWK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3CWK pdb_00003cwk 10.2210/pdb3cwk/pdb RCSB RCSB047299 ? ? WWPDB D_1000047299 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2fr3 . unspecified PDB 2frs . unspecified PDB 2fs6 . unspecified PDB 2g7b . unspecified PDB 2g78 . unspecified PDB 2g79 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3CWK _pdbx_database_status.recvd_initial_deposition_date 2008-04-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vaezeslami, S.' 1 'Geiger, J.H.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Structural analysis of site-directed mutants of cellular retinoic acid-binding protein II addresses the relationship between structural integrity and ligand binding. ; 'Acta Crystallogr.,Sect.D' 64 1228 1239 2008 ABCRE6 DK 0907-4449 0766 ? 19018099 10.1107/S0907444908032216 1 ;Determining Crystal Structures of Proteins and Protein Complexes by X-Ray Crystallography: X-Ray Crystallographic Studies of the Mutants of Cellular Retinoic Acid Binding Protein Type II Toward Designing a Mimic of Rhodopsin ; Thesis ? ? ? ? ? ? ? ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vaezeslami, S.' 1 ? primary 'Jia, X.' 2 ? primary 'Vasileiou, C.' 3 ? primary 'Borhan, B.' 4 ? primary 'Geiger, J.H.' 5 ? 1 'Vaezeslami, S.' 6 ? # _cell.entry_id 3CWK _cell.length_a 45.787 _cell.length_b 44.860 _cell.length_c 77.865 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3CWK _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cellular retinoic acid-binding protein 2' 15507.735 1 ? 'T54V, R111L, L121E, R132K, Y134F' ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'RETINOIC ACID' 300.435 1 ? ? ? ? 4 water nat water 18.015 221 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cellular retinoic acid-binding protein II, CRABP-II, Retinoic acid-binding protein II, cellular' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKVSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELIETMTADDVVCTKVFVRE ; _entity_poly.pdbx_seq_one_letter_code_can ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKVSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELIETMTADDVVCTKVFVRE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ASN n 1 3 PHE n 1 4 SER n 1 5 GLY n 1 6 ASN n 1 7 TRP n 1 8 LYS n 1 9 ILE n 1 10 ILE n 1 11 ARG n 1 12 SER n 1 13 GLU n 1 14 ASN n 1 15 PHE n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 LEU n 1 20 LYS n 1 21 VAL n 1 22 LEU n 1 23 GLY n 1 24 VAL n 1 25 ASN n 1 26 VAL n 1 27 MET n 1 28 LEU n 1 29 ARG n 1 30 LYS n 1 31 ILE n 1 32 ALA n 1 33 VAL n 1 34 ALA n 1 35 ALA n 1 36 ALA n 1 37 SER n 1 38 LYS n 1 39 PRO n 1 40 ALA n 1 41 VAL n 1 42 GLU n 1 43 ILE n 1 44 LYS n 1 45 GLN n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 THR n 1 50 PHE n 1 51 TYR n 1 52 ILE n 1 53 LYS n 1 54 VAL n 1 55 SER n 1 56 THR n 1 57 THR n 1 58 VAL n 1 59 ARG n 1 60 THR n 1 61 THR n 1 62 GLU n 1 63 ILE n 1 64 ASN n 1 65 PHE n 1 66 LYS n 1 67 VAL n 1 68 GLY n 1 69 GLU n 1 70 GLU n 1 71 PHE n 1 72 GLU n 1 73 GLU n 1 74 GLN n 1 75 THR n 1 76 VAL n 1 77 ASP n 1 78 GLY n 1 79 ARG n 1 80 PRO n 1 81 CYS n 1 82 LYS n 1 83 SER n 1 84 LEU n 1 85 VAL n 1 86 LYS n 1 87 TRP n 1 88 GLU n 1 89 SER n 1 90 GLU n 1 91 ASN n 1 92 LYS n 1 93 MET n 1 94 VAL n 1 95 CYS n 1 96 GLU n 1 97 GLN n 1 98 LYS n 1 99 LEU n 1 100 LEU n 1 101 LYS n 1 102 GLY n 1 103 GLU n 1 104 GLY n 1 105 PRO n 1 106 LYS n 1 107 THR n 1 108 SER n 1 109 TRP n 1 110 THR n 1 111 LEU n 1 112 GLU n 1 113 LEU n 1 114 THR n 1 115 ASN n 1 116 ASP n 1 117 GLY n 1 118 GLU n 1 119 LEU n 1 120 ILE n 1 121 GLU n 1 122 THR n 1 123 MET n 1 124 THR n 1 125 ALA n 1 126 ASP n 1 127 ASP n 1 128 VAL n 1 129 VAL n 1 130 CYS n 1 131 THR n 1 132 LYS n 1 133 VAL n 1 134 PHE n 1 135 VAL n 1 136 ARG n 1 137 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CRABP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET17-B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RABP2_HUMAN _struct_ref.pdbx_db_accession P29373 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3CWK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29373 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 137 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3CWK VAL A 54 ? UNP P29373 THR 55 'engineered mutation' 54 1 1 3CWK LEU A 111 ? UNP P29373 ARG 112 'engineered mutation' 111 2 1 3CWK GLU A 121 ? UNP P29373 LEU 122 'engineered mutation' 121 3 1 3CWK LYS A 132 ? UNP P29373 ARG 133 'engineered mutation' 132 4 1 3CWK PHE A 134 ? UNP P29373 TYR 135 'engineered mutation' 134 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 REA non-polymer . 'RETINOIC ACID' ? 'C20 H28 O2' 300.435 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3CWK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_percent_sol 52.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.50 _exptl_crystal_grow.pdbx_details '0.1 M MES, 30% (W/V) PEG 5000, 0.2 M AMMONIUM SULFATE, pH 6.50, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 77.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2004-03-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 32-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 32-ID _diffrn_source.pdbx_wavelength 1.000 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3CWK _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 1.600 _reflns.number_obs 21826 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 27.2800 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.66 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.157 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3CWK _refine.ls_number_reflns_obs 19203 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.47 _refine.ls_d_res_high 1.60 _refine.ls_percent_reflns_obs 97.7 _refine.ls_R_factor_obs 0.125 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.12 _refine.ls_R_factor_R_free 0.167 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.900 _refine.ls_number_reflns_R_free 2110 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.975 _refine.correlation_coeff_Fo_to_Fc_free 0.960 _refine.B_iso_mean 14.29 _refine.aniso_B[1][1] 0.56000 _refine.aniso_B[2][2] 0.13000 _refine.aniso_B[3][3] -0.69000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'RIGID BODY REFINEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.093 _refine.pdbx_overall_ESU_R_Free 0.076 _refine.overall_SU_ML 0.036 _refine.overall_SU_B 2.150 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1146 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 238 _refine_hist.number_atoms_total 1411 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 39.47 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.020 0.022 ? 1190 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 1122 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.881 1.984 ? 1615 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.965 3.000 ? 2635 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.231 5.000 ? 140 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.979 26.000 ? 55 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.332 15.000 ? 238 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 9.868 15.000 ? 6 'X-RAY DIFFRACTION' ? r_chiral_restr 0.125 0.200 ? 193 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1259 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 208 'X-RAY DIFFRACTION' ? r_nbd_refined 0.212 0.200 ? 202 'X-RAY DIFFRACTION' ? r_nbd_other 0.201 0.200 ? 1141 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.180 0.200 ? 578 'X-RAY DIFFRACTION' ? r_nbtor_other 0.086 0.200 ? 792 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.193 0.200 ? 174 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.223 0.200 ? 8 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.314 0.200 ? 50 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.144 0.200 ? 20 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.247 1.500 ? 907 'X-RAY DIFFRACTION' ? r_mcbond_other 0.811 1.500 ? 282 'X-RAY DIFFRACTION' ? r_mcangle_it 2.570 2.000 ? 1164 'X-RAY DIFFRACTION' ? r_scbond_it 3.909 3.000 ? 558 'X-RAY DIFFRACTION' ? r_scangle_it 5.127 4.500 ? 449 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 2.305 3.000 ? 2743 'X-RAY DIFFRACTION' ? r_sphericity_free 9.116 3.000 ? 238 'X-RAY DIFFRACTION' ? r_sphericity_bonded 3.686 3.000 ? 2295 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.60 _refine_ls_shell.d_res_low 1.64 _refine_ls_shell.number_reflns_R_work 1139 _refine_ls_shell.R_factor_R_work 0.115 _refine_ls_shell.percent_reflns_obs 79.09 _refine_ls_shell.R_factor_R_free 0.193 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 113 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3CWK _struct.title ;Crystal Structure of the R132K:Y134F:R111L:T54V:L121E Mutant of Cellular Retinoic Acid Binding Protein Type II in Complex with All-trans-Retinoic Acid at 1.57 Angstroms Resolution ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3CWK _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text ;CRABPII, RETINOIC ACID, RETINOIDS, BETA BARREL, HIGH RESOLUTION, Cytoplasm, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 14 ? LEU A 22 ? ASN A 14 LEU A 22 1 ? 9 HELX_P HELX_P2 2 ASN A 25 ? SER A 37 ? ASN A 25 SER A 37 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 59 ? LYS A 66 ? ARG A 59 LYS A 66 A 2 THR A 49 ? THR A 56 ? THR A 49 THR A 56 A 3 ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 A 4 GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 A 5 VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 A 6 LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 A 7 THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 A 8 LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 A 9 PRO A 80 ? SER A 89 ? PRO A 80 SER A 89 A 10 PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 65 ? O PHE A 65 N PHE A 50 ? N PHE A 50 A 2 3 O LYS A 53 ? O LYS A 53 N GLU A 42 ? N GLU A 42 A 3 4 O VAL A 41 ? O VAL A 41 N TRP A 7 ? N TRP A 7 A 4 5 N LYS A 8 ? N LYS A 8 O VAL A 135 ? O VAL A 135 A 5 6 O CYS A 130 ? O CYS A 130 N MET A 123 ? N MET A 123 A 6 7 O ILE A 120 ? O ILE A 120 N GLU A 112 ? N GLU A 112 A 7 8 O TRP A 109 ? O TRP A 109 N CYS A 95 ? N CYS A 95 A 8 9 O VAL A 94 ? O VAL A 94 N LYS A 86 ? N LYS A 86 A 9 10 O SER A 83 ? O SER A 83 N PHE A 71 ? N PHE A 71 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 400 ? 6 'BINDING SITE FOR RESIDUE SO4 A 400' AC2 Software A REA 300 ? 7 'BINDING SITE FOR RESIDUE REA A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LYS A 86 ? LYS A 86 . ? 4_556 ? 2 AC1 6 LEU A 113 ? LEU A 113 . ? 1_555 ? 3 AC1 6 THR A 114 ? THR A 114 . ? 1_555 ? 4 AC1 6 ASN A 115 ? ASN A 115 . ? 1_555 ? 5 AC1 6 HOH D . ? HOH A 517 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 583 . ? 1_555 ? 7 AC2 7 GLU A 13 ? GLU A 13 . ? 3_655 ? 8 AC2 7 LEU A 19 ? LEU A 19 . ? 1_555 ? 9 AC2 7 ALA A 32 ? ALA A 32 . ? 1_555 ? 10 AC2 7 GLU A 121 ? GLU A 121 . ? 1_555 ? 11 AC2 7 LYS A 132 ? LYS A 132 . ? 1_555 ? 12 AC2 7 HOH D . ? HOH A 401 . ? 1_555 ? 13 AC2 7 HOH D . ? HOH A 590 . ? 1_555 ? # _database_PDB_matrix.entry_id 3CWK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3CWK _atom_sites.fract_transf_matrix[1][1] 0.021840 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022290 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012840 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLU 137 137 137 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 400 400 SO4 SO4 A . C 3 REA 1 300 300 REA REA A . D 4 HOH 1 401 1 HOH HOH A . D 4 HOH 2 402 2 HOH HOH A . D 4 HOH 3 403 3 HOH HOH A . D 4 HOH 4 404 4 HOH HOH A . D 4 HOH 5 405 5 HOH HOH A . D 4 HOH 6 406 6 HOH HOH A . D 4 HOH 7 407 7 HOH HOH A . D 4 HOH 8 408 8 HOH HOH A . D 4 HOH 9 409 9 HOH HOH A . D 4 HOH 10 410 10 HOH HOH A . D 4 HOH 11 411 11 HOH HOH A . D 4 HOH 12 412 12 HOH HOH A . D 4 HOH 13 413 13 HOH HOH A . D 4 HOH 14 414 14 HOH HOH A . D 4 HOH 15 415 15 HOH HOH A . D 4 HOH 16 416 16 HOH HOH A . D 4 HOH 17 417 17 HOH HOH A . D 4 HOH 18 418 18 HOH HOH A . D 4 HOH 19 419 19 HOH HOH A . D 4 HOH 20 420 20 HOH HOH A . D 4 HOH 21 421 21 HOH HOH A . D 4 HOH 22 422 22 HOH HOH A . D 4 HOH 23 423 23 HOH HOH A . D 4 HOH 24 424 24 HOH HOH A . D 4 HOH 25 425 25 HOH HOH A . D 4 HOH 26 426 26 HOH HOH A . D 4 HOH 27 427 27 HOH HOH A . D 4 HOH 28 428 28 HOH HOH A . D 4 HOH 29 429 29 HOH HOH A . D 4 HOH 30 430 30 HOH HOH A . D 4 HOH 31 431 31 HOH HOH A . D 4 HOH 32 432 32 HOH HOH A . D 4 HOH 33 433 33 HOH HOH A . D 4 HOH 34 434 34 HOH HOH A . D 4 HOH 35 435 35 HOH HOH A . D 4 HOH 36 436 36 HOH HOH A . D 4 HOH 37 437 37 HOH HOH A . D 4 HOH 38 438 38 HOH HOH A . D 4 HOH 39 439 39 HOH HOH A . D 4 HOH 40 440 40 HOH HOH A . D 4 HOH 41 441 41 HOH HOH A . D 4 HOH 42 442 42 HOH HOH A . D 4 HOH 43 443 43 HOH HOH A . D 4 HOH 44 444 44 HOH HOH A . D 4 HOH 45 445 45 HOH HOH A . D 4 HOH 46 446 46 HOH HOH A . D 4 HOH 47 447 47 HOH HOH A . D 4 HOH 48 448 48 HOH HOH A . D 4 HOH 49 449 49 HOH HOH A . D 4 HOH 50 450 50 HOH HOH A . D 4 HOH 51 451 51 HOH HOH A . D 4 HOH 52 452 52 HOH HOH A . D 4 HOH 53 453 53 HOH HOH A . D 4 HOH 54 454 54 HOH HOH A . D 4 HOH 55 455 55 HOH HOH A . D 4 HOH 56 456 56 HOH HOH A . D 4 HOH 57 457 57 HOH HOH A . D 4 HOH 58 458 58 HOH HOH A . D 4 HOH 59 459 59 HOH HOH A . D 4 HOH 60 460 60 HOH HOH A . D 4 HOH 61 461 61 HOH HOH A . D 4 HOH 62 462 62 HOH HOH A . D 4 HOH 63 463 63 HOH HOH A . D 4 HOH 64 464 64 HOH HOH A . D 4 HOH 65 465 65 HOH HOH A . D 4 HOH 66 466 66 HOH HOH A . D 4 HOH 67 467 67 HOH HOH A . D 4 HOH 68 468 68 HOH HOH A . D 4 HOH 69 469 69 HOH HOH A . D 4 HOH 70 470 70 HOH HOH A . D 4 HOH 71 471 71 HOH HOH A . D 4 HOH 72 472 72 HOH HOH A . D 4 HOH 73 473 73 HOH HOH A . D 4 HOH 74 474 74 HOH HOH A . D 4 HOH 75 475 75 HOH HOH A . D 4 HOH 76 476 76 HOH HOH A . D 4 HOH 77 477 77 HOH HOH A . D 4 HOH 78 478 78 HOH HOH A . D 4 HOH 79 479 79 HOH HOH A . D 4 HOH 80 480 80 HOH HOH A . D 4 HOH 81 481 81 HOH HOH A . D 4 HOH 82 482 82 HOH HOH A . D 4 HOH 83 483 83 HOH HOH A . D 4 HOH 84 484 84 HOH HOH A . D 4 HOH 85 485 85 HOH HOH A . D 4 HOH 86 486 86 HOH HOH A . D 4 HOH 87 487 87 HOH HOH A . D 4 HOH 88 488 88 HOH HOH A . D 4 HOH 89 489 89 HOH HOH A . D 4 HOH 90 490 90 HOH HOH A . D 4 HOH 91 491 91 HOH HOH A . D 4 HOH 92 492 92 HOH HOH A . D 4 HOH 93 493 93 HOH HOH A . D 4 HOH 94 494 94 HOH HOH A . D 4 HOH 95 495 95 HOH HOH A . D 4 HOH 96 496 96 HOH HOH A . D 4 HOH 97 497 97 HOH HOH A . D 4 HOH 98 498 98 HOH HOH A . D 4 HOH 99 499 99 HOH HOH A . D 4 HOH 100 500 100 HOH HOH A . D 4 HOH 101 501 101 HOH HOH A . D 4 HOH 102 502 102 HOH HOH A . D 4 HOH 103 503 103 HOH HOH A . D 4 HOH 104 504 104 HOH HOH A . D 4 HOH 105 505 105 HOH HOH A . D 4 HOH 106 506 106 HOH HOH A . D 4 HOH 107 507 107 HOH HOH A . D 4 HOH 108 508 108 HOH HOH A . D 4 HOH 109 509 109 HOH HOH A . D 4 HOH 110 510 110 HOH HOH A . D 4 HOH 111 511 111 HOH HOH A . D 4 HOH 112 512 112 HOH HOH A . D 4 HOH 113 513 113 HOH HOH A . D 4 HOH 114 514 114 HOH HOH A . D 4 HOH 115 515 115 HOH HOH A . D 4 HOH 116 516 116 HOH HOH A . D 4 HOH 117 517 117 HOH HOH A . D 4 HOH 118 518 118 HOH HOH A . D 4 HOH 119 519 119 HOH HOH A . D 4 HOH 120 520 120 HOH HOH A . D 4 HOH 121 521 121 HOH HOH A . D 4 HOH 122 522 122 HOH HOH A . D 4 HOH 123 523 123 HOH HOH A . D 4 HOH 124 524 124 HOH HOH A . D 4 HOH 125 525 125 HOH HOH A . D 4 HOH 126 526 126 HOH HOH A . D 4 HOH 127 527 127 HOH HOH A . D 4 HOH 128 528 128 HOH HOH A . D 4 HOH 129 529 129 HOH HOH A . D 4 HOH 130 530 130 HOH HOH A . D 4 HOH 131 531 131 HOH HOH A . D 4 HOH 132 532 132 HOH HOH A . D 4 HOH 133 533 133 HOH HOH A . D 4 HOH 134 534 134 HOH HOH A . D 4 HOH 135 535 135 HOH HOH A . D 4 HOH 136 536 136 HOH HOH A . D 4 HOH 137 537 137 HOH HOH A . D 4 HOH 138 538 138 HOH HOH A . D 4 HOH 139 539 139 HOH HOH A . D 4 HOH 140 540 140 HOH HOH A . D 4 HOH 141 541 141 HOH HOH A . D 4 HOH 142 542 142 HOH HOH A . D 4 HOH 143 543 143 HOH HOH A . D 4 HOH 144 544 144 HOH HOH A . D 4 HOH 145 545 145 HOH HOH A . D 4 HOH 146 546 146 HOH HOH A . D 4 HOH 147 547 147 HOH HOH A . D 4 HOH 148 548 148 HOH HOH A . D 4 HOH 149 549 149 HOH HOH A . D 4 HOH 150 550 150 HOH HOH A . D 4 HOH 151 551 151 HOH HOH A . D 4 HOH 152 552 152 HOH HOH A . D 4 HOH 153 553 153 HOH HOH A . D 4 HOH 154 554 154 HOH HOH A . D 4 HOH 155 555 155 HOH HOH A . D 4 HOH 156 556 156 HOH HOH A . D 4 HOH 157 557 157 HOH HOH A . D 4 HOH 158 558 158 HOH HOH A . D 4 HOH 159 559 159 HOH HOH A . D 4 HOH 160 560 160 HOH HOH A . D 4 HOH 161 561 161 HOH HOH A . D 4 HOH 162 562 162 HOH HOH A . D 4 HOH 163 563 163 HOH HOH A . D 4 HOH 164 564 164 HOH HOH A . D 4 HOH 165 565 165 HOH HOH A . D 4 HOH 166 566 166 HOH HOH A . D 4 HOH 167 567 167 HOH HOH A . D 4 HOH 168 568 168 HOH HOH A . D 4 HOH 169 569 169 HOH HOH A . D 4 HOH 170 570 170 HOH HOH A . D 4 HOH 171 571 171 HOH HOH A . D 4 HOH 172 572 172 HOH HOH A . D 4 HOH 173 573 173 HOH HOH A . D 4 HOH 174 574 174 HOH HOH A . D 4 HOH 175 575 175 HOH HOH A . D 4 HOH 176 576 176 HOH HOH A . D 4 HOH 177 577 177 HOH HOH A . D 4 HOH 178 578 178 HOH HOH A . D 4 HOH 179 579 179 HOH HOH A . D 4 HOH 180 580 180 HOH HOH A . D 4 HOH 181 581 181 HOH HOH A . D 4 HOH 182 582 182 HOH HOH A . D 4 HOH 183 583 183 HOH HOH A . D 4 HOH 184 584 184 HOH HOH A . D 4 HOH 185 585 185 HOH HOH A . D 4 HOH 186 586 186 HOH HOH A . D 4 HOH 187 587 187 HOH HOH A . D 4 HOH 188 588 188 HOH HOH A . D 4 HOH 189 589 189 HOH HOH A . D 4 HOH 190 590 190 HOH HOH A . D 4 HOH 191 591 191 HOH HOH A . D 4 HOH 192 592 192 HOH HOH A . D 4 HOH 193 593 193 HOH HOH A . D 4 HOH 194 594 194 HOH HOH A . D 4 HOH 195 595 195 HOH HOH A . D 4 HOH 196 596 196 HOH HOH A . D 4 HOH 197 597 197 HOH HOH A . D 4 HOH 198 598 198 HOH HOH A . D 4 HOH 199 599 199 HOH HOH A . D 4 HOH 200 600 200 HOH HOH A . D 4 HOH 201 601 201 HOH HOH A . D 4 HOH 202 602 202 HOH HOH A . D 4 HOH 203 603 203 HOH HOH A . D 4 HOH 204 604 204 HOH HOH A . D 4 HOH 205 605 205 HOH HOH A . D 4 HOH 206 606 206 HOH HOH A . D 4 HOH 207 607 207 HOH HOH A . D 4 HOH 208 608 208 HOH HOH A . D 4 HOH 209 609 209 HOH HOH A . D 4 HOH 210 610 210 HOH HOH A . D 4 HOH 211 611 211 HOH HOH A . D 4 HOH 212 612 212 HOH HOH A . D 4 HOH 213 613 213 HOH HOH A . D 4 HOH 214 614 214 HOH HOH A . D 4 HOH 215 615 215 HOH HOH A . D 4 HOH 216 616 216 HOH HOH A . D 4 HOH 217 617 217 HOH HOH A . D 4 HOH 218 618 218 HOH HOH A . D 4 HOH 219 619 219 HOH HOH A . D 4 HOH 220 620 220 HOH HOH A . D 4 HOH 221 621 221 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' database_2 3 4 'Structure model' struct_ref_seq_dif 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 REFMAC phasing 5.2.0005 ? 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 79 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 A _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 79 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 A _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 79 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 A _pdbx_validate_rmsd_angle.angle_value 123.57 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.27 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 73 ? ? -146.75 -151.32 2 1 ASP A 126 ? ? 51.30 -116.66 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 30 ? CG ? A LYS 30 CG 2 1 Y 1 A LYS 30 ? CD ? A LYS 30 CD 3 1 Y 1 A LYS 30 ? CE ? A LYS 30 CE 4 1 Y 1 A LYS 30 ? NZ ? A LYS 30 NZ 5 1 Y 1 A LYS 38 ? CG ? A LYS 38 CG 6 1 Y 1 A LYS 38 ? CD ? A LYS 38 CD 7 1 Y 1 A LYS 38 ? CE ? A LYS 38 CE 8 1 Y 1 A LYS 38 ? NZ ? A LYS 38 NZ 9 1 Y 1 A LYS 101 ? CG ? A LYS 101 CG 10 1 Y 1 A LYS 101 ? CD ? A LYS 101 CD 11 1 Y 1 A LYS 101 ? CE ? A LYS 101 CE 12 1 Y 1 A LYS 101 ? NZ ? A LYS 101 NZ # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'RETINOIC ACID' REA 4 water HOH #